NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA"

Transcription

1 Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10

2 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana ho toy ny fomba iray entin ny olona na fikambanana mitatitra ny asa nataony amin ny manampahefana izay nekana sy napetraka ho tompon andraikitra manoloana ireo olona na fikambanana ireo (Edwards & Hulme 1996, araka ny voalazan i Mulgan, 2000). Ireto avy ny fepetra takiany (i) ny fidirana an-tsehatry ny antokon olona ivelany iray, (ii) ny fifanakalozana sy ny fifanoloran asa ara-tsosialy, sy (iii) ny fisian ny fifandraisana ara-pahefana. Ny tamberin andraikitra dia ny fampisehoan ireo tompon andraikitra ny asa vitany sy ny fahefan ireo tompon ny zo haneho ny heviny, izany hoe haneho ny filàny sy hitaky ny zony. «Amin ny kisarin ny domiverina misy ao amin ny olona miaina sy ao amin ny tontolo manodidina, ny rafitra ara-piarahamonina dia tsy maintsy manana ny fomba fandaminany azy. Isan izany ny lamina momba ny «tamberin andraikitra» ; izany dia ahafahan ny rafitra ara-piarahamonina mianatra, mandamina, mifanaraka foana amin ny samy vahoaka ao aminy ary manatanteraka ny iraka nampanaovina azy.» (Loharano: topics/accountability/using-accountability-relationships-to-support-capacity. html, 16/05/2015) Rafitry ny «aterokalao» FEO Tompon-jo Tinady SETRINY Tompon andraikitra Tolotra Cartographics, Heemskerk

3 2 Ahoana avy no azo isokajiana ny tamberin andraikitra? Mitsangana fifandraisana ara-tamberin andraikitra eo amin ny olompirenena sy ireo notoloram-pahefana (fifidianana, fomba hafa nahafahany nandray anjara na nanolo-tena) Marindrano eo amin ny rafitra ara-panjakana (mpanatanteraka/ olomboafidy/fitsarana) sy/na ireo sehatra mpanara-maso ny maha-olona Midina eo amin ny rafi-pahefana roa (oh : fitantanana eny ifotony mandeha any amin ny ministera mpiandraikitra na ny mifamadika amin izany) Sosialy Tamberin andraikitr ireo firafitra mankeny amin ny vahoaka (fitantanana ara-panjakana, mpiray antoka eo amin ny fampandrosoana mandeha any amin ireo tokony handray izany, sns ) Itambarana fifandraisana ara-tamberin andraikitra mifanakalo ao anatin ny fotoana voafetra Ivelany Tamberin andraikitr ireo mpisehatra ho an ny fampandrosoana ny firenena mankany amin ireo mpamatsy vola avy any ivelany sy ireo mpiara-miombon antoka ho an ny fampandrosoana Ara-pôlitika Manao tatitra ny asa vitany amin ny olom-pirenena ny Governemanta ary tsy manao fanararaotam-pahefana Arapitondrana sy ara-bola Firindran ny fahavitana asa sy ny fandaniam-bola. Fepetran ny fitantanana isan-tokony harahi-maso sy hanaovana tomban ezaka. Fanajana ireo fomba fitantanana.

4 3 Iza avy ireo mpisehatra hampisy ny tamberin andraikitra? Tsy tonga ho azy samy irery ny tamberin andraikitra fa nateraky ny fifandraisana amin ny mpisehatra ivelany OCDE IREO NAMETRAHANA ANDRAIKITRA Ny olom-boafidy, ny tompon andraikitra ara-panjakana, ny Fanjakana, ny mpamatsy vola, ny fikambanana misahana ny asam-bahoaka, ny orinasa IREO TOMPON NY ZO Ireo manan-jo handray ny vokatry ny asa nataon ireo nametrahana andraikitra, ny olom-pirenena / ny Mpanjifa Ny Governemanta, ny olom-boafidy, ny fiarahamonimpirenena (Fikambanana tsy miankina, mpikirakira vaovao, foibem-pikarohana, think tanks, sns...), ary koa ireo mpiara-miombon antoka ivelany dia mandray ny andraikitra tandrify azy ao amin ny fampahombiazana ny tamberin andraikitra. Toy izany koa ireo tompon andraikitra ara-toekarena, ara-pivavahana, ireo tompon ny fahefana netim-paharazana, sy ireo avara-pianarana dia samy mpisehatra hampisy ny tamberin andraikitra avokoa. Fa ny iarahana manaiky dia ny olompirenena no mipetraka ho tompon andraikitra fototra miantoka ny tamberin andraikitra. Telozoron ny asam-bahoaka Feo FANJAKANA Pôlitika Mpanapaka Lalana lava fifanarahana fifanekena OLOM-PIRENENA/MPANJIFA Lalana fohy MPANATANTERAKA NY ASA Fiombonana/Firaisana Fahefan ny mpanjifa Fitantanana Tsy mahantra Mahantra Kianja Fandaminana ASA (Loharano : Trainin_Manual/fr-training-maual-for-web.pdf, 16/05/2015)

5 4 Inona avy ireo zo sy fahefana ananan ny olompirenena momba ny fitakiana ny tamberin andraikitra? Ao amin ny andininy faharoapolon ny Fanambarana iraisam-pirenena momba ny zon olombelona sy ny maha-olom-pirenena tamin ny 24 Jona 1793 dia manamafy fa Tsy misy fandraisana anjara azo atao afa tsy izay ilain ny rehetra. Ny olom-pirenena rehetra dia tsy maintsy manana andraikitra amin ny fametrahana ny fandraisana anjara, fanaraha-maso ny fampiasana izany ary mahazo tatitra momba izany. Ny tamberin andraikitra izany dia azo lazaina ho fitaovana ahafahan ny olompirenena mitaky ary mandray ny tatitra avy amin ireo olomboafidy, avy amin ireo mpitantana ny fananam-panjakana. Ny zava-misy mampalahelo eto Madagasikara sy eo amin ireo firenena ao Afrika Atsimon i Sahara, dia ny fanamaivanan ny olompirenena amin ireo faritra ireo ny fitakiany amin ireo manam-pahefana isan-tsokajiny ny asa manara-penitra, ny mangarahara, ny fanolorana ny kaonty sy ny fahombiazana. Ny fitantanampanjakana mahomby dia manome toerana lehibe ny olompirenena izay tsy maintsy fototry ny fanapahan-kevitra. Ahoana? Ampiroboroboana ny tombony ho azy Mangataka kaonty amin ireo mpitantana Mandray anjara amin ny famoronana, ny fanatanterahana ary ny fanaovana tomban ezaky ny fandaharanasa sy ny politikak iombonana Zo sy fahefana Ampiroboroboana ny tombony ho azy Mangataka kaonty amin ireo mpitantana Mandray anjara amin ny famoronana, ny fanatanterahana ary ny fanaovana tomban ezaky ny fandaharanasa sy ny politikak iombonana Ampiroboroboana ny tombony ho azy Mangataka kaonty amin ireo mpitantana Mandray anjara amin ny famoronana, ny fanatanterahana ary ny fanaovana tomban ezaky ny fandaharanasa sy ny politikak iombonana Zava-kendrena

6 5 Inona no andraikitra manokana iantsorohan ny fiarahamonimpirenena amin ny fitakiana ny tamberin andraikitra? Manana andraikitra lehibe momba ny tamberin andraikitra ny fiarahamonimpirenena. Ny fikambanan ny fiarahamonimpirenena no ahafahana mampandray anjara ny olompirenena na mampanara-maso azy ireo amin ny alàlan ny fitradrahana izay rafitra sy fepetra mety hisy fiantraikany eo amin ny fanehoana, ny fandaminana ary ny fanatanterahana ny fandaharanasa sy ny fitantanana ny volam-panjakana hiatrehana ny filàn ny olompirenena rehetra sy ny fampandrosoana ny firenena. Ohatra amin izany rafitra izany dia ny fandraisana anjaran ny vahoaka amin ny fametrahana ny fitantanana ara-toekarena, ny fanaraha-maso ny volampirenena, ny fanaraha-maso ny fanatanterahana asam-panjakana, ny fandresendahatra ara-politika, ny fandraisana anjara amin ny fanapahan-kevitra amin ny alàlan ny dinika sy ny fihaonana ara-teknika na ara-politika, ny fiambenana sy ny fanaraha-maso ara-pirenena, ny fandaminana ny fomba fanehoan-kevitra. Manangona ny hevitra sy ny vaovao ihany koa ny fiarahamonimpirenena ary mandrafitra ny tatitra isaky ny fanaraha-maso vita. Ireo tatitra ireo dia hanehoana sy hanentanana fa ny fandalinana sy ny vokatra sy ny fandalinana ataon ny fiarahamonimpirenena dia azon ny rehetra jerena. Manamora ny fifandresendahatra ara-politika sy ny fandraisana anjara amin ny dinika hifanaovana izany. Azon ny fiarahamonimpirenena atao ihany koa ny mampiroborobo fiarahamiombon antoka sy fifandraisana amin ny manam-pahefana, ny mpiara-miasa ara-teknika sy ara-bola ary ireo mpisehatra samihafa mba ahazoana vokatra misimisy kokoa. Mpampifandray ara-tsosialy Miantoka ny fifampiresahana sy ny fifandraisana eo amin ny mpitondra sy ny hoentina Mpitondra feon ireo olompirenena Hery fanarahamaso ireo mpanampakevitra Fanarahana ny fandaniambolam-panjakana Andraikitra amin ny fanarahamaso sy filazana ny tsy mety Hery fandresendahatra Fanarahana ny fandrafetana ny fandaharanasa/tetibola Fandresen-dahatra amin ny fampidirana ny fitarainan ny olom-pirenena ao anatin ny fandaharana politika

7 6 Ahoana no hahatomombana ny tamberin andraikitra ara-politika? Ny tamberin andraikitra ara-politika dia fomba demokratika izay hanaovan ny olomboafidy sy ny governemanta tatitra ireo asa nataony ka tompon antoka eo anatrehan ny voahoaka tompoiny izy ireo ary tsy tokony hanararaotra ny fahefana hananany. Manatsara ny fahaiza-mitantana mitondra any amin ny fahombiazana sy mampitombo ny famarinan-toeran ny ny fanamafisana ny tamberin andraikitr izy ireo manoloana ny olompirenena. Manjary fototry ny famarinana ara-politika izany ny tamberin andraikitra. Ny fahalemen ny fifamatorana ara-tamberin andraikitra eo amin ny governemanta mankany amin ny olompirenena mantsy no endriky ny Fanjakana marefo. Hahazoana sy hanamafisana ny tamberin andraikitra politika mantsy, dia tsy maintsy apetraka ny fitsipika fototra marina sy azo tsapain-tanana, na manara-drafitra na tsia, izay hentina manazava ny anjara asa sy ny andraikitry ny mpitondra, ny tanjona iombonana sy ny fanakianana rehefa tsy araka ny fitsipika misy. Ny tamberin andraikitra politika dia mandavtlo amin ny fametrahana ny mangarahara, ny ady amin ny kolikoly, ny fampahatsiarovantena ny mpitondra sy ny vahoaka. Ny tompon ny zo Fitantanana ifotony Ny olom-boafidy sy ny rafi-panjakana Fakana hevitry ny vahoaka Fanamafisana ny fahaiza-manao Fanamarihana ny fandaminana Fomba entina hanamafisana ny rohin ny tamberin andraikitra ara-politika eo amin ny mpitondra sy ny entina Tomban ezaka Fanatsarana ny serasera Tomban ezaky ny fandaharanasa Fanamarihana ny fandaniam-bolampanjakana Fandalinana ny asa

8 7 Ahoana no hahatomombana ny tamberin andraikitra ara-politika? Raha tiana ny hahatomombana ny tamberin andraikitra ara-tsosialy, dia ilaina ny fandraisan ny mpiara-miombona antoka rehetra anjara amin ny fanatanterahana ny tetikasa, eny am-piandohana ka hatrany am-panantanteraha izany tetikasa izany. Isan ireo mpiara-miombona antoka ny Fanjakana, ny sehatra tsy mianky, ireo mpanohana ara-tekinika sy ara-bola, ny fiarahamonimpirenena ary ireo sehatra mpanara-maso isan-tsokajy. Zava-dehibe koa ny firotsahan ny haino aman-jery amin ny fanaraha-maso ny fampiharana izany tamberin andraikitra izany. Tokony ho hita amin ny dingana rehetra amin ny fanantontosàna ny tetikasa izany fandraisana anjara izany : ny fandaharan asa, ny famantarana ny zavatra ilaina sy zavatra anànana; ny famantarana izay ho laharampahamehana; ny fanantanterahana, ny fabaraha-maso sy ny fametraha tomban ezaka. Izany fandraisana anjara izany dia mila lamina mangaraharaha sy andraikitra mazava ho an ny rehetra. Tokony hisy koa anefa toeranamazava ho an ny Oniversite malagasy, manoloana izany fampahalalana sy fanazavana ny tamberin andraikitra izany. Ireo mpikaroka sy manam-pahaizana mantsy dia fantatra fa manana traikefa sy valim-pikarohana matotra, mba hahafahantsika mametraka endrika tamberin andraikitra izay mety sy tomombana ho an ny kolontsaina malagasy ary manaja ny fahasamihafana ara-kolontsaina sy araka ny foto-pisainana malagasy.

9 8 Inona avy ireo ambaratonga-pahefana misy ao amin ny fanjakana malagasy hafahana mitaky ny tamberin andraikitra? Ny sehatra sy fototr asa rehetra dia manana ambaratomgam-pahefana manokana hahafahana mitaky ny tamberin andraikitra. Ohatra amin izany ny fikambanan ny mpanjifa, ny sendikan ny mpiasa, ny komity mpanara-maso isan-tsokajy.etsetra : vondrona maro sy sehatra samiihafa izay afaka manao fanaraha-maso amin ny lafiny tamberin andraikitra. Ny ady amin ny kolikoly eto Madagasikara Napetraka Ny birao mahaleo tena miady amin ny kolikoly (BIANCO) tamin ny taona 2004, mba ho fanatanterahana ny paikady nasionaly amin ny ady amin ny kolikoly : ny fisorohana sy ny fanabeazana ny vahoaka. Taorian izany dia nametraka rafitra fametrahana fitarainana ny BIANCO teny anivon ny distrika ( Ny Médiateur de la République Ny Médiateur de la République dia rafitra mahaleo tena, noforonina araka ny lalàna tamin ny Ireto no sahaniny : (i) Fanelanelanana sy fifampiresahana maharitra eo amin ny fitantanana arapanjakana sy ny tantanina, ny asam-bahoaka sy ny vahoaka; (ii) Ny fanelanelanana rehefa misy tsy fifanarahana eo amin ny fanatanterahana ny asam-bahoaka. (iii) Ny fisorohana ny fiverenan ny tsy fetezana eo amin ny fanatanterahana ny asam-bahoaka. Araka izany dia azon izay olona rehetra mifandray amin ny fanatanterahana asam-bahoaka antsoina ny Médiateur de la République.

10 Ny lalana ara-pitsarana Raha hitory na hanao fitakiana mikasika ny tamberin andraikitra eto Madagasikara dia mila fantarina aloha ilay olona na rafitra hotoriana. - Raha hitory ny Fanjakana na ny mpiasampanjakana dia ny Rafi-pitsarana momba ny fitantanana no mahefa. Raha hampiakatra ny raharaha ny mpangataka dia manatona ny «Cour d appel administrative». Raha manao «pourvoi en cassation» dia afaka kianina manoloana ny «Conseil d Etat» ilay didy na fanapahankevitra nivoaka teo aloha. - Momba ny mpitsara kosa dia sazy mifandray amin ny fitsipi-pipehezana («discipline») no miantra aminy ary ny Minisitry ny Fitsarana (rehefa avy naka hevitra tamin ireo Filoha-na tribonaly) no manasazy azy rehefa avy nandray fitarainana voamarina momba io mpitsara io izy, na koa nandre feo mikasika ny toetra tsy mendrika ataon io mpitsara io izy. - Ny «Haute Cour de justice» dia afaka mitsara ireo raharaha mahakasika famadiham-pitokisana («haute trahison»), fandikana mavaivay sy matetika ny Lalàmpanorenana, fanaovana toetra na asa tsy afaka miaraka amin ny maha-filohan ny Repoblika. Raha nahavita heloka bevava sy heloka tsotra ny filohan ny Antenimierampirenena, ny Praiministra, ny mpikambana ao amin ny Governemanta, na ny filohan ny Fitsarana Avo momba ny Lalàmpanorenana ka tsy nankato ireo adidiny amin ny lafin ny tamberin andraikitra dia afaka enjehina manoloana ny «Haute Cour de justice» izy ireo.

11 9 Ohatra velona : ny tamberin andraikitra eo amin ny fitrandrahana ny harena ankibon ny tany eto Madagasikara Betsaka ny sehatra miara-miasa mna hametrahana ny tamberin andraikitra eo amin ny fitrandrahana ny haerna ankibon ny tany. Ao ny Office national de l environnement (ONE), izay manome ny alalàna hitrandraka rehefa hita fa tsy olana amin ny tontolo iainana ny asa kendrena hatao, ary any aminy koa no handefasan ny orinasa ireo tatitra samihafa ilaina amin izany. Ao koa ny Office des Mines Nationales et des Industries Stratégiques (OMNIS) izay manara-maso ny fitrandrahana harena ankibon ny tany. Isaky ny dingana rehetra eo amin ny fametrahana orinasa mpitrandraka harena an-kibon ny tany dia hahafahana hatrany mitaky ny tamberin andraikitra, raha toa ka tena voahaja antsakany sy andavany izany dingana izany : Fijerena ny mety ho fiantraikan ny asa fitrandrahana amin ny tontolo iainana, ny fazahoana taratasy fitrandrahana ara-dalàna, ny fanajana ny bokin andraikitra ; ny fampandraisana andraikitra ny vondron olona ifotony dieny vao manomboka ny asa mandra-pahatanteraka izany, mba hisian ny vahaolana ara-dalàna, mifandanja ary mifandraika amin ny zava-misy izay sady mihatra eo no hoe no mihatra ho an ny ho avy.

12 10 Ny fandraisan andraikitra ara-tsosialy ataon ny orinasa Ny fandraisana andraikitra ara-tsosialy (responsabilité sociétale des entreprises RSE) ataon ny orinasa dia ny finiavany handray an-tanana ny lafiny aratsosialy sy ara-tontolo iainana eo amin ny hevitra tapahany sy tanterhana ary ny finiavany koa hamantatra sy hiatrika izay vokatra rehetra ateraky ny asany eo amin ny fiarahamonina. Finiavana mila fitondrana mangaraharaha sy madio. Amin ny naimpony no anaovan ny orinasa izany, ho fandraisany anjara, ao amin ny fananterahana ny asany sy ny tanjony amin ny fandrosoana lovainjafy. Amin izany dia omeny tombony hatrany ny fahafahan ny rehetra migoka ny zo fototra ananany toy ny fianarana, ny fahasalamana, ny zo ny mpiasa, ny fiarahamonina amin ny vahoaka manodidina, ny ady amin ny kolikoly etsetra.. Ny fampiharana izany tamberin andraikitra izany dia manaraka lalàna sy fitondrantena izay eken ny lalàna ankapobeny iraisan ny firenena rehetra, eken ny firenena iasana ary eken ny fiarahamonina akaiky : mandala izany an-tsitrapo ny orinasa. Misy ireo fitaovana ilaina amin izany : satam-pitondrantena sy fomba fiasa, mari-pankasitrahana sy labels isankarazant. Tombony ho an ny orinasa ny fametrahana fandraisana andraikitra ara-tsosialy satria sady mahatsara endrika azy imason izao tontolo izao no mampatanjaka azy eo amin ny lafiny aratoekarena : manandratra fiarahamiasa sy fampiasambola madio sy mamokatra izy ary manaja ny fiarahamonina sy ny tontolo manodidina azy. Fisaorana eram-po, eran-tsaina, ho an ireo mpiaramiombon antoka sy olompirenena mandray andraikitra, izay nifanome tànana hahatontosa ity boky kely ity. Noho ny zotom-po sy fikirizantsika dia misandratra hatrany ny fampahafantarana ny atao tamberin andraikitra ary hozaraintsika amin ny manodidina antsika izany. Ianao koa, ry mpamaky hajaina, dia asainay hizara izany sata izany amin ireo akaiky anao. Misaotra, noho ny anjara biriky raisinao. Liberty 32 Facebook: ) Genius Of Designers 2015

13 Genius Of Designers La responsabilité sociétale des entreprises La responsabilité sociétale des entreprises (RSE) est la volonté d une entreprise d assumer les considérations sociales et environnementales dans ses décisions et de s engager à en assumer les impacts, à travers un comportement transparent et éthique. Les entreprises s engagent volontairement à contribuer, dans leurs fonctionnements et leurs missions, au développement durable à travers l appui à l accès aux droits fondamentaux tels que l éducation, la santé de base ; les conditions de travail ; les relations avec les communautés locales ; la lutte contre la corruption etc. L application de la RSE s inspire d un recueil de normes internationales, nationales et même locales, auxquelles les entreprises se soumettent consciemment. Pour ce faire, divers outils sont utiles : codes de conduite, chartes, labels ou certifications. La RSE est un atout pour la réputation des entreprises et est un pilier économique : elle crée des investissements sains et productifs, respectant l environnement et le social. Nos remerciements à celles et ceux, partenaires et citoyens engagés, qui ont permis que ce livret voie le jour. Grâce à la persévérance de chacun, nous avons pu, ensemble avancer dans notre démarche de faire connaître l esprit de la redevabilité et de partager cette valeur autour de nous. A votre tour, cher lecteur, imprégnez-vous de ce principe et partagez-le autour de vous. Merci, pour votre engagement. Liberty 32 Facebook: )

14 9 Un exemple pratique : la redevabilité dans le secteur minier à Madagascar? Dans le secteur minier, plusieurs instances agissent pour contrôler la redevabilité des entreprises d extraction minière. L Office national de l environnement (ONE), qui accorde les autorisations d exploitation et vers qui doivent être régulièrement les rapports émanant d entreprises et sociétés impactant sur l environnement; l Office des Mines Nationales et des Industries Stratégiques (OMNIS) qui surveille les activités d extractions minières. Plusieurs étapes dans le processus d établissement et d exploitation d une société minière permettent de s assurer de la redevabilité des acteurs, si tant est que chaque étape est scrupuleusement respectée : études d impacts environnementaux, obtention d autorisation d exploitation et de toutes autorisations officielles et légales, respect des dispositions du cahier des charges, implication des communautés locales en amont et en aval pour un dédommagement équilibré et réaliste, dans l immédiat et sur le long terme.

15 Recours juridictionnels Pour faire un recours en matière de redevabilité à Madagascar, il faut tenir compte de la personne contre qui le recours est formé. Celui qui rend compte est toute personne exerçant une fonction publique dans le sens large du terme. - Si le recours est formé contre l Administration ou un agent public, c est le tribunal administratif qui est compétent. En cas d appel, le requérant doit saisir la Cour d appel administrative. En cas de pourvoi en cassation, l arrêt peut être contesté devant le Conseil d Etat. - Quant au juge, les poursuites sont disciplinaires et c est le Ministre de la Justice sur avis des chefs de Cour qui en prend l initiative, et ce, suite à une plainte ou après qu il ait été informé de faits de nature à entraîner des poursuites disciplinaires contre ledit magistrat. - La Haute Cour de justice peut juger des actes de haute trahison, de violation grave, ou de violations répétées de la Constitution, de manquement à des devoirs manifestement incompatibles avec l exercice du mandat de Président de la République. Par ailleurs, si des crimes et des délits sont commis par les Présidents des Assemblées parlementaires, le Premier ministre, les membres du Gouvernement et le Président de la Haute Cour constitutionnelle, et qu ils vont à l encontre de leur obligation de redevabilité, ils sont pénalement responsables devant la Haute Cour de justice.

16 8 Quelles sont les instances administratives qui permettent un recours en matière de redevabilité à Madagascar? Chaque domaine et chantier dispose d un recours administratif en matière de redevabilité. Associations d usagers, syndicats, comité de contrôle, etc. : autant de groupes et d instance qui peuvent jouer un rôle de suivi en matière de redevabilité. La lutte contre la corruption à Madagascar En 2003, Madagascar a mis en place le Conseil Supérieur pour la Lutte Contre la Corruption (CSLCC) transformé en Comité pour la Sauvegarde de l Intégrité (CSI) en 2006 qui a notamment eu pour mandat d instaurer le Bureau Indépendant Anti-Corruption (Bianco) en Il met en œuvre la stratégie nationale anti-corruption par la prévention et l éducation. Le Bianco a initié un mécanisme de dépôt des doléances dans chaque district. ( Le Médiateur de la République C est une autorité indépendante de caractère sui generis créée par l ordonnance du 12 avril Il a une fonction de régulation reposant sur trois missions : (i) le rôle d intercesseur institutionnel qui anime et conduit un dialogue permanent entre l Administration publique et les administrés, le service public et ses usagers ; (ii) le règlement à l amiable des litiges imputables au mauvais fonctionnement du service public. (iii) La prévention de la répétition des cas de dysfonctionnement des services publics. Le Médiateur de la République peut être saisi par toute personne physique motivée par une question liée à l exercice et au fonctionnement des services publics à Madagascar.

17 7 Comment obtenir la redevabilité sociale? La redevabilité sociale exige une mobilisation de toutes les parties prenantes du projet, en amont et en aval. Par parties prenantes, on précise l Administration, le secteur privé, les partenaires techniques et financiers, l organisation de la société civile, les organismes de contrôle et de suivi. Il est aussi important d impliquer les médias. Cette mobilisation commence dès la conception même du projet, afin que ces parties prenantes puissent s en approprier le plus tôt possible. L implication se fait à toutes les étapes de la mise en œuvre du projet: la planification, l identification des besoins et des ressources, la priorisation, l exécution, l évaluation et le suivi. Ces implications à toutes les échelles exigent également un processus transparent et une répartition claire des rôles et des responsabilités de chaque entité. L université est appelée à jouer un rôle actif dans l enseignement et la vulgarisation des principes de la redevabilité. En effet, chercheurs et universitaires, par leurs travaux permettront d établir un concept de redevabilité qui correspond aux normes et aux attentes de la société malgache, tenant compte de la diversité culturelle, identitaire et morale.

18 6 Comment obtenir la redevabilité politique? La redevabilité politique est le principe démocratique selon lequel les élus et le gouvernement d un pays doivent rendre compte de leurs actions et sont redevables de ces actions auprès des populations qu ils servent et ne pas abuser de leur pouvoir. Le renforcement de la redevabilité des dirigeants devant les citoyens contribue à améliorer leur capacité à gouverner de manière efficace et asseoir leur légitimité. Elle devient ainsi une base de stabilité politique. La faiblesse des liens de redevabilité du gouvernement envers les citoyens a, en effet, été déterminée comme l un des éléments caractérisant les Etats fragiles. Pour obtenir et renforcer la redevabilité politique, il faut avant tout établir des «règles de base» légitimes et fiables, informelles ou formelles, pour clarifier les rôles et responsabilités des gouvernants, le but commun et la remise en cause lorsque les choses ne sont pas faites dans les règles. La redevabilité politique passe par l établissement d une meilleure transparence, la lutte contre la corruption, la conscientisation des dirigeants comme des dirigés et leur responsabilisation. Des détenteurs de droits Du leadership local Des élus et des entités étatiques Consultations publiques Renforcement de capacités Contrôle des organisations Moyens de raffermissement des liens de redevabilité politique entre population et gouvernants Evaluation de performance Amélioration de la communication Evaluation des programmes Contrôle des dépenses publiques Analyses fonctionnelles

19 5 Quels sont les rôles particuliers des Organisations de la Société civile (OSC) dans la demande de redevabilité envers les élus et les gouvernants? La société civile a un rôle majeur à tenir en matière de redevabilité. Les OSC permettent la mise en œuvre de la participation citoyenne ou du suivi citoyen en exploitant des mécanismes sur la formulation, la planification et l exécution des programmes et des finances publiques. Ces mécanismes sont par exemple la participation de la population à l élaboration de la politique de l économie, le pistage budgétaire, le suivi des prestations de services publics, le plaidoyer politique, la participation à la prise de décision à travers le dialogue et des rencontres techniques ou politiques, la veille et le contrôle citoyen, l organisation de campagnes d opinion. Les OSC collectent les informations, élaborent des rapports alternatifs de suivi. Ces rapports font l objet de publication et de sensibilisation. Ils facilitent le plaidoyer politique et la participation aux cadres de dialogue. Les OSC peuvent aussi développer des partenariats et faire du réseautage avec les autorités, les partenaires techniques et financiers et autres acteurs pour escompter plus de résultats. Connecteur et amplificateur social Assure le dialogue et la connexion entre gouvernants et gouvernés Porte-parole des citoyens Force de controle des decideurs Suivi de l execution des depenses publiques Role de watchdog/interpellation Force de plaidoyer et d influence Suivi de l elaboration des programmes/budgets Plaidoyer pour l integration des doleances citoyennes dans l agenda politique

20 4 Quels sont les droits et pouvoirs du citoyen en matière d exigence de redevabilité? La déclaration des droits de l Homme et du citoyen du 24 juin 1793 dans son article 20 affirme que «nulle contribution ne peut être établie que pour l utilité générale. Tous les citoyens ont droit de concourir à l établissement des contributions, d en surveiller l emploi et de s en faire rendre compte». La redevabilité est le mécanisme par lequel les citoyens exigent et reçoivent des comptes des élus, des gouvernants, des gestionnaires des deniers publics. A Madagascar, les citoyens sont peu exigeants face aux autorités en matière de qualité de service, de transparence, de reddition des comptes et d efficacité. La bonne gouvernance priorise le citoyen qui doit être mis au centre du processus décisionnel. Promouvoir leurs intérêts Demander des comptes aux gouvernants Participer à la conception, mise en œuvre et évaluation des programmes et politiques publiques Comment? A travers des structures comme la société civile, les partis politiques, les médias, les syndicats Sur la base d initiatives individuelles Audits citoyens Suivi et évaluation des budgets/programmes/ projets Présentation publique et justification des résultats/analyses/ comportements/comptes des dirigeants et des prestataires des services publics. Droits et pouvoirs Objectifs

21 3 Quels sont les acteurs de la redevabilité? «La redevabilité ne se décrète pas seule : elle nait d une relation avec un acteur extérieur.» Organisation de Coopération et de Développement Economique (OCDE) Porteurs de responsabilités Détenteurs de droits Les élus, les responsables étatiques, l Etat, les bailleurs de fonds, les organismes prestataires de services publics, les entreprises Les bénéficiaires légitimes des actions menées par les porteurs de responsabilités. Citoyens/clients Acteurs gouvernementaux, acteurs parlementaires, acteurs de la société civile (ONG, médias, centres de recherche, think tanks, etc.), mais aussi acteurs bilatéraux et multilatéraux extérieurs, a``ssurent chacun des rôles spécifiques dans le processus de redevabilité. De même, les opérateurs économiques, les responsables religieux, les détenteurs du pouvoir traditionnel, les intellectuels sont également des acteurs à part entière de la redevabilité. Mais on s accorde à dire que l acteur principal reste le citoyen qui doit être le garant de la redevabilité. Le Triangle de redevabilité du service public Voix Politiques L ÉTAT Itinéraire long Décideurs Contrats Pactes CITOYENS/CLIENTS Itinéraire court PRESTATAIRES Coalitions/inclusivité Pouvoir du client Gestion Non-pauvretes Pauvres Terrain Organisations Services (Source : Manual/fr-training-maual-for-web.pdf, 16/05/2015)

22 2 Quels sont les différents types de redevabilité? Verticale Relations de redevabilité entre citoyens et leurs mandataires publics (élections, autres formes de participation / engagement citoyen) Horizontale Entre institutions publiques (executif/legislatif/judiciaire) et/ ou envers des organismes de controle: commissions des droits de l homme Vers le haut/bas Entre deux niveaux de pouvoir (ex: administration locale vers ministere de tutellle, et inversement) Sociale Redevabilité d organisations envers la population (administration publique, partenaires de développement envers bénéficiaires, etc.) Mutuelle Relation de redevabilité réciproque de nature contractuelle Extérieure Redevabilité des agents de développement du pays envers les bailleurs extérieurs et les partenaires de développement Politique Le gouvernement rend compte de ses actions auprès de ses citoyens et n abuse pas de son pouvoir Administrative/ Financière Rapport sur les performances et les dépenses. Normes de gouvernance sectorielles revues et évaluées. Respect des codes de conduite.

23 1 Qu est-ce que la redevabilité? Pourquoi est-elle importante? La redevabilité peut se définir comme «le moyen par lequel des individus ou des organisations rendent compte de leurs actes à une (ou des) autorité(s) reconnues et sont tenues pour responsables de ceux-ci.» (Edwards et Hulme 1996, cité par Mulgan en 2000). Le processus implique (i) l intervention d une tierce partie, (ii) un échange et une interaction sociale, et (iii) une relation d autorité. Plus simplement, la redevabilité correspond à la réactivité des «porteurs de responsabilité» et à la capacité des «détenteurs de droits» à faire entendre leur voix, à exprimer leurs besoins et à revendiquer leurs droits. «À l image des boucles de rétroaction qui existent chez les organismes vivants et dans les écosystèmes, les systèmes sociaux doivent disposer de fonctions de régulation. Les mécanismes de redevabilité en font partie ; ils permettent aux systèmes sociaux d apprendre, de s autoréguler, de rester pertinents par rapport à leur public et de s acquitter de leurs missions.» (Source : capacity.org/capacity/opencms/fr/topics/accountability/using-accountabilityrelationships-to-support-capacity.html, 16/05/2015) Détenteures de droits Demande Mécanismes de redevabilité VOIX REACTIVITE Cartographics, Heemskerk Porteurs de resposabilité Offre

24 Together, build a brighter future.?????? LA REDEVABILITE EN 10 QUESTIONS

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg 0 UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar HUMBOLDT-UNIVERSITÄT ZU BERLIN Landwirtschaftlich-Gärtnerische Fakultät Schriftenreihe des Seminars für Ländliche Entwicklung VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA TATITRA ANIVON NY ANTENIMIERAM- PIRENENA Praiminisitra Jean RAVELONARIVO 1 TATITRA MANOLOANA NY ANTENIMIERA I 21 MAY 2015 21 MAY 2015 Andininy 54.- Ny Filohan ny Repoblika no manendry ny Praiminisitra

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

Évaluation de l impact environnemental et social

Évaluation de l impact environnemental et social RÉPUBLIQUE DE MADAGASCAR Tanindrazana - Fahafahana - Fandrosoana PRÉSIDENCE PROJET PÔLE INTÉGRÉS DE CROISSANCE Secrétariat National Évaluation de l impact environnemental et social Cadre de politique de

Plus en détail

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY MINISTERAN NY FAMBOLENA NY FIOMPIANA ARY NY JONO ----------------------------------- REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana ---------------------------------- MINISTERAN NY TOEKARENA

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

Le malgache. L exemple d une langue sans test

Le malgache. L exemple d une langue sans test Le malgache L exemple d une langue sans test 1. Pourquoi n existe t il pas de cer:fica:on? Peu d échanges commerciaux avec l extérieur Pas d immigra:on importante de «cols blancs» Peu d étudiants étrangers

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

DISPOSITIONS COMMUNES

DISPOSITIONS COMMUNES ORDONNANCE N 62-074 du 29 SEPTEMBRE 19 62 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics. ( J.O. n 248 du 12.10.62 p. 2248 ) modifiée et complétée

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

46 Ordonnance n 62-074 du 29 septembre 1962

46 Ordonnance n 62-074 du 29 septembre 1962 Ordonnance n 62-074 du 29 septembre 1962 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics (J.O. n 248 du 12.10.62, p. 2248), modifiée et complétée par

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Ventin-kevitra Matoan-dahatsoratra Fampahafantarana an i Madagasikara 4 Ny Nosy Telma, mpandraharaha nasionaly manara-penitra iraisam-pirenena

Plus en détail

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA Public Disclosure Authorized a REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana JIRAMA JIRO SY RANO MALAGASY E1 403 VOL. 1 Public Disclosure Authorized Public Disclosure Authorized ÉVALUATION

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

Note pratique. Réseau PRATIQUES

Note pratique. Réseau PRATIQUES Note pratique Ny Herin ny hafatra / Le pouvoir des messages pour la santé préventive Expérience du programme de santé materno-infantile mené par Inter Aide à Farafangana, Madagascar Notice Type de document

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville

SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville TOERANA ALEHA FIAINGANA ZOTRA RAISINA DESTINATION DEPART TANA LIGNE A PRENDRE A Ambohitrapeto Isotry D Itaosy Itaosy

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

RAPPORT DE FORMATION

RAPPORT DE FORMATION RAPPORT DE FORMATION CHANGEMENT DE COMPORTEMENT ET DE CARACTERE Dans la Lutte contre la Corruption Commune ANTSIRABE Région VAKINANKARATRA Organisation de la Société Civile Hotel IMPERIAL Antsirabe 20

Plus en détail

2. Comment l'exactitude et le périmètre des informations dans votre COP est-elle évaluée par un tiers crédible?

2. Comment l'exactitude et le périmètre des informations dans votre COP est-elle évaluée par un tiers crédible? Oui/ 2015 Global Compact Communication On Progress - Advanced (2014 data) Questions d'auto-évaluation 1. Votre COP contient-elle, si pertinent, une description de politiques et de pratiques liées aux opérations

Plus en détail

- FORMATION Maîtrise d un portefeuille: Analyse de risque et recouvrement. CEFOR Module de formation interne

- FORMATION Maîtrise d un portefeuille: Analyse de risque et recouvrement. CEFOR Module de formation interne - FORMATION Maîtrise d un portefeuille: Analyse de risque et recouvrement CEFOR Module de formation interne Introduction La formation sur «La maîtrise d un portefeuille: analyse de risques et recouvrement»

Plus en détail

PROJET DE LOI N 027/2007

PROJET DE LOI N 027/2007 REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PROJET DE LOI N 027/2007 DU 25 OCTOBRE 2007 PORTANT LOI DE FINANCES POUR 2008 IMPRIMERIE NATIONALE 2007 - 2 - PROJET DE LOI N 027/2007 PORTANT

Plus en détail

d une solution malgachomalgache

d une solution malgachomalgache cyan magenta jaune noir PROGRAMME P.7 ECONOMIE TRANSITOIRE FANANAN-TANY DECHETS URBAINS Interventionnisme critiqué BIRAO FOTOTRA A VALORISER L inaccessibilité aux intrants notamment aux engrais induit

Plus en détail

Les collectivités territoriales ont-elles un avantage comparatif en tant que prestataires de service?

Les collectivités territoriales ont-elles un avantage comparatif en tant que prestataires de service? Les collectivités territoriales ont-elles un avantage comparatif en tant que prestataires de service? La pauvreté peut prendre différentes formes et nécessite donc de disposer d un éventail de réponses

Plus en détail

Module I COMPRENDRE L ENJEU, POLITIQUE, PRINCIPES ET CONTEXE DE LA GESTION AXEE SUR LES RESULTATS DU DEVELOPPEMENT

Module I COMPRENDRE L ENJEU, POLITIQUE, PRINCIPES ET CONTEXE DE LA GESTION AXEE SUR LES RESULTATS DU DEVELOPPEMENT LA GESTION AXEE SUR LES RESULTATS DU DEVELOPPEMENT Module I COMPRENDRE L ENJEU, POLITIQUE, PRINCIPES ET CONTEXE DE LA GESTION AXEE SUR LES RESULTATS DU DEVELOPPEMENT 1 Les valeurs à partager pendant l

Plus en détail

Sortie des YLTPiens 6ème promotion

Sortie des YLTPiens 6ème promotion Démocratie et justice sociale N 05-4 ème trimestre 2010 Sortie des YLTPiens 6ème promotion SOMMAIRE Débat sur la démocratie P - 2 Fa endrika fiaraha-miasa toa inona no ilaina? P - 2 Autre point de vue

Plus en détail

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent cyan magenta jaune noir PROGRAMME P.7 RENCONTRE DE VONTOVORONA POSSIBLE ECHEC Les partis et associations de GRATUIT QUOTIDIEN D INFORMATION N 0137 DU Mercredi 25 Août 2010 FIARAHAMONINA HADIHADIANA NY

Plus en détail

Noely 2009 Taom-baovao 2010

Noely 2009 Taom-baovao 2010 FMM Fiombonana Miara-mivavaka eto Münich. Noely 2009 Taom-baovao 2010 Fa Zaza no teraka ho antsika, Zazalahy no omena antsika, ary ny anarany atao hoe Mahagaga, Mpanolon-tsaina, Andriamanitra Mahery, Rain

Plus en détail