UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP Antananarivo - Tél /

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg"

Transcription

1 0 UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP Antananarivo - Tél / Notre vocation : présenter Jésus Christ aux élèves et étudiants

2 1 UGBM B.P 4181 Antananarivo 101 Tél Lot II F 35 Ter Antsahameva Andraisoro FITSIPIKA ANATINY - U G B M Savaranonando: Ny «Statuts» na ny Sata dia manoritsoritra ny maha-izy ny fikambanana. Izay fara fahakeliny takian ny lalàna ihany no voarakitra ao. Ny Fitsipika Anatiny kosa no mamelabelatra izay voalaza ao anatin ny Sata kanefa tsy voavahavaha. Izy koa no mirakitra izay rehetra tsy voalaza ao amin ny Sata kanefa tena mahakasika ny fiainan ny fikambanana araka ny voalaza ao amin ny andininy faha-19. Natao hiainana sy hampiharina eo amin ny fiainana an-davanandron ny fikambanana ny Fitsipika Anatiny, noho izany dia tokony ho fantatry ny mpikambana rehetra ary indrindra indrindra, tokony ho voafehin ny mpiandraikitra isan ambaratonga tsara. TITRE I: NY "BASE DOCTRINALE" And.1 - Tsy azo ovàna ny vontoatin ny "Base Doctrinale" ary tsy maintsy eken'izay rehetra te-hirotsaka ho mpikambana - Mila manao sonia azy io ny mpiandraikitra Foibe rehetra (ny mambran'ny Conseil d'administration (CA), ny mambran'ny Secrétariat Général (SG), ny Délégué UGBM) isaky ny fotoam-pivorian'ny Filan-Kevi-Pirenena (FKP) na ny mpiandraikitra vao voafidy izany, na izay nohavaozina tamin'ny andraikiny, na ny Matihanina. - Mila manao sonia azy io koa ny Komitin'ny Groupe Biblique Local (GBL) izay vao nofidiana. TITRE II: NY RAFI-PITANTANANA And. 2 Momba ny Filan-Kevi-Pirenana (FKP) Misy karazany roa ny FKP: - ny FKP tsotra - sy ny FKP manokana 2.1 Momba ny FKP tsotra FKP natao handinihana sy handraisana fanapahan-kevitra momba ny fiainana an-davanandron'ny Fikambanana Fotoam-pivoriana, fetr'isa (quorum), fanomezam-pahefana (procuration) - Mivory isan-telo taona mandritra ny fotoana anaovana ny Zaikaben'ny Fikambanana ny FKP raha tsy misy zavatra tsy azo anoharana ka ny CA no manao antso - Faharetany: 4 10 andro - Toerana hanaovana FKP amin ny manaraka: manolo-kevitra toerana 3 ny FKP ary ny SG no mandalina ireny sy manapa-kevitra. - Fetr'isa (quorum) sy fanomezam-pahefana (procuration): Amin'ny fotoam-pivoriana tsotra dia azo tanterahina ny FKP raha ny an-tsasa-manila miampy iray amin'ny GB mivondrona ao amin'ny UGBM no tonga na voasolo tena. Azon'ny GBL tsy afaka hanatrika ny FKP atao ny manome fahefana GBL hafa hisolo tena azy sy handray fanapahan-kevitra amin'ny anarany antony manokana tena tsy azo anoharana anefa vao azo ekena ny fanomezam-pahefana, izay tsy maintsy ampahafantarina ny Foibe mialoha; ny fanomezam-pahefana dia tsy maintsy vita antsoratra ary voasonian'ny Tonia sy komity iray ka voamarin'ny Délégué UGBM eo an-toerana (raha misy), na ny Tonian'ny Sakaiza (raha tsy misy Délégué UGBM) Ny mambra manan-jo hanapa-kevitra amin'ny FKP : - ny mambran ny CA - ny mambran ny SG afa-tsy ireo Matihanina - ny Délégué UGBM any amin ny GBL - ny solontenan ny GBL tsirairay (Universitaires, Secondaires, Amis) izay feran ny SG arakaraky ny tanjany ara isa (prorata numeris) ary ampahafantariny ny CA. Ny ho solon-tenan ny GBL dia izay.komity voafidy na hofidiana ka lohalaharana amin'izany ny Tonia Afaka manatrika ny FKP sy manome tolo-kevitra saingy tsy manapa-kevitra kosa : - Ny mambra rehetra amin ny UGBM sy ny avy amin ny GBUAF sy IFES - Ireo olona nasaina manokana (ny UGBM dia afaka miantso olona ivelan ny Fikambanana raha misy ilàna izany) Ny birao mitarika ny FKP: Ny Filoha sy Filoha Lefitry ny CA ary ny Sekreteran ny UGBM no birao mitarika ny dinik'asa FKP rehetra ary tompon'andraikitra amin'ny fifehezana ny fotoam-pivoriana mba hahatrarana ny zava-kendrena. Toy izao amin'ny ankapobeny ny andraikitry ny Birao: a) Filoha

3 2 - Mitarika sy mandrindra ny fivoriana - Mitandro ny hisian'ny filaminana hatrany ary manao izay hahalavorary ny laha-dinika ara-potoana. - Mamoaka olona na mampiato ny fivoriana raha misy ilàna izany. b) Filoha Lefitra: - Manampy ny Filoha Misolo toerana ny Filoha raha misy tsy fahafahany d) Sekretera: - Mandray an-tsoratra ny fizotry ny dinik'asa rehetra - Mamintina an-tsoratra ka atao FANAMBARANA, ny fizotry ny fotoana sy ny hevitra tapaky ny FKP rehetra. Fanamarihana: Ny fahefan'ny birao dia mandritra ny fotoam-pivoriana ihany, ary feran'ny Tenin'Andriamanitra sy ny Statuts ary ny Fitsipika Anatiny UGBM izany Momba ny dinik'asa sy ny lahadinika Ny soso-kevitra dinik'asa dia raisina avy amin'ny GB (U,S, A), CA sy SG ary mila tonga 2 volana mialohan'ny FKP ao amin'ny Foibe izany fara fahatarany. Izay soso-kevitra tonga aorian izany dia tsy raisina intsony. Ny CA no mandravona sy manivana izay tokony hodinihana any amin'ny FKP ary mandefa izany indray any amin'ny GBL iray volana mialohan'ny FKP. Na izany aza, ny FKP dia manana fahefana hanolotra lahadinika vaovao lany eran ny be sy ny maro, ankoatr'ireo efa voalahatra Fomba fifidianana Araka izay tapaka na ifanarahan'ny be sy ny maro avy amin'ny tolo-kevitry ny birao FKP Lany izay olona na fehin-kevitra eken'ny an-tsasa-manilan'ny mpifidy, afa-tsy amin'ny fandaniana Statuts na Règlement Intérieur izay mitaky ny faneken'ny roa ampahatelon'ny mpandatsa-bato (2/3) Famaranana ny FKP Rehefa vita ny dinik'asa rehetra, dia fintinin'ny birao an-tsoratra ka atao Fanambaràna ny hevi-dehibe tapaky ny FKP. Eo am-pitsanganana no ihainoan'ny mpanatrika rehetra ny Fanambaràna izay vakian'ny Sekretera amin'ny fotoam-pamaranana ny fivoriana. Aorian'ny fanambarana ny fikatonan'ny FKP ataon'ny Filoha mpitarika, dia atolotry ny birao amin'ny Filoha vaovao na ny Filoha Lefitra vaovao na izay Mpanolo-tsaina zokiny indrindra vao voafidy ireo an-tontan-taratasy rehetra ary mifarana eo koa ny andraikitra sy fahefan'ny birao FKP voafetra (na restreint) FKP tsotra ihany izy ity (izany hoe handinihana ny fiainana an-davanandron'ny Fikambanana) kanefa noho ny toe-javamitranga eo amin'ny Firenena na eo amin'ny Fikambanana dia voatery ferana ihany ny isan'ny mpanatrika sy ny faharetany ka ny CA sy SG no miara-midinika momba izany. Ampiharina izay rehetra voalaza etsy ambony afa-tsy ny Momba ny FKP manokana FKP antsoina manokana araka ny fangatahan'ny telo ampahaefatry ny mambra CA, na ny antsasaky ny GB mivondrona ao amin'ny UGBM, mba handinihana lohahevitra manokana sady lehibe mahakasika ny Fikambanana (oh. Fandravàna ny Fikambanana) Fepetra a) Fetr'isa (quorum): Tsy misy fetr'isa fa afaka mivory izay tonga, saingy tsy maintsy mahafeno ny fepetra voalaza ao amin'ny d) etsy ambany vao lany ny fehin-kevitra antom-pivoriana. b) Ny manan-jo hanapa-kevitra: - ny mambran'ny CA - ny mambran'ny SG afa-tsy ny Matihanina - ireo Délégués UGBM any amin'ny GBL - solon-tena iray isaky ny GBL (U, S, A) d) Fahalanian'ny fehin-kevitra (validité du vote): Tsy lany ny fehin-kevitra raha tsy ny 3/4 ny olona rehetra manan-jo hifidy araka ny voalaza ao amin'ny b) etsy ambony no manaiky azy. Tsy ekena ary tsy manan-kery ny procuration fa takiana kosa ny handefasan'ny olona manan-jo hifidy na izay GBL tsy tonga ny heviny an-taratasy (vote par correspondance); izany anefa dia tsy maintsy manaraka ny fepetra voalaza ao amin'ny "Manuel du GB Titre II E 4 Ny fifidianana an-taratasy Fepetra" Raha tsy azo mandritra ny fotoam-pivoriana manokana izany dia asaina alefany any amin'ny Foibe ka ao anatin'ny iray volana no tsy maintsy haharaisan'ny Foibe azy. Tsy mana-kery ny fanehoan-kevitra amin'ny na an-telefaonina. Aorian'ny fahazoana ny hevitry ny olona rehetra vao avoakan'ny CA ny valin'ny fifidianana Momba ny fandravana ny Fikambanana Aorian'ny fahalanian'ny fehin-kevitra fandravàna, ny CA dia manendry olona 1 na 2 hiandraikitra ny famindrana ny fananan'ny UGBM amin'izay fikambanana mitovy tarigetra aminy And. 3 Momba ny Conseil d'administration 3.1 Andraikitry ny CA Ireto koa ny andraikitry ny CA ambonin'izay efa voalaza ao amin'ny Statuts - Article : - mandrafitra ny Plan stratégique ho amin'ny 3 taona, avy amin'ny sori-dalana nomen'ny FKP - manendry ireo olona ome-pahefana hanao sonia ny taratasim-bolan'ny UGBM - manendry ny Commissaire aux comptes

4 3 - mitandro ny hisian'ny firahalahiana sy fiainana ny Tenin'Andriamanitra ao amin'ny Fikambanana Araka ny voalaza ao amin'ny And.1, ny mambra CA vao voafidy dia miara-manao sonia ny base doctrinale-n'ny UGBM Ny tondron'andraikitry ny mpikambana ao amin'ny CA dia voarakitra ao amin'ny Manuel du GB Annexe I-A 3.2 Fe-potoana iasana - Telo taona azo havaozina indroa fara fahabetsany, no fe-potoana azon ny mpikambana iray isahanana ny andraikitra maha CA. - Ny solon-tenan'ny mpianatra ao amin'ny CA, tsy mianatra intsony, dia soloin izay nahazo vato be indrindra nanarakaraka tamin ny fifidianana natao, fa raha tsy izany dia soloina mandritra ny CNU akaiky indrindra. - Ny solon-tenan ny Sakaiza ao amin ny CA izay tsy afaka hanohy intsony noho ny antony maro samihafa dia soloin izay nahazo vato be indrindra nanarakaraka tamin ny fifidianana natao fa raha tsy izany dia soloina mandritra ny AsCA akaiky indrindra. 3.3 Fotoam-pivoriana Fivoriana ara-potoana: - Telo ny fivoriana ara-potoana ataon'ny CA mandritra ny taom-piasana: + ny voalohany, amin'ny Oktobra na Novambra: fandaniana (validation) ny tatitra farany (rapport final) ataon'ny Tonia UGBM ary fanitsiana ny programan'asa sy teti-bola (raha ilaina) + ny faharoa, amin'ny Février na Mars: anaovana tomban'ezaka antenantenany + ny fahatelo, amin'ny Jona na Jolay: anaovana tomban'ezaka farany, fandaniana (validation) ny PTA sy ny teti-bola entin'ny Tonia UGBM momba ny taom-piasana manaraka - Tsy azo atao ny fivoriana raha tsy ny an-tsasa-manilan'ny mpikambana no tonga. - Amin'ny fiantsoana faharoa dia afaka mivory sy manapa-kevitra izay tonga Fivoriana tsy ara-potoana: Afaka mivory tsy ara-potoana ny CA raha misy antony lehibe ilàna izany, araka ny fanapahan-kevitry ny Filoha na ny fangatahan'ny antsasaky ny mambra ao aminy. 3.4 Fandanian-kevitra sy fitanana an-tsoratra - Amin ny fehin-kevitra tsotra, dia lany ny fehin-kevitra eken'ny an-tsasa-manilan'ny mpivory araka ny fomba izay neken'ny be sy ny maro (tsangan-tanana na latsa-bato miafina). - Amin ny fanapahan-kevitra lehibe kosa (grande orientation) sy ny fanendrena Tonia, dia takiana ny faneken ny 3 / 4 ny mpikambana ao amin ny CA - Ny Tonia UGBM dia tsy mandray anjara amin ny fifidianana. Izy no miandraikitra ny fitanana an-tsoratra ny fivoriana rehetra ataon'ny CA 3.5 Ny biraon'ny CA Ny mpikambana ao: - ny Filohan'ny CA - ny Filoha Lefitra - ny Mpitahiry vola - ny Tonia UGBM Ny andraikiny: - mamaritra sy mandinika mialoha ny lahadinika sy ny votoatin-kevitra hodinihina ao amin ny fivorian ny CA ka mandefa izany folo andro mialoha any amin ny mambran ny CA - manara-maso ny fandehan ny ara-bola - mandray izay fanapahan-kevitra maika amin ny toe-java-miseho anelanelan ny fotoam-pivorian ny CA, fa tsy maintsy manao tatitra aminy ny amin izany; na izany aza, dia tsy azon'ny birao atao ny mandray fanapahan-kevitra lehibe mi-engager ny Fikambanana Fomba fiasany - Ny Filoha no mampiantso sy mitarika ny fivoriana 2 herinandro mialohan'ny fivorian'ny CA mba hanomanana izany fivoriana izany - Afaka mivory tsy ara-potoana koa raha misy fanapahan-kevitra maika araka ny antson'ny Filoha noho ny toe-javamiseho na noho ny fangatahan'ny 2 amin'ireo birao. Ny fivoriana tsy ara-potoana anefa dia tsy tokony hihoatra ny in-2 eo anelanelan ny fivoriana ara-potoana roa. 3.6 Fepetra samihafa Ny mambra CA amperin asa dia tsy azo fidiana hitana andraikitra eny anivon ny GBL Fampiatoana na fanesorana mambra CA Ankoatr'izay voalaza ao amin'ny Titre III And momba ny fampiatoana sy fanesorana mambra, dia azo ampiatoana amin'ny andraikiny fa toy ny manala tena izay mambra CA tsy nivory in-telo misesy kanefa tsy nampandre mialoha. Ny fanoloana azy dia manaraka ny fepetra voalaza ao amin ny 3.2 etsy ambony And.4 Momba ny Secrétariat Général 4.1 Ny andraikiny Fahefana mpanatanteraka ao amin'ny UGBM ny SG ka toy izao avy ny andraikiny amin''ny ankapobeny: - manao izay hahatratrarana ny tanjona napetraky ny CA araka ny sori-dalana nomen'ny FKP - mandrafitra ny programan asa hotanterahina (PTA) miainga avy amin ny «Plan Stratégique» aroson ny CA.

5 4 - mandray ny soso-kevitry ny CA sy ny fanamarihany momba ny programan'asa. - mitandro ny fampiharana ny Fitsipika Anatiny sy ny fanajana ny Sata eny anivon ny GBL - mitaiza sy manofana ny GBL, manara-maso ny fiainany sy ny fiasany - mandrafitra ny teti-bola isaky ny Departemanta sy manolotra izany amin ny CA - mitantana sy mikajy ny fananan ny UGBM - manendry ireo Délégué UGBM sy mampahafantatra azy amin'ny CA alohan'ny hanolorana azy any amin'ny FKP - mamaritra izay Cellule na Satellite horaisina ho GBL ary manolotra azy amin'ny CA alohan'ny itondrana azy holanian ny FKP 4.2 Ny firafitry ny SG sy ny fe-potoana iasany Firafitra - Ny Tonian ny UGBM no mamaritra ny rafitra hitondrana ny asa ao amin ny ny SG (organigramme) sy manolotra izany amin ny CA mba holaniany. - Amin ny ankapobeny dia ireto avy no poste mety ho hita ao amin ny SG: + ny Tonian ny UGBM matihanina + ireo Sekretera Nasionaly matihanina dia: ny Secrétaire Administratif et Financier (SAF), ny Secrétaire National de Projet (SNP), ny Secrétaire National des Amis (SNA), ny Secrétaire National des Universitaires (SNU), ny Secrétaire National des Secondaires (SNS) + ireo Sekretera Rezionaly (SR) matihanina + ireo miandraikitra departemanta matihanina na tsia + ireo mitantana projets nasionaly (Responsable d un projet) matihanina na tsia - Ny Tonian ny UGBM no manendry ireo tsy matihanina ary manolotra amin ny CA kosa ireo olona hotendrena ho matihanina Fe-potoana iasana - Telo taona no fe-potoana iasan ireo tsy matihanina ao amin ny SG ary azo havaozina indroa izany. - Ny matihanina kosa dia manana fifanarahana arak asa (contrat de travail). Ny Fitsipika Anatiny mifehy azy ireo dia voarakitra ao amin ny "Règlement Intérieur régissant le personnel de l UGBM" Ny tondron andraikitry ny mpikambana ao amin ny SG dia voarakitra ao amin ny Manuel du GB Annexe I-B 4.3 Fivoriana - Mivory in-telo isan-taona ny Komity Mpanatanteraka ka ny Tonian ny UGBM no mampiantso sy mitarika izany. Amin ny fotoana tsy maha eo azy dia ny iray amin ireo Sekretera Nasionaly izay nametrahany ny andraikitra no mitarika izany - Ny Mpitantsoratra matihanin ny UGBM no miandraikitra ny fitanana an-tsoratra ny fizotry ny fivoriana. Afaka manome ny heviny mandritra ny fivoriana izy fa tsy mandray anjara amin ny fanapahan-kevitra. - Afaka miantso olona ivelan'ny SG, na ny Fikambanana, ny SG hakana hevitra amin-javatra manokana; tsy mandray anjara amin'ny fandraisana fanapahan-kevitra ireny olona asaina manokana ireny. And.5 Momba ny Secrétariat régional Ny Secrétariat régional no rantsana mpanatanteraky ny UGBM eny anivon'ny Faritra. Ny Secrétaire Régional no miandraikitra azy. Izy no tompon'andraikitra voalohany amin'ny fampandrosoana ny Faritra iadidiany. Afaka manangana komity kely izy hanampy sy hanolo-tsaina azy amin'ny fitantanana ny Faritra. Amin'izao fiandohany izao dia ny SR no mifidy sy manendry izay olona hitany fa ilaina hampandehanana ny asa. Aoriana dia azo heverina ny mametraka rafitra maty paika kokoa. TITRE III: MOMBA NY GROUPE BIBLIQUE LOCAL And. 6 Famaritana sy fepetra samihafa 6.1 Famaritana Ny antsoina hoe GBL dia fitambaran ny Fikambanana G B (GBU, GBS, Sakaiza) eo amin ny toerana iray ka ny Délégué UGBM no mandrindra ny asa ao. Mety misy GBU sy GBS ary Sakaiza mitambatra ho GBL iray ; mety misy koa anefa tokana, na roa amin ireo fotsiny Ny GB iray dia tsy manana Statuts ara-panjakana manokana ho azy fa ny an'ny UGBM ihany no mitondra azy. Io no aseho sy ampiasaina amin'izay mety ilaàna azy eo an-toerana. Ny GB tsirairay kosa anefa dia tsara raha manana Fitsipika anatiny momba ny fifampitondrana (an-kasoavana na ankaratsiana) sy fandaminan-draharaha anatiny; izany anefa dia tsy tokony hifanohitra amin'ny FA-UGBM. 6.2 Fepetra fandraisana Cellule na Satellite ho GB Ireto avy ny fepetra takiana: - taratasy milaza fohifohy ny tantaran'ny "Cellule" na Satelita - taratasy fangatahana hiditra ho GB voasonian'ireo mpiandraikitra (03 raha kely) afaka miasa amin'ny taona manaraka, misy filazana ny faneken'ireo, tsy misy fepetra, ny Statuts sy F.A-UGBM,. Ireo taratasy roa ireo dia mila tonga any amin ny birao foiben ny UGBM roa (02) volana mialohan ny FKP Ny SR no manome ny fanazavana momba ireo Satelita na Cellule horaisina ho GB Voaray ny Cellule na Satelita raha eken'ny an-tsasa-manilan'ny FKP. 6.3 Fepetra fanafoanana GB Fisehoan-javatra azo anafoanana GB ny:

6 5 - Fanitsakitsahana ny Statuts sy/na FA-UGBM - Taratasy fametraham-pialana avy amin ny fivoriam-ben ny GB - Toerana tsy misy mambra na tsy misy fivoriana intsony eo anelanelan'ny FKP roa. 6.4 Fepetra hidirana ho mpikambana ao amin'ny GB Ekena ho mpikambana ao amin'ny GB iray izay mpianatra eny amin'ny Sekoly ambaratonga ambony (ho GBU), na Ambaratonga faharoa (ho GBS) sy izay tsy mpianatra (ho Sakaiza) efa nateraka indray ary nahavita ny fanambarana ampahibemaso dia ny Confession de foi sy Confession d adhésion tahaka izao: "Confession de foi" : Izaho Ra... dia manaiky marina fa mpanota ka mendrika ny fanamelohan' Andriamanitra ho faty, kanefa mino aho fa Jeso dia maty nisolo ny heloko teo ambony hazo fijaliana ho famonjena ahy. Koa mino an i Kristy ho Mpamonjy ahy aho ary manaiky Azy ho Tompoko amin ny fiainako rehetra. "Confession d'adhésion" : Izaho Ra... dia manaiky tsy misy fepetra ny Statuts sy Fitsipika Anatiny UGBM rehefa namaky sy nanazavana izany. Koa vonona aho hiara-miasa amin'ny Groupe Biblique eto an-toerana sy eran i Madagasikara. Andro samy hafa no anaovana ireo confessions roa ireo raha tsy amin'ny tranga manokana izay ny Komity eo an-toerana no mahalala azy. Ny Confession d'adhésion dia tsy maintsy atao eo anatrehan'ny Fivoriamben'ny GB aorian'ny dinika ifanaovana amin'ny Komity, fa ny "Confession de foi" kosa dia azo atao any amin'ny cellule. 6.5 Fepetra momba ny fifamofoana Ny mpikambana izay hifamofo ho amin'ny fanambadiana dia tsy maintsy manao fanambarana eo anivon'ny fivoriamben'ny GB misy azy. 6.6 Fampiatoana, fanesorana mambra Ny Komity Groupe Biblique miaraka amin ny Délégué UGBM eo amin'ny GBL no manam-pahefana amin izany. Antony azo ampiatoana na anesorana mambra iray : - fangatahana fialana avy amin'ilay olona - fanitsakitsahana ny Statuts, na ny F.A-UGBM na ny F.A-GBL - fikirizana amin'ny toetra amam-pitondran-tena tsy mifanaraka amin ny ny Filazantsara sy/na manalabaraka ny Fikambanana. Raha misy mambra sendra izany tranga izany dia adidin'ireo tompon andraikitra ery aloha no manao ny ala-olana rehetra, izany hoe manatona sy mihaona amin'ilay mambra, mampianatra sy mananatra ary manitsy azy araka ny voalazan'ny Tenin'Andriamanitra. Raha mbola tsy miova amin'izany ilay olona dia na aato amin'ny andraikiny izy na esorina tsy ho mambra ka izy ireo no tompon'ny fanapahan-kevitra amin'izany. Ambarany amin'ny Fivoriambe, ary tsy hiadian-kevitra, ny fanapahan-kevitra fa izay mila fanazavana manokana dia manatona ny Délégué, na ny Komity. Tsy maintsy lazaina amin'ny SR, izay hampita amin ny Foibe (C.A & SG) rehefa avy eo, ny anaran'izay voan'izany sy ny antony. 6.7 Famerenana mambra naato na nesorina - Izay naato tamin ny andraikiny na amin ny maha-mambra azy rehefa tapitra ny fe-potoana fampiatoana ka feno ny fepetra nangatahina taminy dia miverina avy hatrany ho mambra. - Izay nesorina tsy ho mambra kosa kanefa maniry hiverina indray, na dia hitan'ny mpiandraikitra aza ny fiovàny dia tsy maintsy manao réadhésion And.7 Momba ny GBU sy GBS 7.1 Momba ny Komitin'ny mpianatra sy ny fifidianana azy Ireto avy ny postes mety ho hita ao amin ny komity GBU na GBS iray: Tonia, Tonia Lefitra, Sekretera, Mpiandraikitra ny FIFI, Literatiora, Kolontsaina, Fitaovana, Vola ary ny Vaovao sy Vavaka. Tsy voatery hisy olona avokoa ireo postes ireo fa arakaraky ny tanjaky ny GB sy izay ilain'ny eo an-toerana no andrafetana azy. Fidiana isan-taona ny Komitin'ny mpianatra, ary azo havaozina indroa fara fahabetsany. Tsara raha aloha kelin ny fiafaran ny taom-pianarana no anaovana izany. Raha vao misy mpiandraikitra 3 na 4 vonona sy mazoto tsara dia afaka manomboka ny asan'ny Komity. Ny Fivoriamben'ny GB no mifidy ny Komity. Ny Délégué UGBM eo an-toerana na Sakaiza, raha misy, no mitarika ny fifidianana; raha tsy izany dia izay mambra tranainy tsy milatsaka hofidiana na izay nomen'ny Komity am-perin'asa fahefana. Lany avy hatrany izay mahazo vato antsasaky ny mpifidy mihoatra iray. Raha tsy tratra izany dia averina fanindroany amin ny izay roa be vato indrindra ny fifidianana ka izay be vato amin'izany no lany. Raha mbola mitovy dia izay tranainy amin ny naha-mambra no omena ny toerana. Mila mivory indray mandeha isam-bolana fara-fahakeliny ny Komity: hiarahany mivavaka sy miofana ary handinihany ny raharahan'ny GB. 7.2 Tondron'andraikitry ny Komitin'ny mpianatra amin'ny ankapobeny - mitantana ka manao izay hampandroso ny GB: mambra mitombo isa ary tsara ofana. - mitandro ny fanajana ny Statuts ary mampihatra ny Fitsipika Anatiny misy. - mandrafitra ny programam-pitoriana sy fanofanana ary ny asan'ny GB rehetra ka manolotra izany holanian ny Fivoriambe ary mandrindra ny fanatanterahana azy ireny ireo programa ireo dia tokony hifanaraka amin ny toro-marika ampitain ny Foibe mandritra ny CNU, na CRS na FKP. - manomana ny budget-n ny GB ho entina amin'ny Fivoriambe - manao izay hahatanteraka ny hevitra tapaky ny FKP araka izay tandrify ny GB tarihiny. - miara-mientana amin'ny Fikambanana amin'ny fanatanterahana ny fandaharan'asa iombonana - mampirisika ny fijoroan'ny cellule isan-tsekoly ambaratonga faha-2 na isaky ny Faculté na filière na toeram-ponenana eny amin ny université; izy no manendry ny "Chef de Cellule".

7 6 - manomana izay ho mpisolo (na relève ) azy ny mambra tsirairay ao amin'ny Komity. Momba an'io dia tokony hiasa "par équipe" ny departemanta tsirairay mba ho fianaran-draharaha ho an'ny mambra sy hanamora ny fanomanana relève. And.8 Momba ny Sakaiza 8.1 Antom-pisiana, adidy sy andraikitra Antom-pisian ny Sakaiza (mission): - hanohana ny UGBM ary hanohana ny GBS sy/na ny GBU eo amin ny tanàna misy azy - hifanohana amin ny Sakaiza eo an-toerana sy eran i Madagasikara Adidy (rôle): - hitaiza sy hampy ny GBL eo an-toerana ara-panahy, ara-toro hevitra, ara-pianarana, ara-tsosialy, ara-pitaovana sy arabola (encadrement spirituel, moral, éducatif, social, materiel et financier des GBL de sa localité) - hifampitaiza sy hifanampy amin'ny samy sakaiza [encadrement mutuel avec les autres Amis] Andraikitra (responsabilité) : - manao izay hampandeha ny GBL misy azy, koa tompon'andraikitra feno ny amin'ny fandeha sy fiafaran'ny GBL eo antoerana miaraka amin'ny komitin'ny GBL sy ny Délégué UGBM izy amin'izany (co-responsable du sort du GBL de sa localité avec le Délégué UGBM et les comités locaux) 8.2 Rafi-pandaminana: Momba ny Komitin ny Sakaiza: Tsy voatery hasiana departemanta toy ny an ny mpianatra fa malalaka izy amin ny rafi-pandaminana tiany hatao. Tsara anefa raha fara-faharatsiny misy Tonia, Mpitantsoratra, Mpitahiry vola ary Mpanolotsaina 1 na 2, araka izay azo atao. Fidiana isaky ny 2 na 3 taona ny komitin ny Sakaiza ary azo havaozina in-droa izany. Ny Sakaiza mantsy mitoetra Momba ny Corps Professionnels Atsangana eo anivon ny Sakaiza ny Corps professionnel izay ivondronan ireo mambra nivoaka tamin ny lalam-piofanana mitovitovy, na miasa amin'ny sehatra mitovitovy (ohatra: corp des opérateurs économiques, corp des médecins et paramédicaux, corp des femmes au foyer ) Ny "Corps" dia sehatra natao hifanampiana, hifampandrosoana, hifanakalozana vaovao sy traik'efa manodidina ny asa, hanomanana ny mambra indrindra ireo zandry amin'ny carrière professionnelle, sehatra koa ahafahana maneho hevitra momba ny zava-misy amin'ny maha-kristiana, ary sehatra ahafahana miara-mikaon-doha hanohanana ny UGBM araka ny talenta sy fahaizana ananana. TITRE IV : NY ARA-BOLA SY FANANANA And.9 Ny souscription sy don - Ny souscription dia fanomezana raikitra isam-potoana (isam-bolana na isan-telo volana ets ) Ny mambra tsirairay dia mila manao souscription ao amin ny Groupe Biblique misy azy, ary ny Groupe Biblique tsirairay dia mila manao souscription amin ny Foibe UGBM. Izany dia tokony hatao malalaka, amin'ny fitiavana, araka izay ananana (2Kor.8:12; 9:7) - Ny don kosa dia fanomezana malalaka tsy ara-potoana fa atao araka izay ahafahana manao izany. Ny mambra dia ampirisihina hanome don araka izay azony atao ho fanohanana ny asan'ny Fikambanana. Izany koa dia tokony hataony amin'ny nahim-pony, malalaka sy amin'ny fitiavana ary araka izay ananana And.10 Ny amin'ny famatsiam-bola ny GB - Ny GB tsirairay dia mila manana ny teti-bolany sy mizaka tena ara-bola, ka ny Sakaiza no manao ho foto-draharaha ny famatsiam-bola ny Fikambanana mba hampandehanana ny asa. - Raha misy tsy fahafenoan'ny mambra sy ny Sakaiza ny teti-bola, ny Groupe Biblique mpianatra dia afaka mitady fomba hamatsiana ara-bola ny asan ny fikambanana amin izay fomba tsy mifanohitra amin ny Tenin Andriamanitra, fa kendrena mba tsy hanelingelina ny fianarany na ny fotoanan ny GB izany. Fampitandremana sy tari-dalana: - Tsara kokoa rehefa manao hetsika itadiavam-bola no tsy mampiasa billet. Aleo fantatry ny olona hoe ny GB sady tsy mividy no tsy mivarotra billet, mba hisorohana ny atero ka alao tsy misy farany. - Ny fotoan-dehibe ataon ny GB dia tsy hanatazan-drakitra akory fa hasiana vata na harona kosa hanomezan ny mambra sy ny olona manatrika izay foiny. N.B: Marihina koa fa raha fitoriana ny Filazantsara no atao dia tsy asiana na vata handrotsahan ny olona izay foiny aza mba tsy hiheveran ny sasany fa misy sandany ara-bola ny Filazantsara. Raisina an-tanan-droa kosa anefa izay te-handray anjara an-kalalahana tamin ny fandaniana natao tamin ny fikarakarana (hofan-trano, sono, jiro, sns) And.11 Ny amin'ny volan'ny Foibe Ny volan ny UGBM dia apetraka any amin ny banky. Ny Mpitahiry vola sy ny Tonia ary ny SAF no omem-pahefana hanao sonia ny taratasim-bola. Tsy maintsy sonian olona roa amin ireo telo vao manan-kery hamoahana ny vola amin ny banky. Ny CA dia manana fahefana hanolo mpanao sonia iray na mihoatra amin ny fotoana heveriny fa ilàna izany noho ny antony lehibe (oh. abus financier, abus de confiance ) ka ny mpanao sonia avy amin ny CA soloana mambra CA ary ny SG soloana avy ao amin ny SG. Ny famoaham-bola rehetra sy ny fandaniana natao dia tsy maintsy misy taratasy mazava (pièces justificatives) And.12 Ny Mpandini-bola

8 7 Ny Fikambanana dia manana mpandini-bola izay tendren ny CA: olona manana fahalalana avo lenta momba ny fitantanam-bola, kristiana ary mahafantatra tsara ny fikambanana. Hanamarina ny fitantanam-bolan ny fikambanana araka ny lalàna misy eo amin ny fitantanam-bola no andraikiny ary tokony hanao tatitra isan-taona momba izany eo anivon ny CA izy. And.13 Ny amin ny fananan ny UGBM - Ny fananana mila soratana ara-panjakana rehetra toy ny tany, trano, fiara, dia tsy maintsy atao amin ny anaran ny UGBM noho ny tsy fananan ny GBL Statuts ara-panjakana manokana ho azy, fa tompon andraikitra amin ny fitantanana ireny kosa ny Groupe Biblique eo an-toerana izay notolorana izany. - Ny FKP no manapaka ny amin'ny fivarotana ireo fananana lehibe voasoratra ara-panjakana toy ny tany sy trano, ary ny CA sy ny SG no manatanteraka ny fivarotana. Ny fananana hafa kosa dia apetraka eo ambany fahendren'ny CA sy SG. - Ny fitrandrahana ny fananan'ny UGBM dia adidin'ny CA sy SG. TITRE V: FIFANDRAISANA AMIN'NY HAFA And;14 Ny UGBM sy ny Fikambanana hafa Ny Groupe Biblique dia miara-miasa amin ny fikambanana mitovy firehana sy foto-pampianarana aminy toy ny Fikambanana Mampiely Baiboly (FMB), ny Fikambanan'ny Mpiara-Mamaky ny Baiboly (Ligue pour la Lecture de la Bible), ny Campus pour Christ. Izay Fikambanana mampisalasala kanefa maniry hiara-miasa amin ny GBL dia mila hakana hevitra amin ny ambaratongan-drafitra eo ambony aloha. - Mila fitandremana ny fanasana olon'ny fikambanana hafa hitondra fampianarana ao amin'ny GB: tsy ampirisihina ny fanasana olona izay tsy fantatra ny momba azy sy ny foto-pampianarany. Adidin ny Sakaiza izay manatrika no manitsy izay fampianaran-diso mety tafita (aorian ny fivoriana rehefa lasa ilay vahiny). Tandroina hatrany ny voninahitry ny Tompo sy ny maha-ugbm ny UGBM amin'izay fiaraha-miasa atao amin'ireny Fikambanana ireny. And.15 Ny UGBM sy ny Fiangonana -Ny mambra rehetra dia tsy maintsy manana Fiangonana raikitra. -Anjaran'ny mambra tsirairay ao amin'ny GB ny mampahafantatra ny Mpitondra Fiangonana sy ny Loholona ao ny atao hoe GB sy ny maha-izy azy indrindra fa ny hoe: - Tsy fiangonana ny GB fa fikambanana ara-pilazantsara tsotra. Noho izany dia tsy fanaon ny UGBM ny Sakramenta toy ny: Batisa na Batemy, Kominio na Fanasan ny Tompo, fanamasinana mariazy, sns satria fomba amam-panao eo amin ny fiangonana izany. - Tsy antoko mpihira ny GB fa fikambanana mitory Filazantsara. Koa amin'ny fanasana izay mety hataon'ny Fiangonana dia aoka hiangaviana hampiarahina amin'ny fijoroana vavolombelon'i Kristy na Toriteny na fampahafantarana ny GB ny hira fa tsy hira fotsiny. - Tsy azo atao Alahady maraina ny fivorian'ny GB fanao isan-kerinandro, fa fotoana famonjen'ny tsirairay ny fiangonany izany. - Ny olona vaovao avy nanolo-tena ho an i Kristy vokatry ny asa fitoriana nataon ny Fikambanana ka tsy mbola manana fiangonana dia asaina misafidy amin izay fiangonana akaiky azy ary hita fa mety hiorenany sy hivelarany amin ny finoana. Raha toa kosa ka efa manana fiangonana izy dia amporisihina hazoto hamonjy ny fiangonany. Tsy azo atao velively ny hanery azy hiala ao raha tsy vokatry ny nahimpony irery ihany. And.16 Ny UGBM sy ny Firenena - Araka ny Tenin'Andriamanitra dia mila mivavaka ho an'ny firenena ny GB, manaiky ny fanjakana misy sy manao izay tsara, ary mandray andraikitra amin'izay tandrify azy avy. Marihina fa ny fanatontosana tsara ny fianarana sy ny asa ampanaovin Andriamanitra ny mpikambana tsirairay eo anivon ny GB amin ny fahatahorana Azy dia efa fandraisana anjara goavana eo amin ny fampandrosoana ny firenena eo amin ny lafiny ara-toekarena, ara-tsosialy ary indrindra ara-panahy. - Mila ampahafantarina ny amin'ny GB sy ny tarigetrany ary ny fomba fiasany ny manam-pahefana ao an-toerana: vangiana izy ireny amin'ny tonon-taona, omena statuts, hatonina rehefa hangataka fahazoan-dalana hanao zavatra, omena fanasana amin'ny fotoan-dehibe, sns... And.17 Fandraràna - Tsy azon'ny mpikambana atao ny mitaona ny mpikambana namany hifindra Fiangonana - Tsy azon'ny mpikambana atao ny mitondra ny fomba amam-panaon'ny Fiangonany sy/na ny teolojiany eo anivon'ny Fikambanana satria ny mpikambana dia avy amin'ny Fiangonana samy hafa. - Raràna ny fisian'ny mpihavana akaiky ao anatin ny Komity iray afa-tsy noho ny antony tsy azo anoharana noho ny tsy fisian olona hafa azo atao mpiandraikitra. - Ny Groupe Biblique dia tsy manao hetsika ara-tsendikaly sy ara-politika. Ny tsirairay dia manana zo hanao izany amin ny anaran ny tenany manokana saingy tsy azony atao ny mampiditra izany eo anivon ny Fikambanana. Na izany aza, ny mambran ny CA sy SG, ny Délégué UGBM ary ny komity mpitantana GBL dia tsy tokony hiseho mivantana amina fihetsiketsehana ara-politika na sendikaly mandritra ny fe-potoana iasany ato amin ny UGBM. Izay mpiandraikitra hita fa manao izany dia esorina, ka izay manam-pahefana amin ny fanoloana no manatanteraka ny fanesorana sy fanoloana. - Tsy misy mpikambana, amin ny anarany manokana, afaka mampiasa ny anaran ny Fikambanana na ny fananany na amin ny inona na amin ny inona; raha tsy nahazo alalana. Ny Filan-Kevi-Pirenena (FKP) na ny Filan-Kevi-Pitantanana (CA) na ny

9 8 Komity Mpanatanteraka Foibe (SG) eo amin ny fivoriany no manana fahefana hanome izany alalana izany. Ny engagement nataon olona samy irery tsy nahazoana alalana dia tsy manan-kery And.18 Samihafa - Ny taom-piasan ny UGBM dia manomboka ny 1er Septembre (N) ary mifarana ny 31 Août (N+1) - Ny UGBM dia manana Manuel izay mifameno amin ny Statuts sy ity Fitsipika Anatiny ity. - Amin ny ny tranga manokana tsy voalaza ao amin ny Statuts, na ato amin ity Fitsipika Anatiny ity, na ao amin ny Manuel du GB, dia adidin'ny mpiandraikitra mahefa ny mijery akaiky izany sy ny fomba hiatrehana azy. - Ampiharina ary tsy maintsy eken'ny mpikambana rehetra ao anatin'ny UGBM ity Fitsipika Anatiny ity izay nolaniana teto Toliary ny 26 Aogositra 2007 nandritra ny FKP faha-30. Ny Filohan ny UGBM Etienne RANDRIANARISON

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

Noely 2009 Taom-baovao 2010

Noely 2009 Taom-baovao 2010 FMM Fiombonana Miara-mivavaka eto Münich. Noely 2009 Taom-baovao 2010 Fa Zaza no teraka ho antsika, Zazalahy no omena antsika, ary ny anarany atao hoe Mahagaga, Mpanolon-tsaina, Andriamanitra Mahery, Rain

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. "Dieu qualifie ceux qui sont appelés", hoy Rakotolehibe Mamy, Talen ny FMMB

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. Dieu qualifie ceux qui sont appelés, hoy Rakotolehibe Mamy, Talen ny FMMB Taniketsa - Laharana faha 58 - Septambra 2014 1 Gazetin ny Sampana Sekoly Alahady FJKM Andrainarivo Taniketsa Miseho isan-telo volana. Laharana faha 58. Septambra 2014. Vidiny: 400 Ariary. Tranokala: www.sa-andrainarivo.mg

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar HUMBOLDT-UNIVERSITÄT ZU BERLIN Landwirtschaftlich-Gärtnerische Fakultät Schriftenreihe des Seminars für Ländliche Entwicklung VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

Plus en détail

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA TATITRA ANIVON NY ANTENIMIERAM- PIRENENA Praiminisitra Jean RAVELONARIVO 1 TATITRA MANOLOANA NY ANTENIMIERA I 21 MAY 2015 21 MAY 2015 Andininy 54.- Ny Filohan ny Repoblika no manendry ny Praiminisitra

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

Évaluation de l impact environnemental et social

Évaluation de l impact environnemental et social RÉPUBLIQUE DE MADAGASCAR Tanindrazana - Fahafahana - Fandrosoana PRÉSIDENCE PROJET PÔLE INTÉGRÉS DE CROISSANCE Secrétariat National Évaluation de l impact environnemental et social Cadre de politique de

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA Public Disclosure Authorized a REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana JIRAMA JIRO SY RANO MALAGASY E1 403 VOL. 1 Public Disclosure Authorized Public Disclosure Authorized ÉVALUATION

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY MINISTERAN NY FAMBOLENA NY FIOMPIANA ARY NY JONO ----------------------------------- REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana ---------------------------------- MINISTERAN NY TOEKARENA

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville

SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville TOERANA ALEHA FIAINGANA ZOTRA RAISINA DESTINATION DEPART TANA LIGNE A PRENDRE A Ambohitrapeto Isotry D Itaosy Itaosy

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

AMBATONAKANGA SY NY MISIONERA ;

AMBATONAKANGA SY NY MISIONERA ; AMBATONAKANGA SY NY MISIONERA ; Raha miteny hoe Ambatonakanga isika protestanta amin izao andro ankehitriny izao dia ny trano fiangonana vita amin ny vato no tonga ao an-tsaintsika voalohany ary vitsy

Plus en détail

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES DEPARTEMENT INTERDISCIPLINAIRE DE FORMATION PROFESSIONNELLE COMMUNICATION ET DYNAMIQUE LOCALE RAPPORT

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

DISPOSITIONS COMMUNES

DISPOSITIONS COMMUNES ORDONNANCE N 62-074 du 29 SEPTEMBRE 19 62 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics. ( J.O. n 248 du 12.10.62 p. 2248 ) modifiée et complétée

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

FINOANA SY FAHAZAVANA FOI ET LUMIERE

FINOANA SY FAHAZAVANA FOI ET LUMIERE FINOANA SY FAHAZAVANA FOI ET LUMIERE BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 Gazety avoakan ny Mpiaramivavaka Kristianina Malagasy eto Bénélux (M.K.M.B.) Bulletin de liaison et d information de la

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

FANILO MIAMPITA. TÉLÉPHONIE FIXE La honte. Encore sous le monopole Après le drame libanais, voilà que resurgit

FANILO MIAMPITA. TÉLÉPHONIE FIXE La honte. Encore sous le monopole Après le drame libanais, voilà que resurgit cyan magenta jaune noir PROGRAMME P.7 L accès sans peine à l information QUOTIDIEN D INFORMATION GRATUIT N 080 DU Vendredi 18 Juin 2010 AFFAIRE LILA FANILO MIAMPITA TÉLÉPHONIE FIXE La honte TONGA NY ORA

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

LANY TAMINGANA ETO AMINTSIKA

LANY TAMINGANA ETO AMINTSIKA cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

46 Ordonnance n 62-074 du 29 septembre 1962

46 Ordonnance n 62-074 du 29 septembre 1962 Ordonnance n 62-074 du 29 septembre 1962 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics (J.O. n 248 du 12.10.62, p. 2248), modifiée et complétée par

Plus en détail

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE -----------------------

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- MINISTERE DES TRANSPORTS ET DE LA METEOROLOGIE -------------- RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- I. CONTEXTE Malgré

Plus en détail

M o t d u P rov i n c i a l Temps de grâces

M o t d u P rov i n c i a l Temps de grâces Mot du Provincial Temps de grâces Plusieurs événements de la province et de l Église à Madagascar constituent nos sources d action de grâce à adresser au Seigneur. La visite fraternelle et édifiante du

Plus en détail