Séquençage et Assemblage. de Génomes. François Denizot Emmanuel Talla LCB-IBSM CNRS

Dimension: px
Commencer à balayer dès la page:

Download "Séquençage et Assemblage. de Génomes. François Denizot Emmanuel Talla LCB-IBSM CNRS denizot@ibsm.cnrs-mrs.fr talla@ibsm.cnrs-mrs."

Transcription

1 Séquençage et Assemblage de Génomes François Denizot Emmanuel Talla LCB-IBSM CNRS

2 Projet de séquençage d un génome Séquençage aléatoire Assemblage Annotation Data Release Library construction Assembler Genome scaffold Gene finding Publication Colony picking Combinatorial PCR Homology searches Template preparation Initial role assignments Sequencing reactions Base calling Ordered contig set Gap closure sequence editing Metabolic pathways Gene families Comparative genomics Sequence files Sample tracking Re-assembly ONE ASSEMBLY! Transcriptional/ translational regularory elements Repetitive sequences 2

3 Technologie de séquençage Malgré de nombreuses tentatives de mise au point de nouvelles méthodologies de séquençage d ADN, c est toujours la technique développée par F. Sanger qui est utilisée: Sanger F, Nicklen S, Coulson AR. (1977) DNA sequencing with chain-terminating inhibitors. Proc Natl Acad Sci U S A. 74:

4

5 Original Sanger Sequencing A mixture of dntps and a single ddntp is used in the reaction tubes. We can start with 4 different reaction tubes, each with all four dntps (datp, dgtp, dttp, dctp) and ONLY one of either dda, ddc, ddg and ddt (only 1%). The key is MOST of the nucleotides are regular ones, and just a fraction of them are dideoxynucleotides.

6 DNA Sequencing begins with replication (similar to PCR)

7

8

9 Séquençage automatique Générer à partir d une extrémité fixe tous les fragments d ADN se terminant par une base donnée Utilisation d un oligonucléotide qui après hybridation à sa matrice simple brin, sert d amorce à une réaction de polymérisation enzymatique

10

11

12 Séparation et détection des fragments

13

14

15 Applied Biosystems 3730xl DNA Analyzer Séquenceur à capillaires pour plaques 96 puits. 1 run ~ 2 heures 10 runs /jours 960 lectures /jours ~1000 bases /lectures bases / jours

16 Automatisation de toutes les étapes Préparation des matrices Réactions de séquence Séparation et détection des fragments Analyse informatique

17 Préparation des matrices Réactions de séquence Séparation et détection des fragments Intégration des éléments dans une chaîne de production Analyse informatique Eviter les goulots d étranglement dans le processus Multiplier les éléments en parallèle USINE Permettant le séquençage d ADN à haut débit

18 Cependant! Limitation importante de la technique!

19 Les contraintes Nécessité de fragmenter le DNA génomique Clonage des fragments en vue de leur amplification Séquençage (souvent partiel) des fragments ou sous-fragments Reconstitution de la séquence d origine

20 DNA fragmentation (mécanique ou enzymatique) Shotgun Clonage dans un vecteur

21 puc (insert jusqu à 10 Kb) (insert jusqu à 45 Kb) (insert jusqu à 100 Kb) (insert 300 Kb) (insert jusqu à 1 Mb, mais réarrangements fréquents)

22 Séquençage des extrémités de chaque insert TTCGATGCTAAAGCTAATCGAAGGGCTTA AAGCTACGATTT GA Élimination des fragments de séquence du vecteur

23 Stratégies de séquençage des génomes

24 Petits génomes peu complexes Grands génomes Forte complexité Mixage des deux approches

25 Le génome du rat «Brown Norway» 2,75 Gb Taille des fragments clonés: <10, 10, 50 et >150kb Profondeur (couverture) ~7X ixage des deux approches Gibbs RA et al. Nature Apr 1;428(6982):

26 Le génome humain (consortium) 3 Gb Ordonnancement des clones (entre eux et sur le chromosome): Comparaison des profils de restriction Hybridation des clones entre eux

27 Finger Print Migration de chaque digestion de BAC Logiciel FPC Minimal Tiling Path X % de fragment "communs" = BACs probablement chevauchant

28 Ordered cloning People who don't trust software generally put a lot of time into dividing large pieces of DNA into small ordered overlapping fragments This strategy requires much more initial cloning work in the laboratory but it minimizes the number of actual sequencing reads required to complete a project It is easy to assemble the reads since it is known how they should fit together to form the final contig

29 Primer Walking Make a new primer from the end of each new sequence read It requires very fast and accurate analysis of sequence reads since each step uses information from the previous read Skips sub-cloing step entirely since all sequencing reactions can be done on one large clone Expensive to make a lot of PCR primers but the price of primer synthesis keeps dropping & there is an economy of scale Assembly problems are minimized since both the order and the amount of overlap of reads are known

30 Shotgun Sequencing Shotgun sequencing takes maximum advantage of the speed and low cost of automated sequencing relies totally on software to assembly a jumble of essentially random sequence reads into a coherent and accurate contig TIGR demonstrated proof of concept on the genomes of Haemophilus influenzae, Methanococcus jannaschii, and Mycoplasma genitalium Celera Genomics demonstrated the ability to shotgun sequence the entire human genome (?)

31 Problems with shotgun sequencing Some sequences are uncloneable; therefore gaps will remain even with redundant coverage Random picking leaves gaps Sample failure of around 20% in the sequencing process is common Sequencing a 40 kb cosmid may require production of 400 kb of raw sequence, with the need for additional sequencing to close gaps Shotgun sequencing is still the most commonly used strategy for sequencing -- it s less labor-intensive than creating nested libraries of ordered subclones.

32 Projet de séquençage d un génome Séquençage aléatoire Assemblage Annotation Data Release Library construction Assembler Genome scaffold Gene finding Publication Colony picking Combinatorial PCR Homology searches Template preparation Initial role assignments Sequencing reactions Base calling Ordered contig set Gap closure sequence editing Metabolic pathways Gene families Comparative genomics Sequence files Sample tracking Re-assembly ONE ASSEMBLY! Transcriptional/ translational regularory elements Repetitive sequences 32

33 A Genome Assembling Project Assemblage Assembler Genome scaffold - Théorie du contigage - Outils d assemblage Combinatorial PCR Ordered contig set Gap closure sequence editing -Etapes de finition - Difficultés et résolution Re-assembly ONE ASSEMBLY!

34 Théorie du contigage

35 La couverture d un contig: un exemple Couverture Contig Reads Pour prévoir une assez bonne couverture de ces contigs lors de l assemblage, il existe une méthode statistique (Lander- Waterman) permettant de determiner le nombre de clones à séquencer, le nombre de contigs prévisibles.

36 Théorie du contigage (Lander-Waterman statistics) (#ilôts) = Ne -cσ (taille des ilôts) = L(e cσ 1) / c + 1 σ L = longueur de la lecture T = chevauchement minimum G = Taille du génome N = Nombre de lectures c = couverture (NL / G) σ = 1 T/L contig = ilôts d au moins 2 lectures

37 Ilôts vs Contigs c N #ilôts #contigs 1 1, , , , G: 1 Mpb L: 600pb T: 40pb

38 Chromobacterium violaceum genome project

39 Outils et programmes d assemblages

40 Le Defi!!!! Image original Pièces du puzzle Reconstruction de l image La mission s apparente à resoudre un puzzle unidimentionnelle avec des centaines de milliers (voire des millions) de pieces et sans l image d origine, bien sur!!!!!!

41 Comment s y prendre? Chromatogramme Programmes d assemblage Sequence complète

42 Sequençage automatique -La plupart des sequençages automatiques utilisent la méthode enzymatique de terminaison de chaine de Sanger (1977), et des marqueurs fluorescents -Séparation des fragments par électrophorese sur gel -Lecture des fragments marques.

43 Sequençage automatique Analyse informatique des images du gel: - lane tracking identifier chaque ligne - trace processing Estimation de l intensité du signal (et bruit de fond) - lane profiling Creation du profile (trace) de chaque chromatogramme - base-calling Transformation des profiles de bases (sequence) Le programme Phred est devenu quasi-standard pour le base calling

44 Base calling - Phred Taux d erreurs varient de 1-17%

45 Base calling - Phred race idéale consiste en: -pics espacés et non hevauchantes Qualité supérieure Aucune ambiguité races généralement btenues different de idéal à cause des: imperfections des éactions de séquençage, e l électrophorèse, ou du trace processing xtremités de la trace Qualité moyenne quelques ambiguités Qualité faible confiance faible

46 Phred quality values q = - 10 log 10 (p) avec: q - quality value p - estimated probability error for a base call Examples: q = 20 means p = 10-2 (1 error in 100 bases) q = 40 means p = 10-4 (1 error in 10,000 bases)

47 Phred Taches effectués par Phred: a. Lire les traces compatible avec la plupart des formats de sequences: SCF (standard), ABI (373/377/3700), ESD (MegaBACE) and LI-COR. b. Base Calling c. Assigne une valeur qualité à chaque base. d. Créer un fichier de séquence et un fichier qualité e. Modifier les chromatogrammes ( vector trimming )

48 Phred BEGIN_SEQUENCE a112e211b.b BEGIN_COMMENT phd2fasta phred Projet.fasta >a112a1.b... ACTGCTCGATGTGTGTG ACTGCTAGCTAGCTAGTC... >a112a2.b ACTGCATGTTCGATCGTAGC... >a112a1.b >a112a2.b Projet.fasta.qual.phd.1 CHROMAT_FILE: a112e211b.b ABI_THUMBPRINT: 0 PHRED_VERSION: c CALL_METHOD: phred QUALITY_LEVELS: 99 TIME: Mon Jan 15 11:27: TRACE_ARRAY_MIN_INDEX: 0 TRACE_ARRAY_MAX_INDEX: TRIM: CHEM: term DYE: big END_COMMENT BEGIN_DNA n 0 5 t 4 24 t 6 35 g 6 44 a 6 71 g 6 92 t t

49 Phred >a112a1.b... ACTGCTCGATGTGTGTG ACTGCTAGCTAGCTAGTC... >a112a2.b ACTGCATGTTCGATCGTAGC... Projet.fasta Crossmatch Séquences de vecteurs >a112a1.b... XXXXXXXXXXXXGTGTG ACTGCTAGCTAGCTAGTC... >a112a2.b ACTGCATGTTCGATCGTAGC... Projet.fasta.screen Projet.fasta.qual Projet.fasta.screen.qual Assemblage

50 Programmes d Assemblage des Séquences Phrap - sequence assembly program (UNIX) Systeme Phred-Phrap-Consed TIGR Assembler - microbial genomes (UNIX) The Staden Package (UNIX) GeneTool/ChromaTool/Sequencher (PC/Mac) Arachne www-genome.wi.mit.edu/wga/ Celera Assembler Paracel Genome Assembler Stroll Amass (Pattern Matching) bio.informatics.indiana.edu/sunkim/amass/ Phusion (SSAHA) Assembler Genome Research 2003 vol 13 p Euler (Eulerian path) AMI based Assembler (Stochastic process) Bioinformatics 2003 vol 19 p22-29

51 Formats et Codification des séquences Nommage des séquences Format des sequences ABI, SCF Les séquences du même clone ont le même prefix L orientation des séquences est matérialisée par g ou b / f ou r Longueur des clones sequencés doit etre définis Taille du clone KT g.SCF KT b.SCF Si séquences provenant des BACs, on effectue également une codification de ces séquences

52 Le système Phred-Phrap-Consed Lire tous les fichiers de séquences (10-10,000) Reverse complemente toutes les séquences (doubles # des séquences à aligner) Alignement multiple de ces séquences afin d obtenir une séquence unique

53 Phrap 1)Rechercher les pairs de séquences chevauchantes 2)Construire l alignement multiple 3)Améliorer l alignement multiple et déterminer le consensus

54 1) Rechercher les paires de séquences chevauchantes -Compare chaque séquence (et son reverse-complement) avec chacune des autres séquences -Génère une liste des régions ayant certains critères de similarités de séquences. Paramètres importants: minimum overlap length, stringency (% of bases identiques), and minimum repeat length.

55 Chevauchement entre deux séquences overlap (19 bases) overhang (6 bases) AGCCTAGACCTACAGGATGCGCGGACACGTAGCCAGGAC CAGTACTTGGATGCGCTGACACGTAGCTTATCCGGT overhang % identity = 18/19 % = 94.7% overlap - region of similarity between regions overhang - un-aligned ends of the sequences Formation des paires de séquences chevauchantes basée sur: length of overlap % identity in overlap region maximum overhang size.

56 Phrap 1) Rechercher les paires de séquences chevauchantes Une séquence peut avoir plusieurs régions chevauchantes

57 1) Rechercher les paires de séquences chevauchantes

58 2) Construire l alignement multiple Combinaison des paires de séquences chevauchantes pour construire des grands fragments de séquences

59 2) Construire l alignement multiple Combinaison des paires de séquences chevauchantes pour construire des grands fragments de séquences

60 2) Construire l alignement multiple Combinaison des paires de séquences chevauchantes pour construire des grands fragments de séquences

61 2) Construire l alignement multiple Combinaison des paires de séquences chevauchantes pour construire des grands fragments de séquences

62 2) Construire l alignement multiple Combinaison des paires de séquences chevauchantes pour construire des grands fragments de séquences

63 2) Construire l alignement multiple Combinaison des paires de séquences chevauchantes pour construire des grands fragments de séquences

64 3) Améliorer l alignement multiple Introduction de gaps dans les alignements de séquences si cela doit ameliorer les alignements. Paramètres: gap creation penalty (default 2.0) gap extension penalty (default (0.1)

65 Au final

66 enus de navigation Consed Séquence du contig Mismatch en rouge Outils de navigation

67 Consed

68 Création des Scaffolds (SuperContigs)

69 Gaps physical gap scaffold A scaffold B sequencing gaps

70 Scaffolding Ordonner et Orienter les contigs (nonchevauchants) le long du chromosome II I III IV III II IV I

71 Contraintes sur les lectures -Les extrémités des lectures doivent avoir une orientation en miroir l un par rapport à l autre -La distance entre deux lectures est connue (avec une certaine erreur expérimentale) clone length F R sequenced ends

72 Création des scaffolds Assembly caffolding

73 Création des scaffolds Assembly caffolding

74 Linking informations Overlaps Mate-pair links Similarity links Physical markers reference genome physical map Clone/Bac reads Gene synteny

75 PCR combinatoire A B D C F E G H A B C D E F G H A B C D E F G H A B C D E F G H A B C D E F G H A B C D E F G H A B C D E F G H A B C D E F G H A B C D E F G H B--D C--F E--H

76 Reads base-pairs Assembly Contigs bp Scaffolding Scaffolds bp

77 Finition Fermeture des gaps

78 Shotgun Finition Shotgun Finition FINITION : -Correction des zones de basse qualité -Ordonnancement des contigs -Séquençage des parties manquantes -gap de séquence -gap de clonage -Réorganisation des séquences répétées

79 Problèmes associés à l assemblage Banques Biaisées === Assemblage foireux L ensemble des clones des différentes banques utilisées doivent couvrir la presque totalité du génome à séquencer Tailles incorrects des Inserts Faible couverture Orientation inconnue des reads. ACGT or TGCA??? Erreurs de séquençage Séquences repétées

80 Finishing repeats RPT A RPT B clones or PCR walks TEP 1. Isolate repeat copies TEP 2. Assemble in isolation TEP 3. Incorporate assembled repeats into rest of assembly - TIGR Assembler can hold together previously assembled contigs - Other assemblers: use repeat consensus as input to the assembler

81 SASA repeat (4776 AA, 14Kb) rom Streptococcus Pneumoniae - likely involved in cell adhesion MTETVEDKVSHSITGLDILKGIVAAGAVISGTVATQTKVFTNESAVLEKTVEKTDALATNDTVVLGTISTSNSASSTSLSASESASTSASESASTSASTSASTSASESASTSASTSISASSTVVGSQTAAA TEATAKKVEEDRKKPASDYVASVTNVNLQSYAKRRKRSVDSIEQLLASIKNAAVFSGNTIVNGAPAINASLNIAKSETKVYTGEGVDSVYRVPIYYKLKVTNDGSKLTFTYTVTYVNPKTNDLGNISSMRP GYSIYNSGTSTQTMLTLGSDLGKPSGVKNYITDKNGRQVLSYNTSTMTTQGSGYTWGNGAQMNGFFAKKGYGLTSSWTVPITGTDTSFTFTPYAARTDRIGINYFNGGGKVVESSTTSQSLSQSKSLSVSA SQSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASASTS ASGSASTSTSASASTSASASASTSASASASISASESASTSASESASTSTSASASTSASESASTSASASASTSASASASTSASASASTSASASTSASESASTSASASASTSASASASTSASASASTSASASA STSASVSASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASISASESASTS ASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASA SASTSASASASTSASASASTSASASTSASESASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASVSASTS ASASASTSASESASTSASASASTSASESASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASESASTSTSASASTSASESASTSASASASTSASASASTSASASASTSASA SASTSASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASVSASTS ASESASTSASASASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASA SASTSASASASTSASASASISASESASTSASASASTSASASASTSASVSASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASASAS TSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSA SESASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASASTSASASASTSASASASTSASASASISASESASTSASESASTSTSASASTSASESASTSASASASTSAS ASASTSASASASTSASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAST SASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSAS ASASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASTSASESASTSASASASTSASASASTSASASASTSASESAST SASASASTSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASVSASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASASISASESASTSASASASTSAS ASASTSASASASTSASESASTSTSASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAST SASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASASASTSASESASTSASASASTSAS ASASTSASESASTSASASASTSASASASTSASASASTSASASASASTSASASASTSASASASTSASASASISASESASTSASASASASTSASASASTSASASASTSASASASISASESASTSASESASTST SASASTSASESASTSASASASTSASASASTSASASASTSASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASESASTSASASTS ASESASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASG SASTSTSASASTSASASASTSASASASISASESASTSASESASTSTSASASTSASESASTSASASASTSASASASTSASASASTSASASTSASESASTSASASASTSASASASTSASASASTSASASASTS ASVSASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASISASESASTSASA SASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS TSASASASTSASASASTSASASTSASESASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASVSASTSASA SASTSASESASTSASASASTSASESASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASESASTSTSASASTSASESASTSASASASTSASASASTSASASASTSASASAS TSASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASE SASTSASASASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS TSASASASTSASASASISASESASTSASASASTSASASASTSASVSASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASASASTSA SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASESASTSTSASASTSASES ASTSASASASTSASASASTSASASASTSASASASTSASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSA SASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASAS ASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASASASTSASVSASTSASASASTSASASASISASESASTSASASASTSASASASTSASASAST SASASASISASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSVS NSANHSNSQVGNTSGSTGKSQKELPNTGTESSIGSVLLGVLAAVTGIGLVAKRRKRDEEE

82 Pipeline de Séquençage Quelques Succès

83 Consed A B I vector_dir chromat_dir preta phd_dir base calling quality trimming vector trimming.seq,.qual phd2fasta.contig ace2contig achne2gbrowse Gbrowse.links.reads.ps prearachne runta phrap.xml ta2ace.asm Arachne.bases/.fasta/.contigs repeatfinder gobambus.mates.ace.repeats.stats.details.dot toarachne

84 Sequencing Successes T7 bacteriophage completed in ,937 bp, 59 coded proteins Escherichia coli completed in ,639,221 bp, 4293 ORFs Sacchoromyces cerevisae completed in ,069,252 bp, 5800 genes

85 Sequencing Successes Caenorhabditis elegans completed in ,078,296 bp, 19,099 genes Drosophila melanogaster completed in ,117,226 bp, 13,601 genes

86 Homo sapiens 1st draft completed in ,160,079,000 bp, 31,780 genes

87 The Genome Sequencing Era 18 microbial genomes 40 microbial genomes mouse First eukaryote genome Yeast First higher plant Arabidopsis First fish Fugu irst microbial genome H. influenzae E. coli First multicellular animal C. elegans Fruit fly First mammal Homo sapiens malaria: mosquito and parasite 197 microbial genomes

88 Conclusions et Perspectives Amélioration des procédures d'assemblage en tenant compte des liens clones, des erreurs de nommages, des longueurs variables d'inserts et de la sur-couverture des contigs obtenus. Nécessité d optimisation mathématique (Graphes, Stochastic), et informatique (tables de bits, multi-threading) Diminution des risques d'erreurs d'assemblage Simplification de la phase de finition Obtention d'un génome => Annotation Comparaison génomiques Transcriptome Métabolome Pouvoir pathogène...

89 References TIGR Assembler Sutton, G.G., et al., TIGR Assembler: A New Tool for Assembling Large Shotgun Sequencing Projects. Genome Science and Technology, :9-19. phrap Green, P., PHRAP documentation: ALGORITHMS phred Ewing B., Hillier L, Wendl M, Green P., Basecalling of automated sequencer traces using phred. Genome Research, 1998, 8: consed Gordon, D., C. Abajian, P. Green. Consed: A graphical tool for sequence finishing. Genome Research, 1998, 8: REPuter S. Kurtz, C. Schleiermacher, Fast Computation of Maximal Repeats in Complete Genomes, Bioinformatics, 1999, 15(5): Multiplex PCR Tettelin, H., et al., Optimized Multiplex PCR: Efficiently Closing a Whole- Genome Shotgun Sequencing Project. Genomics, : Celera Assembler Myers, E.W. et al A whole-genome assembly of Drosophila. Science 287: Arachne Batzoglou, S., et al ARACHNE: a whole-genome shotgun assembler. Genome Res 12: Jaffe, D.B., et al Whole-genome sequence assembly for Mammalian genomes: arachne 2. Genome Res 13:

90 References TIGR Assembler Sutton, G.G., et al., TIGR Assembler: A New Tool for Assembling Large Shotgun Sequencing Projects. Genome Science and Technology, :9-19. phrap Green, P., PHRAP documentation: ALGORITHMS phred Ewing B., Hillier L, Wendl M, Green P., Basecalling of automated sequencer traces using phred. Genome Research, 1998, 8: consed Gordon, D., C. Abajian, P. Green. Consed: A graphical tool for sequence finishing. Genome Research, 1998, 8: REPuter S. Kurtz, C. Schleiermacher, Fast Computation of Maximal Repeats in Complete Genomes, Bioinformatics, 1999, 15(5): Multiplex PCR Tettelin, H., et al., Optimized Multiplex PCR: Efficiently Closing a Whole- Genome Shotgun Sequencing Project. Genomics, : Celera Assembler Myers, E.W. et al A whole-genome assembly of Drosophila. Science 287: Arachne Batzoglou, S., et al ARACHNE: a whole-genome shotgun assembler. Genome Res 12: Jaffe, D.B., et al Whole-genome sequence assembly for Mammalian genomes: arachne 2. Genome Res 13:

91 Quelques illustrations et idées empruntées à différents sites Ce site fait référence à un livre: Human Molecular Genetic 2, Tom stachan and Andrew P. Read, Bios Scientific Publisher, Ltd

Séquençage Assemblage. de Génomes. Génomique 1 M1 (2012-2013): Assemblage des Génomes Emmanuel Talla, Aix-Marseille Université

Séquençage Assemblage. de Génomes. Génomique 1 M1 (2012-2013): Assemblage des Génomes Emmanuel Talla, Aix-Marseille Université Séquençage Assemblage de Génomes Génomique 1 M1 (2012-2013): Assemblage des Génomes Emmanuel Talla, Aix-Marseille Université Projet de séquençage d un génome Séquençage aléatoire Assemblage Annotation

Plus en détail

Séquençage haut débit (Next Generation Sequencing) 12/03/2012 Pascal Le Bourgeois, M1BBT, EM8BTGM 1

Séquençage haut débit (Next Generation Sequencing) 12/03/2012 Pascal Le Bourgeois, M1BBT, EM8BTGM 1 Séquençage haut débit (Next Generation Sequencing) 1 Pyroséquençage (454) Margulies M. et al. (2005). Genome sequencing in microfabricated high-density picolitre reactors. Nature 437:376-80 Pas de banques

Plus en détail

La génomique. Etude des génomes et de l ensemble de leurs gènes. Nécessite des outils bioinformatiques. Plusieurs étapes :

La génomique. Etude des génomes et de l ensemble de leurs gènes. Nécessite des outils bioinformatiques. Plusieurs étapes : La génomique Etude des génomes et de l ensemble de leurs gènes La structure Le fonctionnement L évolution Le polymorphisme, Plusieurs étapes : Nécessite des outils bioinformatiques 1 Chronologie sur le

Plus en détail

Les technologies de séquençage à haut débit. Patrick Wincker, Genoscope, Institut de Génomique du CEA

Les technologies de séquençage à haut débit. Patrick Wincker, Genoscope, Institut de Génomique du CEA Les technologies de séquençage à haut débit Patrick Wincker, Genoscope, Institut de Génomique du CEA CNG, 12.05.2009 Séquençage Sanger (méthode des dididéoxy terminateurs) : a permis les progrès de la

Plus en détail

RNAseq et NGS. Adriana Alberti Karine Labadie

RNAseq et NGS. Adriana Alberti Karine Labadie RNAseq et NGS Séquençage et Diversité LES ORGANISMES EUCARYOTES animaux plantes champignons protistes BACTERIES ARCHEES VIRUS METAGENOMES LES SOURCES ADN GENOMIQUE ARN / cdna AMPLICONS BACs ET FOSMIDES

Plus en détail

Le séquençage à haut débit Mars 2011

Le séquençage à haut débit Mars 2011 Atelier Epigénétique Université Pierre et Marie Curie Le séquençage à haut débit Mars 2011 Stéphane Le Crom (lecrom@biologie.ens.fr) Institut de Biologie de l École normale supérieure (IBENS) de la Montagne

Plus en détail

A la rencontre du séquençage haut-débit nouvelle génération. Infosys Building, Kuwait

A la rencontre du séquençage haut-débit nouvelle génération. Infosys Building, Kuwait A la rencontre du séquençage haut-débit nouvelle génération Infosys Building, Kuwait 2001 : Aboutissement du projet Génome Humain Ancêtres & Renouveau 2010 Hélicos, Ion torrent, Pacbio, Oxford Nanopore

Plus en détail

Introduction : l ère de la génomique

Introduction : l ère de la génomique Introduction : l ère de la génomique En 1995, pour la première fois, la séquence complète du génome d une cellule vivante a été déterminée. Il s agissait d Haemophilus influenzae, une bactérie responsable

Plus en détail

Séquençage. Bérénice Batut, berenice.batut@udamail.fr. DUT Génie Biologique Option Bioinformatique Année 2014-2015

Séquençage. Bérénice Batut, berenice.batut@udamail.fr. DUT Génie Biologique Option Bioinformatique Année 2014-2015 Séquençage Bérénice Batut, berenice.batut@udamail.fr DUT Génie Biologique Option Bioinformatique Année 2014-2015 Séquençage Séquençage ADN Détermination de l ordre d enchainement des nucléotides d un fragment

Plus en détail

Les nouvelles technologies de séquençage au Genoscope. Jean-Marc Aury, France Denoeud

Les nouvelles technologies de séquençage au Genoscope. Jean-Marc Aury, France Denoeud Les nouvelles technologies de séquençage au Genoscope Jean-Marc Aury, France Denoeud Introduction Présentation du Genoscope et des activités liées aux NTS Séquençage et assemblage des génomes procaryotes

Plus en détail

Barcoding environnemental par séquençage haut débit

Barcoding environnemental par séquençage haut débit Barcoding environnemental par séquençage haut débit Potentiel et limites Jean-François Martin Échantillonnage Spécificités du barcoding environnemental Amplification (PCR) de marqueurs choisis Séquençage

Plus en détail

Le séquençage à haut débit Juin 2012

Le séquençage à haut débit Juin 2012 Atelier Epigénétique Université Pierre et Marie Curie Le séquençage à haut débit Juin 2012 Stéphane Le Crom (stephane.le_crom@upmc.fr) Laboratoire de Biologie du Développement (UPMC) de la Montagne Sainte

Plus en détail

15 septembre 2010. Démo #2 MySQL Séquençage

15 septembre 2010. Démo #2 MySQL Séquençage 15 septembre 2010 Démo #2 MySQL Séquençage SQL et MySQL SQL: structured query language langage pour manipuler des données dans des bases de données relationnelles MySQL: Implantation de SQL Ajout à SQL

Plus en détail

Le séquençage Roche 454

Le séquençage Roche 454 Le séquençage Roche 454 www.454.com Stéphane Fénart, Arnaud Mouchon Roscoff, Avril 2012 Systèmes Genome Sequencers Une stratégie unique en séquençage nouvelle génération Pionniers en séquençage de nouvelle

Plus en détail

Deux plateformes IBiSA et 3 plateaux techniques regroupés depuis 2010. Responsable scientifique Denis Milan. Coordination des nouveaux investissements

Deux plateformes IBiSA et 3 plateaux techniques regroupés depuis 2010. Responsable scientifique Denis Milan. Coordination des nouveaux investissements RNA-seq Olivier Bouchez Nathalie Marsaud Mercredi 28 mars 2012 Plateforme GeT : Génome et Transcriptome Deux plateformes IBiSA et 3 plateaux techniques regroupés depuis 2010 Responsable scientifique Denis

Plus en détail

Université Bordeaux Segalen - PACES 2012-2013 ED UE9s Avril 2013

Université Bordeaux Segalen - PACES 2012-2013 ED UE9s Avril 2013 Sélectionner les propositions exactes Université Bordeaux Segalen - PACES 2012-2013 ED UE9s Avril 2013 QCM 1 La plupart des techniques de biologie moléculaire repose sur le principe de complémentarité

Plus en détail

MAT 2377 Solutions to the Mi-term

MAT 2377 Solutions to the Mi-term MAT 2377 Solutions to the Mi-term Tuesday June 16 15 Time: 70 minutes Student Number: Name: Professor M. Alvo This is an open book exam. Standard calculators are permitted. Answer all questions. Place

Plus en détail

deux tâches dans le tableau et à cliquer sur l icône représentant une chaîne dans la barre d outils. 14- Délier les tâches : double cliquer sur la

deux tâches dans le tableau et à cliquer sur l icône représentant une chaîne dans la barre d outils. 14- Délier les tâches : double cliquer sur la MS Project 1- Créer un nouveau projet définir la date du déclenchement (début) ou de la fin : File New 2- Définir les détails du projet : File Properties (permet aussi de voir les détails : coûts, suivi,

Plus en détail

Analyse des génomes. Module de Bioinformatique Appliquée. A. Les projets Génome : a) Qu est-ce qu un projet génome? Cours Analyse des génomes

Analyse des génomes. Module de Bioinformatique Appliquée. A. Les projets Génome : a) Qu est-ce qu un projet génome? Cours Analyse des génomes Module de Bioinformatique Appliquée GB3-2012 Cours Analyse des génomes 0 Analyse des génomes 1 Les objectifs des projets génomes sont : Assemblagedes cartes physiques et génétiques sur le génome de l organisme

Plus en détail

Le séquençage haut-débit

Le séquençage haut-débit Nouveaux outils en biologie Le séquençage haut-débit DES d hématologie 16 janvier 2015 Paris Alice Marceau-Renaut Laboratoire d hématologie CHRU Lille NGS = Next-Generation Sequencing Whole-genome Whole-exome

Plus en détail

Big data et sciences du Vivant L'exemple du séquençage haut débit

Big data et sciences du Vivant L'exemple du séquençage haut débit Big data et sciences du Vivant L'exemple du séquençage haut débit C. Gaspin, C. Hoede, C. Klopp, D. Laborie, J. Mariette, C. Noirot, MS. Trotard bioinfo@genopole.toulouse.inra.fr INRA - MIAT - Plate-forme

Plus en détail

Instructions Mozilla Thunderbird Page 1

Instructions Mozilla Thunderbird Page 1 Instructions Mozilla Thunderbird Page 1 Instructions Mozilla Thunderbird Ce manuel est écrit pour les utilisateurs qui font déjà configurer un compte de courrier électronique dans Mozilla Thunderbird et

Plus en détail

Exemple PLS avec SAS

Exemple PLS avec SAS Exemple PLS avec SAS This example, from Umetrics (1995), demonstrates different ways to examine a PLS model. The data come from the field of drug discovery. New drugs are developed from chemicals that

Plus en détail

Editing and managing Systems engineering processes at Snecma

Editing and managing Systems engineering processes at Snecma Editing and managing Systems engineering processes at Snecma Atego workshop 2014-04-03 Ce document et les informations qu il contient sont la propriété de Ils ne doivent pas être copiés ni communiqués

Plus en détail

PACKZ System Requirements. Version: 2015-05-27. Version: 2015-05-27 Copyright 2015, PACKZ Software GmbH. 1

PACKZ System Requirements. Version: 2015-05-27. Version: 2015-05-27 Copyright 2015, PACKZ Software GmbH. 1 PACKZ System Requirements Version: 2015-05-27 Copyright 2015, PACKZ Software GmbH. All rights reserved.this manual may not be copied, photocopied, reproduced, translated, or converted to any electronic

Plus en détail

DIAGNOSTIC PRÉNATAL NON INVASIF : LE SANG MATERNEL

DIAGNOSTIC PRÉNATAL NON INVASIF : LE SANG MATERNEL 6 LE TEST DIAGNOSTIC PRÉNATAL NON INVASIF : LE SANG MATERNEL Source : les cellules trophoblastiques Fetal cell Cell isolation Détection 5-6SA Disparition rapide après accouchement Pas de persistance après

Plus en détail

Les principes du sequençage haut-débit

Les principes du sequençage haut-débit Les principes du sequençage haut-débit Mardi 23 avril 2013 Dr H. EL HOUSNI Organisation Génomique Podhala'et'al.'Trends'in'genetics'2012' Costa V et al. J BioMed BioTech 2010 32 ans Costa V et al. J BioMed

Plus en détail

APPENDIX 6 BONUS RING FORMAT

APPENDIX 6 BONUS RING FORMAT #4 EN FRANÇAIS CI-DESSOUS Preamble and Justification This motion is being presented to the membership as an alternative format for clubs to use to encourage increased entries, both in areas where the exhibitor

Plus en détail

Analyse de Séquences M1 BIBS. 2 e partie. http://rna.igmors.u-psud.fr/gautheret/cours/ V. 2012.1

Analyse de Séquences M1 BIBS. 2 e partie. http://rna.igmors.u-psud.fr/gautheret/cours/ V. 2012.1 Analyse de Séquences M1 BIBS 2 e partie http://rna.igmors.u-psud.fr/gautheret/cours/ V. 2012.1 1 Les programmes Génome 2 Les programmes Génome Préhistoire Séquençage de Sanger Avant le séquençage d organismes:

Plus en détail

Instructions pour mettre à jour un HFFv2 v1.x.yy v2.0.00

Instructions pour mettre à jour un HFFv2 v1.x.yy v2.0.00 Instructions pour mettre à jour un HFFv2 v1.x.yy v2.0.00 HFFv2 1. OBJET L accroissement de la taille de code sur la version 2.0.00 a nécessité une évolution du mapping de la flash. La conséquence de ce

Plus en détail

Anomalies chromosomiques

Anomalies chromosomiques Master bioinformatique, Université de Rouen Janvier 2013 Sylvain Mareschal [@etu.univ-rouen.fr] Anomalies chromosomiques Speicher & Carter (2005) Nat Rev Genet. Oct;6(10):782-92. The new cytogenetics:

Plus en détail

Become. Business Provider for Matheo Software

Become. Business Provider for Matheo Software Become Business Provider for Matheo Software Who we are? Matheo Software was created in 2003 by business intelligence and information processing professionals from higher education and research. Matheo

Plus en détail

3615 SELFIE. http://graffitiresearchlab.fr HOW-TO / GUIDE D'UTILISATION

3615 SELFIE. http://graffitiresearchlab.fr HOW-TO / GUIDE D'UTILISATION 3615 SELFIE http://graffitiresearchlab.fr HOW-TO / GUIDE D'UTILISATION Hardware : Minitel Computer DIN FM545 45 connector (http://www.gotronic.fr/art-fiche-din-fm545-4747.htm) Cable Arduino compatible

Plus en détail

Evaluation de la prime de risques de la vente d une bande d énergie nucléaire

Evaluation de la prime de risques de la vente d une bande d énergie nucléaire 28/3/2011 ANNEXE 6 (Source: Electrabel) Evaluation de la prime de risques de la vente d une bande d énergie nucléaire Si nous vendons une bande d énergie nucléaire à certains clients, que nous garantissons

Plus en détail

NOTICE D UTILISATION Option USB 2-Ports USB FRANCAIS

NOTICE D UTILISATION Option USB 2-Ports USB FRANCAIS NOTICE D UTILISATION Option USB 2-Ports USB FRANCAIS Introduction Ce supplément vous informe de l utilisation de la fonction USB qui a été installée sur votre table de mixage. Disponible avec 2 ports USB

Plus en détail

INTRODUCTION TO NEXT GENERATION SEQUENCING

INTRODUCTION TO NEXT GENERATION SEQUENCING ECOLE DE BIOINFORMATIQUE INITIATION AU TRAITEMENT DES DONNÉES DE GÉNOMIQUE OBTENUES PAR SÉQUENÇAGE À HAUT DÉBIT 05-10 OCTOBRE 2014 - STATION BIOLOGIQUE - ROSCOFF INTRODUCTION TO NEXT GENERATION SEQUENCING

Plus en détail

Marc DELPECH. CORATA La Rochelle le 21 mai 2008

Marc DELPECH. CORATA La Rochelle le 21 mai 2008 Marc DELPECH CORATA La Rochelle le 21 mai 2008 En 24 ans les progrès ont été considérables Premières utilisation des techniques de génétique moléculaire en diagnostic : 1984 Une palette de techniques très

Plus en détail

Méthodes d études. Chapitre 8 : Professeur Joël LUNARDI. UE1 : Biochimie Biologie moléculaire

Méthodes d études. Chapitre 8 : Professeur Joël LUNARDI. UE1 : Biochimie Biologie moléculaire Chapitre 8 : UE1 : Biochimie Biologie moléculaire Méthodes d études Professeur Joël LUNARDI Année universitaire 2011/2012 Université Joseph Fourier de Grenoble - Tous droits réservés. Chapitre 8. 8. Méthodes

Plus en détail

C est quoi, Facebook?

C est quoi, Facebook? C est quoi, Facebook? aujourd hui l un des sites Internet les plus visités au monde. Si tu as plus de 13 ans, tu fais peut-être partie des 750 millions de personnes dans le monde qui ont une page Facebook?

Plus en détail

How To connect to TonVPN Max / Comment se connecter à TonVPN Max

How To connect to TonVPN Max / Comment se connecter à TonVPN Max How To connect to TonVPN Max / Comment se connecter à TonVPN Max Note : you need to run all those steps as an administrator or somebody having admin rights on the system. (most of the time root, or using

Plus en détail

Groupe Sarcome Français Génétique et Biologie des Sarcomes U916 Institut Bergonié

Groupe Sarcome Français Génétique et Biologie des Sarcomes U916 Institut Bergonié Groupe Sarcome Français Génétique et Biologie des Sarcomes U916 Institut Bergonié Next Generation Sequencing Bioinformatics - Biology ! Initié en 2008, le programme international ICGC a pour objectif de

Plus en détail

Please find attached a revised amendment letter, extending the contract until 31 st December 2011.

Please find attached a revised amendment letter, extending the contract until 31 st December 2011. Sent: 11 May 2011 10:53 Subject: Please find attached a revised amendment letter, extending the contract until 31 st December 2011. I look forward to receiving two signed copies of this letter. Sent: 10

Plus en détail

Bioinformatique en génomique évolutive

Bioinformatique en génomique évolutive Bioinformatique en génomique évolutive Elsa Petit Parcours 1997-2000: Ecole d Ingénieurs des Travaux Agricoles, Bordeaux Option pathologie végétale Eté 1999: Iowa State University, Prévision de l anthracnose

Plus en détail

Utilisation de la métagénomique 16S pour la surveillance de l émergence de zoonoses bactériennes dans les populations animales

Utilisation de la métagénomique 16S pour la surveillance de l émergence de zoonoses bactériennes dans les populations animales Utilisation de la métagénomique 16S pour la surveillance de l émergence de zoonoses bactériennes dans les populations animales Réunion Rongeur 2014 CBGP Maxime Galan Métagénomique 16S: Pourquoi? Identification

Plus en détail

POPULATION D ADN COMPLEXE - ADN génomique ou - copie d ARNm = CDNA

POPULATION D ADN COMPLEXE - ADN génomique ou - copie d ARNm = CDNA POPULATION D ADN COMPLEXE - ADN génomique ou - copie d ARNm = CDNA Amplification spécifique Détection spécifique Clonage dans des vecteurs Amplification in vitro PCR Hybridation moléculaire - hôte cellulaire

Plus en détail

Les NGS en pratique. Quelques slides sur les NGS et leur utilisation... Laurent (travail avec Marta, toujours en cours...)

Les NGS en pratique. Quelques slides sur les NGS et leur utilisation... Laurent (travail avec Marta, toujours en cours...) Quelques slides sur les NGS et leur utilisation... LIFL, Université Lille 1 - INRIA Journées au vert 31 mai - 1er juin 2010 - NEWS FEATURE HUMAN GENOME AT TEN NATURE Vol 464 1 April 2010 NATURE Vol 464

Plus en détail

Initiative d excellence de l université de Bordeaux. Réunion du Comité stratégique 17-19 décembre 2014. Recommandations

Initiative d excellence de l université de Bordeaux. Réunion du Comité stratégique 17-19 décembre 2014. Recommandations Initiative d excellence de l université de Bordeaux Réunion du Comité stratégique 17-19 décembre 2014 Recommandations 2/1 RECOMMANDATIONS DU COMITE STRATEGIQUE Une feuille de route pour le conseil de gestion

Plus en détail

How to Deposit into Your PlayOLG Account

How to Deposit into Your PlayOLG Account How to Deposit into Your PlayOLG Account Option 1: Deposit with INTERAC Online Option 2: Deposit with a credit card Le texte français suit l'anglais. When you want to purchase lottery products or play

Plus en détail

MAXI SPEED-ROLL Course à boules

MAXI SPEED-ROLL Course à boules Course à boules Notice de montage 1. Posez le jeu à plat sur une table. 2. A l aide de la clé de service, dévissez les vis qui maintiennent la plaque de plexiglas et déposez la. 3. Dévissez les 4 vis fixant

Plus en détail

RAPID 3.34 - Prenez le contrôle sur vos données

RAPID 3.34 - Prenez le contrôle sur vos données RAPID 3.34 - Prenez le contrôle sur vos données Parmi les fonctions les plus demandées par nos utilisateurs, la navigation au clavier et la possibilité de disposer de champs supplémentaires arrivent aux

Plus en détail

SC 27/WG 5 Normes Privacy

SC 27/WG 5 Normes Privacy SC 27/WG 5 Normes Privacy Club 27001 Toulousain 12/12/2014 Lionel VODZISLAWSKY Chief Information Officer l.vodzislawsky@celtipharm.com PRE-CTPM 141212-Club27001 Toulouse normes WG5_LV L organisation de

Plus en détail

Application Form/ Formulaire de demande

Application Form/ Formulaire de demande Application Form/ Formulaire de demande Ecosystem Approaches to Health: Summer Workshop and Field school Approches écosystémiques de la santé: Atelier intensif et stage d été Please submit your application

Plus en détail

SERVEUR DÉDIÉ DOCUMENTATION

SERVEUR DÉDIÉ DOCUMENTATION SERVEUR DÉDIÉ DOCUMENTATION Release 5.0.6.0 19 Juillet 2013 Copyright 2013 GIANTS Software GmbH, All Rights Reserved. 1/9 CHANGE LOG Correction de bug divers (5.0.6.0) Ajout d une option de relance automatique

Plus en détail

NOTICE. General rules for applying the package method by Euronext Paris and by C21 clearing system.

NOTICE. General rules for applying the package method by Euronext Paris and by C21 clearing system. NOTICE >> LCH.Clearnet SA Corporate Reference No.: 2008-084 NOTICE From : Rules and Regulation Department Date : July 6 th, 2008 Subject Referred documentation LCH.Clearnet SA publishes hereinafter a Notice

Plus en détail

Exercices sur SQL server 2000

Exercices sur SQL server 2000 Exercices sur SQL server 2000 La diagramme de classe : Exercices sur SQL server 2000 Le modèle relationnel correspondant : 1 Créer les tables Clic-droit on Tables et choisir «New Table» Créer la table

Plus en détail

Utiliser une WebCam. Micro-ordinateurs, informations, idées, trucs et astuces

Utiliser une WebCam. Micro-ordinateurs, informations, idées, trucs et astuces Micro-ordinateurs, informations, idées, trucs et astuces Utiliser une WebCam Auteur : François CHAUSSON Date : 8 février 2008 Référence : utiliser une WebCam.doc Préambule Voici quelques informations utiles

Plus en détail

eid Trends in french egovernment Liberty Alliance Workshop April, 20th 2007 French Ministry of Finance, DGME

eid Trends in french egovernment Liberty Alliance Workshop April, 20th 2007 French Ministry of Finance, DGME eid Trends in french egovernment Liberty Alliance Workshop April, 20th 2007 French Ministry of Finance, DGME Agenda What do we have today? What are our plans? What needs to be solved! What do we have today?

Plus en détail

Spécial Catégorie 6 Patch Cords

Spécial Catégorie 6 Patch Cords Spécial Catégorie 6 Patch Cords Patent Pending Sommaire 1 - Préliminaires... 2 2 Qu est ce qu apporte la catégorie 6... 3 3 Qu est ce que l interopérabilité...3 4 Ce que PatchSee annonçait en septembre

Plus en détail

Enjeux de la biologie haut débit en oncologie

Enjeux de la biologie haut débit en oncologie Enjeux de la biologie haut débit en oncologie Pascal BARBRY, CNRS, Sophia Antipolis o Les technologies haut-débit ont enrichi considérablement nos approches quantitatives en biologie. o Des applications

Plus en détail

SEQUENÇAGE LI-COR DNA 4200

SEQUENÇAGE LI-COR DNA 4200 SEQUENÇAGE LI-COR DNA 4200 Le gel de séquence contient 64 puits au maximum soit 16 clones traités en parallèle. Les oligos utilisés (modifiés en 5 ) fluorescent à 700/800 nm. Une amorce permet de séquencer

Plus en détail

RFP 1000162739 and 1000163364 QUESTIONS AND ANSWERS

RFP 1000162739 and 1000163364 QUESTIONS AND ANSWERS RFP 1000162739 and 1000163364 QUESTIONS AND ANSWERS Question 10: The following mandatory and point rated criteria require evidence of work experience within the Canadian Public Sector: M3.1.1.C / M3.1.2.C

Plus en détail

AMESD-Puma2010-EFTS- Configuration-update-TEN (en-fr)

AMESD-Puma2010-EFTS- Configuration-update-TEN (en-fr) AMESD-Puma2010-EFTS- Configuration-update-TEN (en-fr) Doc.No. : EUM/OPS/TEN/13/706466 Issue : v3 Date : 7 May 2014 WBS : EUMETSAT Eumetsat-Allee 1, D-64295 Darmstadt, Germany Tel: +49 6151 807-7 Fax: +49

Plus en détail

Once the installation is complete, you can delete the temporary Zip files..

Once the installation is complete, you can delete the temporary Zip files.. Sommaire Installation... 2 After the download... 2 From a CD... 2 Access codes... 2 DirectX Compatibility... 2 Using the program... 2 Structure... 4 Lier une structure à une autre... 4 Personnaliser une

Plus en détail

WEB page builder and server for SCADA applications usable from a WEB navigator

WEB page builder and server for SCADA applications usable from a WEB navigator Générateur de pages WEB et serveur pour supervision accessible à partir d un navigateur WEB WEB page builder and server for SCADA applications usable from a WEB navigator opyright 2007 IRAI Manual Manuel

Plus en détail

CALCUL DE LA CONTRIBUTION - FONDS VERT Budget 2008/2009

CALCUL DE LA CONTRIBUTION - FONDS VERT Budget 2008/2009 Société en commandite Gaz Métro CALCUL DE LA CONTRIBUTION - FONDS VERT Budget 2008/2009 Taux de la contribution au Fonds vert au 1 er janvier 2009 Description Volume Coûts Taux 10³m³ 000 $ /m³ (1) (2)

Plus en détail

Différentes applications de l oracle des facteurs

Différentes applications de l oracle des facteurs Différentes applications de l oracle des facteurs Thierry Lecroq LITIS Thierry.Lecroq@univ-rouen.fr http://www-igm.univ-mlv.fr/~lecroq en collaboration avec : Joël l Alexandre, Hélène H Dauchel,, Arnaud

Plus en détail

Génotypage et Séquençage. Pierre Mournet

Génotypage et Séquençage. Pierre Mournet Génotypage et Séquençage Pierre Mournet Plan Séquençage/Génotypage Classique (usat, Sanger) Séquençage NGS (Next Generation Sequencing) Séquenceur Préparation Pré-NGS Exemple 1 NGS Exemple 2 NGS Génotypage

Plus en détail

Les Evolutions techniques. Marc Delpech Laboratoire de Génétique et Biologie moléculaires de l hôpital Cochin

Les Evolutions techniques. Marc Delpech Laboratoire de Génétique et Biologie moléculaires de l hôpital Cochin Les Evolutions techniques Marc Delpech Laboratoire de Génétique et Biologie moléculaires de l hôpital Cochin 1 Les principales étapes de l évolution technologique 1975 Southern blot 1977 Séquençage Sanger

Plus en détail

INSERTION TECHNIQUES FOR JOB SHOP SCHEDULING

INSERTION TECHNIQUES FOR JOB SHOP SCHEDULING INSERTION TECHNIQUES FOR JOB SHOP SCHEDULING ÉCOLE POLYTECHNIQUE FÉDÉRALE DE LAUSANNE POUR L'OBTENTION DU GRADE DE DOCTEUR ES SCIENCES PAR Tamas KIS Informaticien mathématicien diplômé de l'université

Plus en détail

Stratégie DataCenters Société Générale Enjeux, objectifs et rôle d un partenaire comme Data4

Stratégie DataCenters Société Générale Enjeux, objectifs et rôle d un partenaire comme Data4 Stratégie DataCenters Société Générale Enjeux, objectifs et rôle d un partenaire comme Data4 Stéphane MARCHINI Responsable Global des services DataCenters Espace Grande Arche Paris La Défense SG figures

Plus en détail

Guide d'installation rapide TFM-560X YO.13

Guide d'installation rapide TFM-560X YO.13 Guide d'installation rapide TFM-560X YO.13 Table of Contents Français 1 1. Avant de commencer 1 2. Procéder à l'installation 2 Troubleshooting 6 Version 06.08.2011 16. Select Install the software automatically

Plus en détail

La coopération dans un contexte de recherches doctorales Cooperation amongst PhD researchers. Josée Charbonneau Anne- Marie Merrien 28 mai 2014

La coopération dans un contexte de recherches doctorales Cooperation amongst PhD researchers. Josée Charbonneau Anne- Marie Merrien 28 mai 2014 La coopération dans un contexte de recherches doctorales Cooperation amongst PhD researchers Josée Charbonneau Anne- Marie Merrien 28 mai 2014 Pourquoi sommes- nous ici? Étudiantes au doctorat, bourse

Plus en détail

«Algorithmes pour le séquençage haut débit»

«Algorithmes pour le séquençage haut débit» Loïk LE DRÉAU Master 2 de Recherche en Informatique Supelec, Rennes Étude bibliographique : «Algorithmes pour le séquençage haut débit» Janvier 2010 Encadrant : Dominique LAVENIER Équipe : Symbiose Laboratoire

Plus en détail

Support Orders and Support Provisions (Banks and Authorized Foreign Banks) Regulations

Support Orders and Support Provisions (Banks and Authorized Foreign Banks) Regulations CANADA CONSOLIDATION CODIFICATION Support Orders and Support Provisions (Banks and Authorized Foreign Banks) Regulations Règlement sur les ordonnances alimentaires et les dispositions alimentaires (banques

Plus en détail

ADHEFILM : tronçonnage. ADHEFILM : cutting off. ADHECAL : fabrication. ADHECAL : manufacturing.

ADHEFILM : tronçonnage. ADHEFILM : cutting off. ADHECAL : fabrication. ADHECAL : manufacturing. LA MAÎTRISE D UN MÉTIER Depuis plus de 20 ans, ADHETEC construit sa réputation sur la qualité de ses films adhésifs. Par la maîtrise de notre métier, nous apportons à vos applications la force d une offre

Plus en détail

Influence du nombre de réplicats dans une analyse différentielle de données RNAseq

Influence du nombre de réplicats dans une analyse différentielle de données RNAseq Influence du nombre de réplicats dans une analyse différentielle de données RNAseq Statisticiens: Sophie Lamarre Steve Van Ginkel Sébastien Déjean - Magali San Cristobal Matthieu Vignes Biologistes: Stéphane

Plus en détail

The new consumables catalogue from Medisoft is now updated. Please discover this full overview of all our consumables available to you.

The new consumables catalogue from Medisoft is now updated. Please discover this full overview of all our consumables available to you. General information 120426_CCD_EN_FR Dear Partner, The new consumables catalogue from Medisoft is now updated. Please discover this full overview of all our consumables available to you. To assist navigation

Plus en détail

Empowering small farmers and their organizations through economic intelligence

Empowering small farmers and their organizations through economic intelligence Empowering small farmers and their organizations through economic intelligence Soutenir les petits agriculteurs et leurs organisations grâce à l intelligence économique XOF / kg RONGEAD has been supporting

Plus en détail

GISAfrica First phase closure meeting East African Pole. SIGAfrique Réunion de clôture de la première phase Pôle Afrique de l est

GISAfrica First phase closure meeting East African Pole. SIGAfrique Réunion de clôture de la première phase Pôle Afrique de l est GISAfrica First phase closure meeting East African Pole SIGAfrique Réunion de clôture de la première phase Pôle Afrique de l est Ethiopia MAURITANIE MALI Kenya SENEGAL GUINEE Ouagadougou BURKINA FASO NIGER

Plus en détail

Introduction à la Génomique Fonctionnelle

Introduction à la Génomique Fonctionnelle Introduction à la Génomique Fonctionnelle Cours aux étudiants de BSc Biologie 3ème année Philippe Reymond, MER PLAN DU COURS - Séquençage des génomes - Fabrication de DNA microarrays - Autres méthodes

Plus en détail

Séquençage Haut-Débit : HiSeq 2000 et HiSeq 2500 (Illumina)

Séquençage Haut-Débit : HiSeq 2000 et HiSeq 2500 (Illumina) Séquençage Haut-Débit : HiSeq 2000 et HiSeq 2500 (Illumina) avec automatisation sur robot Tecan EVO200 Préparation des librairies High Output - HiSeq 2000 ou 2500 Run : 11 jours -2 Flowcells, 8 lanes /

Plus en détail

English version ***La version française suit***

English version ***La version française suit*** 1 of 5 4/26/2013 4:26 PM Subject: CRA/ARC- Reminder - Tuesday, April 30, 2013 is the deadline to file your 2012 income tax and benefit return and pay any / Rappel - Vous avez jusqu'au 30 avril 2013 pour

Plus en détail

Installation et compilation de gnurbs sous Windows

Installation et compilation de gnurbs sous Windows Installation et compilation de gnurbs sous Windows Installation de l environnement de développement Code::Blocks (Environnement de développement) 1. Télécharger l installateur de Code::Blocks (version

Plus en détail

2012, EUROPEEN YEAR FOR ACTIVE AGEING 2012, ANNEE EUROPEENNE DU VIEILLISSEMENT ACTIF

2012, EUROPEEN YEAR FOR ACTIVE AGEING 2012, ANNEE EUROPEENNE DU VIEILLISSEMENT ACTIF 2012, EUROPEEN YEAR FOR ACTIVE AGEING 2012, ANNEE EUROPEENNE DU VIEILLISSEMENT ACTIF Kick off transnational project meeting June 6 & 7th 2011 6 et 7 Juin 2011 CERGY/ VAL D OISE Monday june 6th morning

Plus en détail

France with an OIB. Updated January 2014

France with an OIB. Updated January 2014 France with an OIB Updated January 2014 The French system May appear complicated Not too expensive Good opportunities if you look carefully 2 European harmonisation of higher education - LMD system Licence

Plus en détail

Procédure d utilisation du Beckman CEQ 2000 XL pour la réalisation de programmes de séquençage ou de génotypage.

Procédure d utilisation du Beckman CEQ 2000 XL pour la réalisation de programmes de séquençage ou de génotypage. MODE OPERATOIRE Code : SSG / 003 UMR 1229 MGS Microbiologie et Géochimie des Sols 17 rue Sully BP86510 21065 Dijon Cedex Rédigé par : D. Bru / S. Hallet. Procédure d utilisation du Beckman CEQ 2000 XL

Plus en détail

Memorandum of Understanding

Memorandum of Understanding Memorandum of Understanding File code of the Memorandum of Understanding (optional) texte 1. Objectives of the Memorandum of Understanding The Memorandum of Understanding 1 (MoU) forms the framework for

Plus en détail

Corrigé 4 : Édition de fichiers texte - Vi. Pré-requis. Édition de fichiers texte - Vi. / Faux.

Corrigé 4 : Édition de fichiers texte - Vi. Pré-requis. Édition de fichiers texte - Vi. / Faux. Édition de fichiers texte - Vi CORRIGÉS DU CHAPITRE 4 129 Corrigé 4 : Édition de fichiers texte - Vi Pré-requis, Faux. - Faux.. Faux. / Faux. 0 Vrai. Il existe des implémentations libres de Vi pour tous

Plus en détail

Assembly Instructions Stratton Premier Combo Plus Instructions Pour Assembler Collection Stratton Premier Combo Plus

Assembly Instructions Stratton Premier Combo Plus Instructions Pour Assembler Collection Stratton Premier Combo Plus W westwood design Assembly Instructions Stratton Premier Combo Plus Instructions Pour Assembler Collection Stratton Premier Combo Plus ! WARNING: FALL HAZARD TO PREVENT DEATH OR SERIOUS INJURY, ALWAYS

Plus en détail

Software and Hardware Datasheet / Fiche technique du logiciel et du matériel

Software and Hardware Datasheet / Fiche technique du logiciel et du matériel Software and Hardware Datasheet / Fiche technique du logiciel et du matériel 1 System requirements Windows Windows 98, ME, 2000, XP, Vista 32/64, Seven 1 Ghz CPU 512 MB RAM 150 MB free disk space 1 CD

Plus en détail

Eléments de statistique

Eléments de statistique Eléments de statistique L. Wehenkel Cours du 9/12/2014 Méthodes multivariées; applications & recherche Quelques méthodes d analyse multivariée NB: illustration sur base de la BD résultats de probas en

Plus en détail

Scénarios économiques en assurance

Scénarios économiques en assurance Motivation et plan du cours Galea & Associés ISFA - Université Lyon 1 ptherond@galea-associes.eu pierre@therond.fr 18 octobre 2013 Motivation Les nouveaux référentiels prudentiel et d'information nancière

Plus en détail

Folio Case User s Guide

Folio Case User s Guide Fujitsu America, Inc. Folio Case User s Guide I N S T R U C T I O N S This Folio Case is a stylish, lightweight case for protecting your Tablet PC. Elastic Strap Pen Holder Card Holders/ Easel Stops Figure

Plus en détail

Quatre axes au service de la performance et des mutations Four lines serve the performance and changes

Quatre axes au service de la performance et des mutations Four lines serve the performance and changes Le Centre d Innovation des Technologies sans Contact-EuraRFID (CITC EuraRFID) est un acteur clé en matière de l Internet des Objets et de l Intelligence Ambiante. C est un centre de ressources, d expérimentations

Plus en détail

FEDERATION INTERNATIONALE DE L AUTOMOBILE. Norme 8861-2000

FEDERATION INTERNATIONALE DE L AUTOMOBILE. Norme 8861-2000 FEDERATION INTERNATIONALE DE L AUTOMOBILE Norme 8861-2000 NORME FIA CONCERNANT LA PERFORMANCE DES DISPOSITIFS D'ABSORPTION D'ÉNERGIE À L'INTÉRIEUR DES BARRIÈRES DE PNEUS DE FORMULE UN Ce cahier des charges

Plus en détail

ANALYSE DE L ADN FŒTAL DANS LE SANG MATERNEL: APPLICATION A LA TRISOMIE 21

ANALYSE DE L ADN FŒTAL DANS LE SANG MATERNEL: APPLICATION A LA TRISOMIE 21 ANALYSE DE L ADN FŒTAL DANS LE SANG MATERNEL: APPLICATION A LA TRISOMIE 21 JM Costa 5èmes Journées de Biologie Praticienne Mazagan, 4-5 Avril 2014 LABORATOIRE CERBA, Laboratoire du réseau DIAGNOSTIC PRÉNATAL

Plus en détail

Séquençage massif en parallèle Défis technologiques et informatiques

Séquençage massif en parallèle Défis technologiques et informatiques Séquençage massif en parallèle Défis technologiques et informatiques Jean-Baptiste Rivière, PhD jean-baptiste.riviere@u-bourgogne.fr 10/09/2014 Séquençage massif en parallèle Défis technologiques de Sanger

Plus en détail

Edna Ekhivalak Elias Commissioner of Nunavut Commissaire du Nunavut

Edna Ekhivalak Elias Commissioner of Nunavut Commissaire du Nunavut SECOND SESSION THIRD LEGISLATIVE ASSEMBLY OF NUNAVUT DEUXIÈME SESSION TROISIÈME ASSEMBLÉE LÉGISLATIVE DU NUNAVUT GOVERNMENT BILL PROJET DE LOI DU GOUVERNEMENT BILL 52 PROJET DE LOI N o 52 SUPPLEMENTARY

Plus en détail

BIOLOGIE MOLECULAIRE

BIOLOGIE MOLECULAIRE BIOLOGIE MOLECULAIRE I. Eléments importants de la structure des génomes eucaryotes 1. Chromosomes et chromatines a) Caractéristiques générales d'un chromosome Les chromosomes des eucaryotes sont des grosses

Plus en détail

HAUTE DISPONIBILITÉ DE MACHINE VIRTUELLE AVEC HYPER-V 2012 R2 PARTIE CONFIGURATION OPENVPN SUR PFSENSE

HAUTE DISPONIBILITÉ DE MACHINE VIRTUELLE AVEC HYPER-V 2012 R2 PARTIE CONFIGURATION OPENVPN SUR PFSENSE HAUTE DISPONIBILITÉ DE MACHINE VIRTUELLE AVEC HYPER-V 2012 R2 PARTIE CONFIGURATION OPENVPN SUR PFSENSE Projet de semestre ITI soir 4ème année Résumé configuration OpenVpn sur pfsense 2.1 Etudiant :Tarek

Plus en détail