ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

Dimension: px
Commencer à balayer dès la page:

Download "ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE"

Transcription

1 ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014

2 Résumé non technique - Juin 2014 TABLE DES MATIERES RESUME NON TECHNIQUE LISTE DES FIGURES Sary 1 : Famaritana ny toeram-pivangongoan ny mineraly Ranobe... 2 Sary 2 : Ny foto-drafitrasa ilaina sy ny fomba fitrandrahana ampiasaina... 3 Figure 1 : Localisation du gisement de Ranobe Figure 2 : Infrastructures et processus simplifié du projet ii

3 PROJET MINIER DE RANOBE - MADAGASCAR ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTINANA TSY ARA-TEKNIKA

4 Famintianana tsy ara-teknika - Jona 2014 TENY FANOLORANA Ny volana aprily 2003, nisy ny tombana ara-tontolo iainana mikasika ny vinavina mialoha ny fanatanterahana ny tetik asa fitrandrahana harena an-kibon ny tany notontosain ny Costal Environnement Service (CES), nisahana ireo faritra eo anelanelan i Toliara sy Morombe, ka niompana manokana tamin ny faritry ny fahazoan-dàlana Ranobe. Izany tombana izany dia nomanina mialoha mba hahafahana manoritra ny votoatiny amin ireo pitsopitsony mahakasika ny ara-tontolo iainana sy ara-piarahamonina mifandraika amin ny tetik asa fitrandrahana ny fasika mineraly, niarahana nidinika tamin ireo rehetra heverina ho voakasiky ny tetikasa. Ny antontan-taratasy mikasika ny vinavina mialoha ny fanatanterahana dia namaritra ny fiantraikan ny tetikasa eo amin ny ara-tontolo iainana sy ara-piaraha-monina heverina ho vokasik izany eny amin ny tontolon'ny toeram-pitrandrahana, ary koa mamelabelatra ny mety ho fiantraikan izany eo amin ny lafiny ara-piaraha-monina sy ara-toekarena. Ny antontantaratasy koa dia mitatitra ny lafiny somary lalindalina kokoa, izay mitanisa ny fandraisan anjaran ny daholobe ary manoritra ny toerana sy ny hay rindram-piainana ao amin ny faritra hanatanterahina ny fandalinana ary koa tombana mikasika ny endriky ny tontolo arapiaraha-monina sy toekarena alohan ny tetikasa. Taty aoriana, ny taona 2005 dia nisy tatitra izay nilaza ny famaritana ny tetikasa fitrandrahana harena an-kibon ny tany ao Ranobe ary natolotra ireo fitondrana mahefa izany tatitra izany (Office National de l Environnement) ny taona Ny rafitry ny fandalinana ny fiantraikan'ny tetikasa amin'ny tontolo iainana sy fiarahamonina (EIES) dia nampidirina tao anatin ny tatitra famaritana ny tetikasa voalaza etsy aloha ary miaraka amin ireo ny famaritana ny votoatin asa (TDR) ny fandalinana manokana ilaina amin ny fanatontosana io fandalinana io. Nahazo ny fankatoavan ny ONE izany tatitra famaritana izany tamin ny fotoan androny. Ireo fanadiadiana manokana voasoritra tao amin ny tatitra famaritana (rapport de cadrage) dia notanterahina teo anelanelan ny taona 2006 sy 2007 mba handrafetana antontan-taratasy mafonja kokoa mikasika ny fanadiadiana ny ara-tontolo iainana sy ara-piaraha-monina (EIES) Na izany aza anefa, io antontan-taratasy mikasika ny fanadiadiana ara-tontolo iainana sy arapirarahamonina io (EIES) dia tsy natolotra ny fahefana mahefa Malagasy mihitsy, noho ny fandraisan'ny Exxaro 1 fepetra hampitsahatra ny fandraisany anjara tao amin'ny tetikasa Ranobe. Nisy fanovana mafonja nataon ny World Titanium Resources 2 (WTR) mikasika ny tetikasa raha oharina amin ny endriny tany am-piandohana nohon ny antony eo amin ny lafiny tsena sy ny taozava-baventy misy eto Madagasikara.Noho izany fanovana izany (fitrandrahana "maina" amin ny alàlan ny antsoina hoe "voie sèche" fa tsy amin ny alalan ny "fitrohana", na "dragage",ny tsy hahitana soritra betsaka amin ny fitrandrahana,fefiloha vato vaovao ho any amin ny helodranomasina Toliary fa tsy any amin ny farihy masira any Ifaty sns). Tapaka tamin izany fa hanao fanadihadiana vovao mikasika ny Fandalinana ny fiantraika eo amin ny tontolo iainana sy ny 1 Exarro dia vondron orinasa mpitrandraka miorina ao Afrika atsimo,tompon ny tetikasa Toliara Sands tany am-piandohana saingy nanapa-kevitra ny nampitsahatra ny fandraisany anjara tao amin ny tetikasa ary nanolotra ny angom-baovao rehetra ho an ny orinasa aostraliana World Titanium Resources (WTR) izay naka mpanadihady mikasika ny fasika mineraly, mba hahazoana fandalinana lalindalina kokoa mikasika ny tetikasa Ranobe. 2 Wold Titanium Resources dia orinasa voasoratra ao amin ny Australia Stock Exchange, tompon ny tetikasa Toliara Sands sy ny tetikasa fitrandrahana Ranobe zato isan-jato. World Titanium Resources no tompon ny tetikasa tamin ny nahafantarana azy voalohany ka fantatra tamin ny anarana hoe Madagascar Resources izy talohan ny novambra

5 Famintianana tsy ara-teknika - Jona 2014 fiarahamonina na EIES, izay niainga tamin ireo fandalinana vita amin ny endriky ny tetikasa teo aloha ka nofenoina tamin ireo fanadihadiana manokana ary nifanatrehana tamin ny antok olona mpandray anjara. Ny fahalalàna sy traikefa rehetra notovozina nandritra ireo asa rehetra ireo, no trandrahana teo amin ny fotoam-pamaritana ka ny tatitra voalohany dia natolotra ny Foibem-pirenena misahana ny tontolo iainana na ny ONE ary naparitaka ho fantatry ny rehetra ny volana aprily 2012; ambonin ireo dia nisy tombana manokana ihany naverina natao sy nampifandrifiana amin ny vanim-potoana mba handrafetana ny antontan-taratasy EIES vaovao. FAMARITANA NY TETIKASA Ny vangongom-pasika mineraly (gisement) Ranobe, dia ao atsimo andrefan i Madagasikara, ao avaratry ny seranan-tsambon i Toliara (sary 1), izay mitahiry harena lehibe (fasika misy mineraly mavesatra sarobidy toy ny fasimainty na ilmenita, ny "rutile" ny zirikaonina "zircón", sy ny "leucoxène"; ny faritry ny fahazoan-dalana Ranobe dia mitrandrahaka eo amin ny 16 kilaometra eo ho eo ny lavany raha 1 ka hatramin ny 2 kilaometatra ny sakany. Mitsinjara ho toko telo ireo vangongom-pasika mineraly ao izay rehefa mikambana, dia mahafeno 1200 ka hatramin ny 1400 taonina amin ny fasika mahafeno sahana 4-5 % ny mineraly mavesatra raha atao ny salan isa. Miainga avy amin iray amin'ireo toko telon ny vangongom-pasika mineralin i Ranobe ireo, ny tetikasa dia mikendry ny hitrandraka 161 lavitrisa taonina vangongom-pasika mineraly manana ampahan-danja (teneur) 8,2 % ny mineraly mavesatra mandritra ny 21 taona. Sary 1 : Famaritana ny toeram-pivangongoan ny mineraly Ranobe 2

6 Famintianana tsy ara-teknika - Jona 2014 Ny tetikasa dia mikasa hanao fitrandrahana " maina " amin ny alalan ny antsoina hoe "voie sèche" amin ny alalan ireto foto-drafitr asa ireto: trano fanaovana famoriana am-boalohany na " concentration primaire " miorina eo aminy toera-pitrandrahana trano hanatanerahana ny fanivanana ny mineraly eo amin ny toera-pitrandrahana ihany koa saingy toerana roa samihafa no ametrahana azy ireo Làlana hitaterana ny vokatra (làlana telo mifandimby no efa voatombatombana fefiloha vato (Jetée) vaovao mivarina ho any amin ny helo-dranomasina Toliara, ary toera-pitehirizana manamorona ny fefiloha vato vaovao. Sary 2 : Ny foto-drafitrasa ilaina sy ny fomba fitrandrahana ampiasaina Ny zavamaniry rehetra manoritra ny toera-pitrandrahana dia ho voaripaka daholo. Noho izany dia ampahany kely ihany (10 ka hatramin ny 35 hekitara) mioahatra amin ny mariky ny fitrandrahana, 455 hekitara no hiharan ny fandripahan'ala ary izany aza dia atao miandalana amin ny ampahany kely hatrany. Raha tsy izany ny tany tsara fambolena dia alaina ary hangonina manaraka ny lavan ny firoson ny fandavahana ny toera-pitrandrahana ka ampiasaina rehefa tonga ny fotoana 3

7 Famintianana tsy ara-teknika - Jona 2014 famerena ny tany amin ny laoniny. Ny mineraly dia hotrandrahana amin ny alalan ny antsoina hoe pelleteuses chargeuses ary hotaterina avy hatrany amin ny alan ny fiara vaventy ho an ny ao amin ny trano fanaovan-taozavatra famoriana mialoha (usine de concentration primaire, UCP) mba hahazoana mineraly mavesatra voatanika (concentré de minéraux lourds, CML) ary manavaka ny faikam-pasika vaventy sy madinika. Ireo faikany ireo dia fohina hankany amin ny faritra nohadiana ary averina ao anaty lavaka (trous d excavation). Ny mineraly mavesatra voatanika izay avy novokarin ny UCP dia mainina amin ny alalan ny teknika atao hoe hydrocyclone ary tehirizina alohany hitaterana azy mankany amin ny trano fanaovana ny fanivanana (usine de séparation des minéraux, USM). Ireo mineraly voatanika nomainina ireo dia mandalo eny anelanelan ny andriamby maro mba hanavahana ny vokatra sarihin'ny andrimby (flots de produits magnétiques) sy ireo izay tsy mitahiry izany. Ny vokatra sarihin'ny andriamby dia ahitana ilmenita fa ny rutile, ny zirikaonina sy ireo izay tsy voadio kosa dia ao anatin ireo izay tsy sarihin'ny andriamby. Tsy misy vokatra simika ampiasaina ary tsy misy fihenana ara-tsimika mandritr izany rehetra izany. Ny sisa avy amin ny fasika UCP sy ny USM dia entina manototra ny faritra avy nitrandrahana ary izany dia mandava taona arak a ny fandroson ny fitrandrahana. Manaraka izany hatrany koa ny famerenana amin ny laoniny ny faritra nototofana amin ny alalan ny fanaovana tany lonaka, fambolen-kazo na fambolena hafa araka ny fivoarana hatrany. Tombanana ho taonina isan-taona ny CML ho kirakiraina ao aminy USM mba hahazahoana vokatra fivarotra milanja taonina ilmenita sy taonina na rutile / zirikaonina marihitra. Ny tokony ho famoahana izany vokatra fivarotra izany dia toy izao manaraka izao: fitaterana amin ny fiara-vaventy lavabe avy any amin ny amin ny ozinina fanivanana mineraly (USM) eo amin'ny toerana iadiana azy, mandalo amin'ny làlana natokana ho an ny fitrandrahana irery ihany fa tsy azon ny daholobe ampiasaina, ary mankany amin ny sisin-drano avaratry ny renirano Fiherenana, ka hamaky ny lalam-pirenena faha 9, Ny fiampitana ny renirano amin ny alalan ny rafibato aorina haharitra sy hifanaraka amin ny filan ny tetikasa, Ny fifampitohizan ny fiara-vaventy aorian ny fiampitana ny renirano manaraka ny lavan ny làlana mandra-pahatonga any amin ny toeram-pitehirizana mifanolotra amin ny fefiloha vato, Ny vokatra ilmenita dia hafatratra avy hatrany avy ao amin ny trano fitehirizana ary taterinin ny sambokely mankeny anaty sambo miantsona eny am-paran ny fefiloha vato, Ny vokatra zirikaonina / rutile kosa dia tehirizina anaty kaontenera eny amin ny fefiloha vato vaovao ary tanterina mankany aminy fandraisam-bokatra eny amin ny seranantsambon i Toliara mba hoampidirina ao anaty sambompitatitra kaontenera, na koa hafatratra avy hatrany ao anaty sambo ka ampiasana ireo fitaovana fampiasa amin ny fitaomana ny fasimainty. NY FIZOTRY NY FANDINIHANA NY FIANTRAIKAN NY TETIKASA ARA TONTOLO IAINANA Ny fandinihana ny fiantraikan ny tetikasa eo amin ny tontolo iainana dia notanterahina araka ny lalàna velona manan-kery eto Madagasikara ary mifanaraka amin ireo ireo fenitra takian ny SFI (Societé Financière Internationale) ny amin ny mikasika ny ara-tontolo iainana sy arapiarahamonina. Ny fampahafantarana ampahibemaso izany fandinihana izany dia notanterahina 4

8 Famintianana tsy ara-teknika - Jona 2014 foana nandritra ny fotoam-pamaritana ny fandihihana na tamin ny fotoana nanatanterahina ny fanadihadiana ny fiantraikan ny tetikaasa eo amin ny tontolo iainana mba nahafahana nanana antoka fa nandray anjara mavitrika avokoa ireo izay voakasiky ny tetikasa. Nisy ireo fivoriana ampahibemaso notanterahina tamin ireto toerana ireto: Antananarivo, Toliara, Tsiafanoka, Ranobe, Ankilimalinke, Belalanda, Maromiandra ary Mangily. NY SAFIDY SOLO VAIKA AROSON NY TETIKASA Safidy maro no vita tombana ho amin ny fanatanterahana ity tetikasa fitrandrahana harena ankibon ny tany ity: Ny fametrahana ny ozinina fanivanana mineraly USM, na eny amin ny seranan-tsambon i Toliara, na eny amin ny toerana hiadina ny mineraly; Raha eny aminy seranan-tsambo no hisy ny USM, dia misy fanamboarana fantsona hanana hery fisintonana mahery vaika mba hitrohana ny CML mankany amin ny USM ka soritra telo no voadinika ho amin io fametrahana io fantson-dava io; Telo koa ny soritra voadinika ho amin'ny filalovan'ny làlana fitaterana. Fanorenana ny USM ao anaty ny seranan-tsambon I Toliara Ity tranga iray ity dia mitaky ny fitanterana ny mineraly marihitra (CML) mankeny amin ny toerampamindrana manakaiky ny reniranon i Fiherenana, sy ny fitanterana ny vokatra fivarotra miala eo amin ny USM mankeny amin ny fandraisana ny entan-tsambo mialoha ny famatrarana azy ao anaty lakam-be izay hitatitra izany ho eny amin ny sambo. Ity tranga ity dia mety hiteraka akony mafonja koa eo amin ireo fianakaviam-ben ny mpanjono noho izy manamorona ny tanàna manodidina, ny fivezivezen ny lakana, ireo faritra fanjonoana ary mikasika ireo raharaha andavanandro mifandraika amin ny fampiasana ny ranomasina sy ny manodidina ny seranantsambo. Safidy telo ho amin ny soritra mikasika ny fantson-dava miala eo aminy toerana hanaovana ny famindrana ny vokatra miala eo amin ny reniranon i Fiherenana hatrany amin ny USM no efa vita tombana. Izany fantson-dava izany dia tokony handalo eo ambonin ny tetezana misy na izay mety ho tetezana vaovao raha tsy azo tanterahina ny hampihantonana azy tanteraka, ary hilevina any ambanin ny tany ho an ny làlany sisa ambiny mandra-pahatonga any amin ny trano hanaovana ny fikirakirana. Ny angovo ilaina amin ny fitrohana ny nofon-tany dia ho vokarina eny amin ny toera-mpamindrana. Ny safidy voalohany no lava indrindra ary soritana hizotra ho any amin ny seranantsambo, ka vokatr izany dia lafo tokoa ny fanamboarana azy miohatra amin ireo safidy hafa; mamakivaky ny làlam-pirenena faha 9 koa izy io ka mety hanelingelina ireo mpampiasa izany mandritra ny fotoam-panorenana. Fohy ny safidy faharoa, saingy mamakivaky rano masira ambanin ny tany ka mitaky fiarovana bebe kokoa mikasika ny mety ho fiantraikan ny sira amin ireo fantsona; mandritra ny fanorenana, mety tsy ho azo diavina ny moron-dranomasina ka hanelingelina ireo mpanjono sy ireo mpaka rivotra Ny safidy fahatelo no mivantana mankany amin ny seranan-tsambo nefa mila hatrany fiarovana bebe kokoa hiadina amin ny vokatry ny sira. Ny fametrahana ny foto-drafitrasa dia mitaky fandoarana ny tany any amin ny roa metatra ary voaaro aminy mety fiakaran ny rano mba hametrahana ny fantsona lehibe, miaraka amin ny fanotofana tany aorian izany; izany fandoarana tany sy fanotofana izany koa dia mitarika fihantonana ny fotaka ho an ireo rano alohan ny hiparitahany. 5

9 Famintianana tsy ara-teknika - Jona 2014 Amin ireo safidy ireo dia ilay fahatelo no nankasitrahana. Na izany na tsy izany dia notapahina fa ny mety ho fametrahana mitokana ny USM any amin ny toera-piadiana lavaka (jereo eo ambany) no nekena fa tsy ny fametrahana izany ao anatin ny seranan-tsambon i Toliara, ka tsy hilana intsony ny fametrahana ny fantsona lehibe. Fanorenana ny USM eny amin ny toeram-pandavahana Ny fametrahana ny USM eny anivon ny toeram-pandavahana ny mineraly dia midika fa ireo pitsopitsony amin ny fikarakarana ny vokatra dia vita eny an-toerana avokoa, ka ny vokatra efa vonona hoamidy sisa tanterina mankeny amin ny fefiloha vato mialoha ny hanondranana azy amin ny sambo, izay mampihena ny fivezivezen ireo fiara vaventy. Io koa no safidy tsara, ary kely dia kely ireo mety ho fiatraikan ny tetikasa eo amin ny lafiny tontolo iainana izay notombanana nandritra ny fandrafetana ny vokatry ny fandalinana ny fiantraikan ny tetikasa eo amin ny tontolo iainana sy ny fiarahamonina (EIES). Safidy mikasika ny làlana Na aiza na aiza no hanorenana ny trano antsoina hoe USM, misy hatrany ny filàna ny làlana izay hitaterana ireo vokatra CML mankeny amin ny toera-pamindrana vokatra (safidy seranantsambo Toliara) na ireo vokatra efa vonona hoamidy (safidy ny eny an-toeram-pitrandrahana). Araka ny voalaza etsy ambony dia safidy telo no nandalo tombana ho an ny làlana (tombana feno no voarakitra ao anatin ny antontan-taratasy EIES mikasika ireo safidy ireo): Ny safidy voalohany dia manoritra ny làlana tsy masaka (piste) efa nisy hatrizay avy any Toliara, mamakivaky faritra afovoany feno tsilo, izay miseho amin ny endrika azo ampiasana azy sy ny ampahany tena niharatsy tanteraka miampy ny ampahan ala maina izay mifampitaha amin ny endrika fahasimbany (simba tanteraka sy andalampahasibana). Izany soritra izany dia mampiseho ny fitomboan ny fisamatsamahan ny ala. Fanampin izany dia maro amin ireo tanàna manamorona io làlana taloha io no mety voatery afindra toerana. Ny safidy faharoa no hita fa azo ahazoana tombony raha miohatra amin itsy aloha noho izy mivantana, mandalo ao atsimon ny ala maina. Kely no mety ho fiantraikan io soritra io amin ireo alan-tsilo raha miohatra amin ilay làlana taloha avy any Toliara ka azo atao tsara ny manalavitra ny faritra misy zava-maniry mbola tsy simba; mampitombo ny fisamatsamahan ny ala anefa io soritra io; eo amin ny lafiny ara-piaraha-monina, tsy misy tanàna raha tsy any amin ny miohatra ny 1 kilaometra ka tsy hilana famindran-toerana akory. Ny safidy fahatelo dia ilay manaraka sisin-dranomasina manamorona ny làlam-pirenena faha 9. Tsy dia misy fiatraikany firy raha ny mahakasika ny fisamatsamahan ny ala saingy mbola mamakivaky ny alan-tsilo mikitroka. Misy fiantraikany tsy dia tsara loatra eo amin ny fiaraha-monina io soritra io, noho izy mandalo akaikin ireo tanàna manamorona ny sisin-dranomasina, ka hanakorontana ny fiainana andavan andron ny mponina sy ny manodidina, sy ireo loza ateraky ny làlana satria ireo mponina dia mamakivaky mandrakariva ny làlana mba hahafahan izy ireo mitady izay hivelomana ao anaty ala. Noho ireo antony ireo, dia ny safidy faharoa no tsaratsara kokoa eo amin ny lafiny làlana. Raha bangoina, ny safidy tsaratsara kokoa tao amin ny fandinihana ny fiantraikan ny tetikasa eo amin ny tontolo irainana sy ny fiaraha-monina, dia ny tokony hanorenana ny trano fanivanana ny mineraly (USM) eny amin ny toeram-pandavahana ary ny fitaterana ny vokatra vonona hoamidy 6

10 Famintianana tsy ara-teknika - Jona 2014 manaraka ny làlana nosoritana tao amin ny safidy faharoa koa ary ny fametrahana fitehirizana mifanolotra amin ny fefiloha vato vaovao ao amin ny helo-dranomasin'i Toliara. Nandritra ny fizahana ifotony ny hoe "tsy misy tetikasa fitrandrahana", dia tsapa fa ny fampiasana ny tany dia hanana fiantraikany mafonja eo amin ireo zava-maniry misy eo amin ny toerana hanaovana ny fitrandrahana sy manerana ny faritra; eo ankilany, ny fiantraikany miaraka amin ny toerana handavahana sy ny fisian ny làlana dia tsy manana lanja firy rehefa natao ny fampitahana miaraka eo anivon ny faritra. TONTOLO VOAJANAHARY HITA MASO Ny rivotra mitsoka ao anatin y faritra nanaovana ny fandalinana dia anjakan ny rivotra avy atsinanana mianantsimo atsinanana, avy atsimo andrefana mianavaratra andrefana, ary rivotra avy avaratra andrefana mankany avaratra atsinanana. Mitsoka matetika avy atsinanana ny rivotra. Ny mari-pana ao amin ny faritra nanaovana ny fandalinana dia ao anelanelan ny 8 ka hatramin ny 38 C.Ny mari-pana ambony indrindra dia rehefa volana marsa sy oktobra, fa ny ambany indrindra dia mandritra ny vola jona. Ny faritra amin ny fahazoan-dalana Ranobe dia faran izay karakaina (subaride) eto Madagasikara, ary manana rotsak orana 550 mm isan-taona eo anelanelan ny volana janoary ka hatramin ny marsa (CES, 2012). Ny lemaky manolo-dranomasina eo anelanelan i Toliara sy ny reniranon i Manombo dia manana endrika tendrombohitra mifanesy miaka-midina toy izao: Fandrakofan ny hatsana mitovy elanelana hatrany hatrany ary manaraka ny sisindranomasina, tapahan ny tany sokay tranainy; Ny atitany misy sokay mitovy tantana manamorona ny sisin-dranomasina ary mipaka hatrany amin ny faran ireo farihy an-tsisin-dranomasina; Ny fisian ny vondrom-pasika amoron-driaka eo anelanelan ny sisin-dranomasina sy ny hantsana, voamarik ireo vondro-pasika milahatra amin ny sisin-drano sy ny lohasaha mitandavana; Ny renirano roa izay mivarina an-dranomasina; Ny farihy amoron-dranomasina tsy dia lalina loatra; Ny farihin-dranomamy manodidina an i Ranobe; Ny mampiavaka ny sisin-dranomasina izay mampisongadina ny fivarinan ny rano sy ny fasika any avaratra. Ny faritry ny fahazoan-dàlana Ranobe dia ao amin ny toerana faran izay maina any amin ny faritra karakaina any atsimon i Madagasikara. Ny havoan-tsokay ao anatin ny faritra Ranobe namorona ireo rano manondraka ny tanimbary any an-toerana dia ao amin ny faritra voasokajy ho karakaina koa. Noho izany, mandritra ny taona dia voafetra ihany ny fahazoan-drano raha tsy hoe misy zava-tsy ampoizina toy ny tondra-drano ateraky ny rivodoza. Ny mikasika ireo riandrano, dia betsaka ao anatin ny faritra no mikoriana avy atsinanana miakandrefana amin ny havoanan-tsokay na faritra misy tendrombohitra, izany hoe: ny reniranon i Onilahy ao atsimon i Toliara; ny reniranon i Fiherenana ao avaratr i Toliara avy hatrany; ny reniranon i Manombo ao avaratry ny faritra nahazoan-dàlana Ranobe Ny rano ambanin ny tany ao anatin ny faritra nanaovana fandalinana dia voafaitry ny havoanantsokay ny atsinanana, ny sisin-dranomasina ny andrefana, ny reniranon i Manombo ny ao avaratra ary Toliara ny ao atsimo, miaraka amin ny tandavana hikoriana miainga eo amin ny 7

11 Famintianana tsy ara-teknika - Jona 2014 havoanan-tsokay ka mihazo ny avaratra avaratra atsinanana sy atsimo atsimo andrefana, izay milahatra amin ny fiforonana tsy ara-dalàna ny nofon-tany misy sokay (Hydromad, taona 2004). Ny rano ambanin ny tany eo ankilan ny faritra nahazoan-dàlana Ranobe dia tombanana eo anelanelan ny 50 sy 60 metatra ambonin ny haavon ny ranomasina andavanandro (GCS taona 2005). Ny lavan ny sisin-dranomasina ao andrefan ny faritra, dia hifananton'ny tany sy ny rano ambanin ny tany ka nahatonga faritra mando. Ny farihy Ranobe, dia heniheny ohatra tsara manazava izany fifanatonana izany. Misy andiana faritra mando maharitra manaraka ny fefin ny sisin-dranomasina, ary ny hadiriny dia mitombo be noho ireo rotsak orana betsaka ka mahatonga ny faritra ho tsy azo diavina mandritra ny fotoana maharitra. Ny eo anivon ny ranomasina amin ny sisiny andrefana dia anjakan ny rano miataka amin ny ranomasina milahatra amin ireo sisin-dranomasina ary voafaritry ny rambon ny vondrona harandranomasina avy any andrefana. Ireo rano miataka ireo dia mifaningotra amin ny faritra rakojavamaniry anaty rano efa simba ary koa haram-bato sy vato hara mitovy tantana. Amin ny toerana misy rano miataka ny ranomasina no misy ny tanànan i Toliara sy ny seranan-tsambony, izay amin ny ranomasim-be noho ny fisian ny haram-bato mitovy tantana amin ny morontsiraka; izany rano miataka izany dia misokatra ary mivarina any amin ny ony Onilahy avy ao atsimo sy ao amin ny reniranon i Fiherenana avy ao avaratra. Tsy azo lavina fa manenika ny sisindranomasina ny fasika marivo ary manantona hatrany manamorona ireo fidirana eo avaratra sy atsimon ny toerana misy rano mihataka amin ny ranomasina, izay mety hiteraka fahatotorana ny sisiny indrindra amin ny haram-bato heverina ho ajoro sy ny seranan-tsambo misy ankehitriny. Na izany na tsy izany anefa, dia tsy misy fitomboany loatra ny morontsiraka ao anatin ireo toerana misy rano miataka amin ny ranomasina. Ny fisian ny tanànan i Toliara sy ny mponina ao aminy dia misy fiantraikany eo amin ireo toerana misy rano ireo, noho ny fanimbana ny alan ny honko sy ireo karazan-java-manan aina an-dranomasina ataon ireo mpanjono any an-toerana. Ny rako-javamaniry misy ao anatin ny faritra hanaovana ny fandalinana (eo anelanelan ny reniranon i Manombo sy Fiherenana) dia manan-karena rahany lafiny fahasamihafany sy ny karazany misy ao ankehitriny. Ny tena mibahana amin izany dia ny fisian ny zava-maniry anjakan ny ala matevina manaraka ny lemaka amin ny tora-pasika sy ny ala ary kirihitr ala manamorona ny tany avo mitovy tantana misy sokay. Ireo karazan-java-maniry roa ireo dia manan-karena tokoa amin ny karazany misy ary misy ampahany aza toa voatsinjara ny fijery ny toerana ahitana azy. Raha jerena amin ny ankampobeny ny toerana nanaovana ny fandalinana, dia tsapa fa zava-maniry mbola tsy nisy fahasimbana no nisy tany amin ny taona 2007, fa taty min ny taona 2012, dia vitsy sisa ireo tsy niharan ny fahasimbana noho ny afitsoky ny olombelona ka ny fanaovana arina fandrehitra no betsaka amin izany. Tsy misy akony firy ny fahitana ireo karazan-javamaniry. Ny vakim-paritra ekolojika dia mitahiry karazany enina amin ireo biby mampinono manana rantsana dimy misy hoho ka ny efatra dia ao anatin ireo dimy harovana fa madiva ho lany taranaka, anisan izany ny maki. Maro amin ireo karazam-biby no arovana satria atahorana ho lany tamingana any amin ny tany karakaina any atsimo, ka anisan izany ny mangouste de Grandidier sy ny sokatra antsoina hoe radiée de Madagascar. Miha ripaka na mihamanify ny ala noho ny famokarana arina fandrehitra ary koa avy amin ny fitomboan ny fambolena (katsaka sy ny ahitra eny am-piandrasana omby ary ireo afo anaty ala amin ny famoronana na fanavaozana ireo kijana fiandrasana omby. Hatry ny ela, ny harena voajanahary Malagasy dia noheverin ireo fianakaviam-be iraisampirenenana miandraikitra ny fikajiana ho tena lohalaharana eo amin ny fiarovana azy. Niaraka amin ny fitomboan ny fifaninanana hanana tany teto Madagasikara, dia nataon ny fitondrana 8

12 Famintianana tsy ara-teknika - Jona 2014 Malagasy sy ireo fikambanana mikajy ny tontolo iainana toy ny Fonds Mondial pour la Nature (WWF) ho laharam-pahamehana ny fiarovana ny zavaboahary sy ny zava-misy ao aminy. Voasokajy ho tsy manam-paharoa I Madagasikara amin ny fananany izany karazan-javamiainaizany. Eo anatrehan izany dia noheverina fa ny valan-javaboahary voaharo no afaka hiantoka ny faharetan izany karazan-java-miaina. Nanomboka ny taona 2003, dia nametraka fiaraha-miombon antoka amin ireo fikambanana iraisam-pirenena tahaka ny WWF ny Governemanta Malagasy amin ny hanitarana avo telo heny ny faritra arovana (WWF, 2012). Ny faritra arovana vonjimaika ao amin ny PK32- Ranobe dia anisan ny tao anatin izany. Ao avaratr'i Toliara ary atsimon ny toera-pitrandrahana hoapetraka no misy izany. Araka ny voalazan I Gardner et al (2009), io faritra voaaro io dia mitandavana eo amin ny hekitara eo an-tampon I Mokoboka. Ny toe-ponenana dia rakotry ny alan-tsilo eo amin ny tany sokay. Io valan-javaboahary vaovao io dia noheverina ho alafady, indrindra noho ireo karazan-drajako tao misy karazany maro araka ny fandinihana nataon I Charlie et al (2009). Amin izao fotoana izao dia lavitry ny tabataba ateraky ny fisian ny asa vaventy sy ny fivezivezen ny fiarakodia ny faritra. Na izany aza, dia tsapa fa mafimafy noho ireo voasoritry ny Banky iraisam-pirenena ny feon-javatra re manodidina, raha araka ny fanadiadiana natao (efa misy na misy alohan ny hisian ny tetikasa) amin ireo toerana sasany. Ao amin y faritra nahazoan-dàlana Ranobe, ny tahan ny fihanaka ny taratra mahery vaika (niveau de rayonnement) misy dia efa ambony ara-voajanahary (avo 3-4 heny) raha oharina amin ireo faritra ivelany noho ny taratra mahery vaika voajanahary amin ireo mineraly kendrena hotrandrahana. Tamin ny taona 2006, ny fandalinana ny fandavahana hahazoana santionan-tany nivoaka tamin ny asa andrana teo amin ny manodidina sy ny toerana mitahiry ny mineraly dia nakana singany ary naovana fanavahana ifotony mba hijerena ny vesatry ny antsoina hoe radionucléides. Ny vokatry ny fanadihadiana dia nampiseho fiovaovana samihafa: ny tahan ny oranioma na uranium dia tsy dia mifankaiza amin ireo singa nalaina tamin ny faritry ny tany nankatoavina fa hanaovana ny fandalinana voalohany, fa ny tahan ny torioma na thorium kosa no somary latsaka ambany. TONTOLO ARA-PIARAHAMONINA SY TOEKARENA Ny sehatra mikasika ny fifandraisana sy ny ara-panjakana ary ireo famatsina samihafa dia hita ao Toliara miaraka amin'ny fisian ny seranan-tsambo an ny atsimo andrefan I Madagasikara, saingy tsy dia hita any an-toerana kosa ireo mpanao taozava-baventy. Ny faritra tahakan Ifaty ao avaratra sy Anakao ao atsimon i Toliara dia efa azo antoka fa ho toeram-pizahantany hahaliana ny maro noho izy ireo manana tora-pasika mahasintona sy ny haram-bato hara tsy fahita firy. Ny toerana hitrandrahana dia ao amin ny faritra atsimo andrefana, izay eo ambany fitantanan ny Lehiben ny faritra. Ny faritra hanaovana ny fandalinana dia ao amin ny distrikan i Toliara II izay misy ny kaominin i Ankilimalinike, Tsianisiha ary Maromiandra. Misy mponina 36 isaky ny kilaometatra toradroa ao amin io faritra hanaovana fandalinana io, ary 4 ka hatramin ny 8 no isan ny olona isan-tokantrano. Ny tanàna manodidina io faritra io dia manana mponina 400 ka hatramin ny Ny faritra dia ampiasain ny olona ho kijana firaofan ny biby fiompy, fanangonana ireo zavatra ilaina andavanandro ary ny fambolena manaraka ny fizaran-taona. Natao tany am-piandohana ny fiaraha-midinika teo amin ny orinasa mpitrandraka sy ny mponina manodidina, ary notohizana hatrany ka taorian ireny fihaonana ireny no nanekena fa mety ho azon ny orinasa tanterahina ny fitrandrahana. Fepetra maro no napetraka toy ny fahafahana 9

13 Famintianana tsy ara-teknika - Jona 2014 mampiasa hatrany ny faritra ivelan ny natao hitrandrahana, ny fanatanterahana ireo tsirin-kevitra mitondra fampandrosoana ho an ny mponina manodidina, ny fanonerana ara-drariny sy mahitsy ny fatiantoka noho ny tsy fahafahana mampiasa ireo harena voajanahary ao anaty faritra hitrandrahana ary ny hisian ny dinika mitohy eo amin ny roa tonta. FAMINTINANA NY FANDALINANA MANOKANA NATAO NANDRITRA NY EIES Ny toetry ny rivotra Ny mety ho fiantraikan ny fielezan ny vovoka, ny entona ary ireo poti-java-madinika avy amin ny tetikasa amin ny rivotra iainana dia nodinihina koa, ka taorian izany no notsoahina ireo fehinkevitra manaraka ireto: Ny fiparitahan ny poti-javatra madinika PM 10, ny dioxide d azote (NO 2 ), ny PMD (particule matière diesel) sy ny fianjeran ny vovoka voavinavina dia tokony ho any ambonin'ny faritry ny fitrandrahana, ary mahitsy mankany amin ny làlana famoaham-bokatra; Ny fiantraikany dia mety hampidi-doza raha toa ka ny toera-pitrandrahana sy ireo fanorenana manolotra azy tsy voatrandraka araka ny pitsopitsony tondroin ny fomba fanaraha-maso napetraka mialoha (ohatra, fanondrahana ara-potoana ny làlana mba hanenana hatrany amin'ny 75 isan-jato ny fihanaky ny vovoka). Ny faritra iharan izany, rehefa ampiharina ny fomba fanenana voalaza etsy aloha dia tokony tsy hisy hafa tsy ny eo amin ny toeram-pitrandrahana ihany; Noho ny tahan ny filana mbola latsaka eo amin ny lafiny fitaterana, ny fiantraikan ny entona sy ny poti-java-madinika dia tombanana ho mbola ambany raha miohatra amin ny fenitra fampiasa. Noho ny kisendrasendra dia mety hisy fioharana ny fenitra ilain ny hatsaran ny rivotra eny amin ny toerana manaraka ny halavan ny làlana; Koa satria misarona ny fametraham-bokatra eo amin ny toeram-pitehirizana eny amin ny fefiloha rarivato, dia ho maivana ny fiantraikan ny poti-java-madinika (vovoka) sy ny etona mipariaka. Manoloana ny fehin-kevitra notsoahina tamin ny fanombanana ny fiantraikan ny tetikasa, ny fitaterana ary ny fefiloha rarivato voatanisa etsy aloha, dia toy izao no toromarika naroson ireo manam-pahaizana: Ny fepetra mialoha (fanondrahana ara-potoana ny làlana) dia tokony ampiharina ary tohizana mandritra ny fitrandrahana manontolo; Ny fanaraha-maso mitohy dia ampiharina amin ny etona mirehitra maina, ny fiparitahan ny zava-madinika, ny dioxyde de soufre ary ny oxyde d azote mba hanajana ireo fepetra napetraky ny IFC mahakasika izany; Miankina amin ny fiantraika fantatra ary sy ny fizotry ny rivotra ao amin ny faritra, ny fanarahana ny PM 10 dia tokony hotanterahina any amin ny faritry ny ilany andrefan ny toera-pitrandrahana. Ny fametrahana ny toerana hanaovana izany fijerena izany, dia miankina amin ny fizotra sy ny fandroson ny asa fitrandrahana hatrany. Fandinihana ny tabataba Ny fahalotoana henon ny sofina (pollution sonore) dia miseho amin ny fotoan ny fanorenana sy mandritra ny asa. Hiteraka tabataba ny fanatanterahana ireto zavatra manaraka ireto mandritra ny fotoam-panorenana: ny fanomanana ny toeram-pitrandrahana sy ny fanarenana na fanandratan-tany; ny fananganana ireo foto-drafitrasa ampiasana fitaovana mifindrafindra toerana; ny fampiasana sy ny fivezivezen ny fiarakodia; 10

14 Famintianana tsy ara-teknika - Jona 2014 ny fampiasana ireo milina mpamokatra herinaratra, sns. Mbola tsy vita ny famaritana ny ho fampiasana matetika ireo fitaovana vaventy, fa ny tabataba aterak izany dia tombanana ho eo anelanelan ny 85 ka hatramin ny 100 db. Noho izany, dia napetraka ireto toro-marika manaraka ireto ho an ny fotoana hanatanterahana ny fanorenana: raha misy ny fametrahana / fikapoana fototra mandritra ny fandrafetana fefiloha rarivato, dia mba hampihenana ny tabataba dia tokony handray fepetra toy ny fanaovana rindrinakely manasaraka ohatra. Tsy maharitra izany tabataba izany; noho izany, tsy misy fiantraikany loatra amin ny ankampobeny. Raha amin'ny alina no anatanterahina ny asa, dia tokony hisy fandalinana misimisy kokoa mahakasika ny fipariahan ny tabataba sy ny fepetra hampihenana izany; ny mpiasa dia tokony hahazo fiofanana mikasika ny maha sarotiny amin ny tabataba, mba hahafahana miantoka mba tsy ho mafy ny tabataba ateraky ny asa fanorenana; notsindrina mafy ny fampiasana fitaovana azo enti-tànana miaro amin ny tabataba. Ireo fitaovana ireo dia azo apetraka faran izay akaiky indrindra ny fototry ny tabataba, toy ny fitaovana fanindrina entona azo afindrafindra (compresseurs mobiles), na ny milina fampiasa amin ny fandavahana (plateforme de forage); apetraka ny fomba fanatanterahana fandinihana miverimberina ny tabataba, mba hahazoana mamaritra ny fahazoan antoka ny fepetra hampitoniana izany. Fanombanana ny rano Ny filana amin ny rano eo amin ny fitrandrahana " maina " ny harena an-kibon ny tany (amin ny antsoina hoe voie seche) sy ho amin ireo fikarakarana samihafa dia tombanana ho any amin ny 560 metatra toratelo (m 3 ) isan ora (latsaka kely ny metatra toratelo isan andro, ka ny 90 % dia alaina amin ny alalan ny fandavahana, ary 5-10 % oneran ny akora mineraly mando. Manodidina ny 90 % ny filana rano no miverina any amin ny toerana voajanahary avy amin ny alalan ireo sisa tavela avy ao amin ny ozinina fanodinana avy amin ny antsoina hoe voie humide, izay mitarika ny fahafenoana ho azy ny tandavan-drano misy sokay mifanolotra amin ny tany faha-gola Eocene. Zava-dehibe ny fampiasan ny trano fikarakarana ireo rano nodiovina indray rehefa avy nampiasaina, ary mandritra ny fotoana ela, ny taham-pifandraisan izany miohatra amin ny fitondrana rano avy any ivelany dia eo aminy ny 6,5:1. Ny filana amin ny rano dia mety tsy hiova firy mandritra ny 21 taona hiodinanan ny fitrandrahana ny harena an-kibon ny tany. Noho ny elanelan-tany misy eo amin ny toeram-pandavahana noeritreretina sy ny habetsahan ny rano manodidina (rano miandrina amin ny sisin ny moron driaka sy ny reniranon i Manombo), dia tsy hisy fiantraikany firy amin'ny rano manodidina ny fisintonana rano ambanin ny tany. Ny tombana natao mahakasika ny filana amin ny rano momba ny faminavinana vaovao ny toerapitrandrahana (fitrandrahana "maina"), dia tokony hoporofoin ny ohatry ny tena izy (modèle) novokarina teo aloha manoloana ny fitakiana filana aterak izany fomba fitrandrahana vaovao izany, alohan ny hamitana tanteraka ny ambaratongam-piovaovan ny faminavinana. Anisan ireny ny filan ny mponina manodidina sy ireo asa mahakasika ny varotra (toerana fandraisam-bahiny), ary ny mety hitomboan izany aoriana. Raha vao vita ny faminavinana ka azo antoka fa hisy akony eo amin ireo faritra mando manakaiky ny morontsiraka ny fisintonan-drano notondroina dia tokony hiroso amin ny fandinihana lalina momba ny maha zava-dehibe ny fiantraikan izany eo amin ny toe-piainan ireo faritra mando ireo. Ny fanaovana andri-maso maharitra dia ilaina mba hanamarinana ny vokatry ny andrana sy hahafahana mahazo antoka fa fantratra mialoha avokoa ny mety ho akon ny tetikasa eo amin ny ireo mpampiasa azy sy ny toerana manodidina, ary hanohanana ny fepetra fanarenana raha 11

15 Famintianana tsy ara-teknika - Jona 2014 ilaina izany. Tokony ho ao anatin ny fanarahana maharitra mandritra sy aorian ny fanatanterahana ny tetikasa ny momba ireo toerana natao hifampitahana (vavolombelona) izay tsy voakasiky ny toerana mineraly sy ny fakana rano, mba hahafahana manombana ny mety ho fiovan ny faritra izay tsy mifandray amin ny fitrandrahana harena an-kibon ny tany. Ny mety hisian ireo atsanga mitsitokotoko Ny fefiloha vato vaovao sy ny toeram-pitehirizam-bokatra mifanila dia manakaiky ny morontsiraka anjakan ny herin ny onja sy ny rano mandeha mitondra atsanga avy an-tanety sy an-dranomasina manaraka ny moron-drano, izay tsy misy fiovana firy ny fivoarany. Namporisihina noho izany ny hampidirana anatiny kokoa ny toera-pitehirizana sy ny fefiloha, mba hampihena ny fiantraikan ny asa atao ao eo amin ny fitaterana ny atsanga an-dranomasina, ary tsy hampirodana an ireo fotodrafitrasa noho ny mety ho fahalanian ny tany amin ny tavan-tevana. Mba tsy hahabetska ihany koa ny fiantraikan ny atsanga eo amin ny fefiloha, dia tokony fohy izy io, fa ny rarivato amin ny tongon-kazo amon-dranomasina no tokony ho lava araka izay azo atao. Ny faminavinana natao mahakasika ny tongon-kazo sy ny fefiloha vato eo amin ny seranana dia tokony tsy hisy fiantraikany eo amin ny fitaterana ny atsanga manaraka ny moron-drano sy ny rarivato indrindra indrindra, ary ny helo-dranomasin i Toliara amin ny ankampobeny. Fanombanana ny taratra mahery vaika (rayonnement) Ny tetikasa fitrandrahana dia misy ny fanalana (extraction), ny fikirakirana ary ny nanomezandanja ny fivangongoam-pasika mineraly misy mineraly mavesatra ka misy taha ambony momba ny radionucléides azo avy amin ny fivakisana ny oranioma sy ny torioma. Ny fisian ny antsoina hoe matières radiactives ao amin ireo mineraly ireo dia miterka ireto fiantraika radiolojika (radiologiques) manaraka ireto: ny fitataovan izany eo amin ny mpiasa noho ny asany; ny mety ho fitataovan izany eo amin ireo mponina manodidina; ny fitantanana ny faika sy ny mahakasika ny fiantraika radiolojika eo amin ny tontolo iainana mandritra ny fotoana maharitra. Ireto no fomba mety hampitatao ny mpiasa sy ny olona miaina manodidina ny toerampitrandrahana: ny fitataovana ivelany amin ny rayonnement gamma azo avy amin ny radionucléides mamokatra ny gamma; ny fifohana entona radioactifs avy amin ny radon sy thoron ny fifohana rivo-bovoka radioactifs misy mpitondra potika alpha lava fiainana (à vie longue) azo avy amin ny fivakisana voajanahary eo amin ny oranioma sy ny torioma. Ny nivoitra tamin io fandalinana manokana io dia ireto manaraka ireto: ny fatra isan-taonan ny fanambanin ny fampitahana ao anatin ny fizaran-tany fitrandrahana dia hiakatra be raha mitaha amin ireo taha antonony iraisam-pirenen ny komity siantifikan ny firenena mikambana (Comité Scientifique des Nations Unies sur les effets de rayonnements ionisants); ny vokatry ny fandinihana ny fampitahana dia nanambara fa ny fomba ahazoana ny fitataovana amin ny antsoina hoe radon no tena mibahana mandritra ny fotoampanomanana ny asa; 12

16 Famintianana tsy ara-teknika - Jona 2014 mandritra ny fikarakarana ny mineraly mavesatra CML araka ny pitsopitson ny USM, dia mitombo ny fifangaroana misy eo amin ny oranioma sy ny torioma mahasahana ireo fiovaovana maro; Ny zavatra fantatra dia miangona ao amin izay sisa tavela ny ankamaroan ny taratra mahery vaika ao amin ny CML niainga avy tany amin ny USM. Ny anton izany dia satria ny pitsopitsony amin ny fampisarahana ny mineraly dia natao hampiavahana ireo vokatra misy vidiny (ilmenita, rutile ary zirikaonina) amin ireo ambiny mameno ny CML. Ireo sisa tavela ireo dia mitahiry monazita izay tena miteraka taratra mahery vaika noho izy misy singa radioactifs sahala amin ny oranioma sy ny torioma. Noho izany ny refin ny taratra mahery vaika ao amin ny ambiny sisa tavela amin ny CML dia miakatra raha miohatra amin ny an ny fasika misy mineraly tamin ny voalohany. Mba hitantanana tsara ny fitataovan ny mpiasa amin ireo zavatra ireo dia tsara ny fisian ny fanaraha-maso arapitantanana sy ara-teknika; Ny ankamaroan ny radioexposition arak asa ao amin ny UCP sy ny UCM dia azo avy amin ny rayonnement gamma raha ohatra ka voavatsy fitaovana mahomby miady amin ny fanidin ny vovoka ny faritra maina ao amin ny ozinina; takiana ny hisian ny fepetra mifandraika amin ny fampitoniana mba hiadiana amin ny fianaka entin-drivotry ny vokatra miala ao amin ny faritra fitehirizana. Ny fifangaroan ireo sisa tavela amin ny USM sy ny UCP alohan ny hampiasana azy ireo mba ho fanotorana ny lavaky ny fitrandrahana no heverina fa hevitra mahomby ho an ny fanariana farany azy ireo. Na izany aza anefa, io safidy mikasika ny fanariana farany io dia tsy ankatoavina raha tsy aorian ny faminavinana avy amin ny fitarafana mandritra ny fahazoan-tsaina amin ny antsipiriany. Andraikitry ny mpitarika ny tetikasa ny mamantara sy mitantana ny lafiny mahakasika ny radiolojoka rehetra ary mamaritra fepetra teknika sy ara-pitantanana mba hitazonana ny radioexposition mitatao amin ny mpiasa sy ny vahoaka hifanaraka amin ny fomba famerana ny fatra mandritra ny faharetan ny tetikasany. Misy karazana lokaloka mikasika ny taratra mahery vaika efa voafaritra tao anatin ny fandinihana lalina, izay tokony ho jerena akaiky ary anaovana tombana amin ny fotoana mialoha ny haminavinana ny tetikasa. Alohan ny fizahana (fakana sy fikirakirana) ny fitrandrahana, dia tokony hisy tombana amin ny antsipiriany mikasika ny fahazoana toky ny fatra mety hisy amin ny fitataovan ny mpiasa sy ny vahoaka, miainga avy amin ny fitrandrahana harena an-kibon ny tany mahazatra. Misy angombaovao ilaina amin izany, izay hanaovana tombana ireto zavatra mikasika ny fandaminana ny fiarovana amin ny radioexposition. Alohan'ny ny fitrandrahana, dia tsy maintsy tafapetraka ny fandaminana ny fiarovana amin ny radioexposition ho an'ny mpiasa sy ny vahoaka, ary ny fanaovana andri-maso mikasika izany eo amin'ny orinasa sy ny tontolo-iainana. Fanombanana ireo faika Sivy no isan ireo mety ho fiantraikan'ny fitantanana ny faika voasokajy, ka ny fito amin ireo dia tsy dia misy fiantraikany ratsy loatra rehefa misy ny fepetra fampitoniana, iray antonony, fa ny iray kosa dia manana fiantraikany avo kokoa. Ny fanatsarana ny foto-drafitrasa momba ny fitantanana ny faika sy ny faharesen-dahatra ny amin ny tokony hitantanana araka any tokony ho izy ny faika no heverina fa fenitra ambony sy tsara indrindra. 13

17 Famintianana tsy ara-teknika - Jona 2014 Nohon ny toetra maharitra ananan ny mety ho fiantraika ateraky ny faika dia lazaina fa tokony hanaja ireo fepetra mahasarotiny arakany lalàna misy eto an-toerana sy ny fanao eran-tany mikasika ny fitantanana ny fampitoniana ny mpamorona ny tetikasa. Noho ny mbola tsy fahampian ny fari-pahalalàna eto an-toerana mikasika ny fitantanana ny faika, dia nohamafisina ny tokony hametrahana fikarakarana ny faika ao anatin ny toeram-pitrandrahana. Araka ny firehana iraisam-pirenena mahakasika izany, ny faika rehetra dia tokony raisina antànana ny fikarakarana azy ary tantanana araka ny ambaratongam-pitantanana mifandraika amin izany, izay manoritra manokana, araka izay azo atao mba hanakanana ny fisian ny faika na ny fampihenana azy ireo dieny ny any am-piandohana. Raha tsy azo tanterahina izany, dia tokony averina ampiasaina izy ireo, ahodina indray ary avy eo potehina arakany tokony ho izy mba hanenana ny fiantraikany eo amin ny tontolo iainana. Fandinihina ny zavamaniry Ny fampiasana ny tany amin izao fotoana izao dia misy fiantraikany azo tsapain-tanana eo amin ny rako-javamaniry eo anivon ny zana-paritra, indrindra noho ny fampiasan ny mponina azy. Noho izany ny rako-javamanirin ny fizaran-tany dia miha simba noho ny fiantraikan ny asan ny olombelona toy ny famokarana arina fandrehitra, ny fanamboarana lakana, ny fandorana tanety ho an ny kijana firaofan ny biby fiompy ary ny tavy. Ny fiantraikan ireo dia miha mafy miha mafy eo amin ny fahapotehan ny rako-javamaniry ary miteraka fikorontanana lehibe eo amin'ny tontolo manodidina. Misy karazan-javamaniry mandrakotra sady mandripaka (envahissantes), saingy tsy mbola mahataitra amin izao fotoana izao nefa mety ho sakana aoriana. Ny fisavana ny rako-java-maniry ao anatin ny faritra manodidina ny fitrandrahana mba ho amin ny fametrahana ny foto-drafitrasa samihafa dia mitarika: ny fahaverezan ny vondron ny rako-javamaniry: Ny maha zava-dehibe io fahaverezana io noho ny fisavana dia miankina amin ny fitsinjarana ny rafitra ny fahasamihafana ary ny fiarovana ireo vondrona manokana ho very. Enina no isan ny vondron ny rako-javamaniry voakasik izany, ary ny maha zavadehibe amin ny fiantraikany aoriann y fampiharana ny fepetra fampihenana dia heverina ho amin ny tahany maivana ka hatramin ny antonony, fa raha tsy misy kosa ny fepetra mifandraika amin ny fampitoniana, dia ahina ny hisian ny fiantraikany goavana. ny fahaverezana na fihenan ny karazan-java-miaina: Ny fandripahana ny rako-javamaniry dia midika ho fahaverezan ny karazan-javamaniry ao anatin ny faritra manodidina ny toeram-pitrandrahana sy ireo tontolo voakasiky ny fotodrafitrasa sy ny làlana. Harenan ny faritra amin ny ankampobeny ny fananana karazandrako-javamaniry indrindra ny alan-tsilo izay ny ankamaroany any ivelan ny fizaran-tany hanaovana andrana Ranobe. Noho izany dia heverina ho maivana ny tahan ireo akony ireo aorian ny fampiharana ny fepetra mifandraika amin ny fampitoniana. Ny fiantraika eo amin ireo karazany mampanahy: Ny fiantraika dia hita taratra eny amin ny maridrefy ho an ireo karazany voafetra ny fiparitahany ary mila fiarovana. Ny tetikasa dia afaka mampihena ny fizaran-tany hizarana azy izay mety hampihena ny fahavelomany. Natao tamina vondron-karazana telo samihafa ny tombana (karazana 19 fantatra fa mampanahy ao amin ny fizaram-paritry anovana andrana ao Ranobe, karazana 24 ao anatin ny fizaram-paritry ny tetikasa, ary 43 azo heverina ho mampanahy ary voasokajy ho antonony ny tahany aorian'ny fampiharana 14

18 Famintianana tsy ara-teknika - Jona 2014 ny fepetra fampihenana ho an ny zana-paritry ny fitrandrahana harenan-kibon ny tany sy ny làlana, fa ambony kosa raha tsy misy fampitoniana. Ny fikorontanan ny anjara raharaha sy ny fivoarana miandalan ny tontolo manodidina: Mifameno ny toeram-pivelomana ary ao anatin ny tontolo manodidina mirindra izay misy ny ahitana ny fizotry ny fepiainana sy ny tena toetrany hita mivantana. Ny fahaverezany na ny fiovany dia mitondra fikorontanana ho an ny firindran ny tontolo manodidina ary ataharorana hanohintohina ny fifandraisan ireo fivoarana miantoka ny hery ara tontolo iainana sy ny faharetam-pahaveloman ny karazana sasany. Ny fivakivakisana dia hisan ny antony mitondra fiantraikany tsy hita pesipesenina amin ny rako-javamaniry satria ny fahatapahana miseho ao amin ny fitohizana hatrany am-piandohana dia mitarika fahaverezan ny fifangaroan ny tarika sy ny fivoarana miandalan ny tontolo manodidina. Ny toeram-pandavahana dia hisy akony amin ny tahany maivana eo amin ny lafiny fikorontanan ny tontolo manodidina aorian ny fampiharana ny fepetra mifandraika amin ny fampitoniana ka apetraka ny tandavan ala ekolojika alohan ny zava-drehetra. Ny endrika mahitsin ny làlana hitaterana ny vokatra no tena hanana akony lehibe ka anisan izany ny fikorontanan ny tontolo manodidina, indrindra ho an izay safidy noraisina ao anatin ny faritra eo anelanelan ny ala amin ny tany sokay sy ny karazan-drako-javamaniry eo amin ny lemaka tany fasika. Na dia hampiatra ny fepetra mifandraika amin ny fampitoniana aza dia ho mafy hatrany ny fiantraikan izany. Ireto no toro-marika lehibe nivoitra taorian ny tombana: alalinina indray mandeha ireo tsiririn-kevitra rehetra mikasika ny drafitra momba ny famerenana amin ny laoniny ny toeram-pandavahana ka tokony ho azo hatsaraina mandritra ny fotoam-pitrandrahana; arafitra ny drafitra mahasahana fotoana tsy ela mikasika ny famerenana amin ny laoniny mba hahafahana mitsinjo ny fandaharam-potoana amin ny 2 ka hatramin ny 5 taona ho avy hanatanterahana ny famerenana amin ny laoniny. Tokony ho ao anatin ireo ny paik ady amin ny hampidirana ka hambolena ao anaty fizaran-tany ny karazan-kazo mety hanaovana famerenana amin ny laoniny ara-dalana sy ny fitadiavana na fanavotana ireo karazana ao anatin ireo mampanahy; apetraka miaraka amin ireo sampana misahana ny fiarovana ny tontolo iainana ny paika ady ho enti-manao ny fanonerana ny karazan-java-miaina voakasika. Azo atao ny manampy amin ny fiarovana ireo fizaran-tany manana ny maha izy azy ao anatin ny valan-javaboahary voaaro vonjimaika, amin ny PK32-Ranobe. Ireo fizaran-tany heverina ho laharam-pahamehana kany iray amin ireny ny tantanan ala Ranobe, dia tokony ho raisina ho toy ny faritra arovana, ary iarahana amin ireo vondrona mahefa. Ny fitantanana mahomby sy ny fiarovana ny karazan-java-miaina dia mitaky famatsiam-bola sy fiofanana; misy ampahany amin ny fizaran-tany hitrandrahana no ho voavoly hazo ao anatin ny fotoam-panarenana. Voalaza fa ny faritra natao ho arenina amin ny fambolen-kazo (400 hekitara) no honerana amin ny fanarenana ny alan-tsilo sy ny fiarovana ny ala maina miha simba any ivelan ny toeram-pitrandrahana, iarahana amin ireo vondrona sy ny mponina manodidina. Mba hahombiazan ny fanarenana izany faritra izany, Toliara Sands dia maminavina fiaraha-miombon antoka miaraka amin ireo fandaharan asa manao fambolenkazo iombonana efa misy ary hanome ny anjara birikiny amin ny fanarenana ny fizarantany voakasik izany. 15

19 Famintianana tsy ara-teknika - Jona 2014 Ireo fepetra rehetra ireo dia ho voamarika ao anatin'ny lamin asa mikasika ny karazan-javamiaina (Plan d Action pour la Biodiversité, PAB). Fandinihana ny biby Tsy mahagaga raha misy fiantraikany betsaka amin ireo biby sy ny rafi-piainan ny zavaboahary ao amin ny fizaran-tany ny fampiasana ny tany. Na dia tsy voakasika firy aza ny toepiveloman ireo biby mangatsia-drà (amphibiens et reptiles) samihafa, dia misy akony tsy azo tsinotsinonina eo amin ny vorona sy ireo biby mampinono, ary ny zava-dehibe amin ny fiantraikany mialoha ny fitrandrahana, dia ny fiakaran izany niha mafimafy kokoa. Raha tsy misy fanatsarana ny lafiny ara-piaraha-monina sy ara-toekaren ny mponina manodidina ny faritra, dia fantatra mialoha fa hiakatra ny taha ka hitarika fahaverezan ny biby ary fikorontanan ny rindrampiainanan ny zavaboahary ka hosarotra ny fanarenana izany amin ny fotoana maharitra. Na izany aza, ny fametrahan ny tetikasa fandaharan asa momba ny fampivoarana ara-piarahamonina tahaka ny fanorenana asa, ny fampiofanana ny mpiasa, ny fanohanana ny fandaharan asa mikasika ny fambolena sns, dia hampihena miandalana ireo akony voalaza ireo. Ny asa tanterahin ny tetikasa mifandraika amin ny fitrandrahana harena an-kibon ny tany dia mety hiteraka akony amboniny eo amin ny tontolo iainana, izay marihina fa miha mafy eo amin ny tontolon ny biby sy ny fizotry ny toe-piainan ny zavahoahary ao amin ny faritra. Ireo asa fitrandrahana ireo dia hitarika fahaverezana eo amin ny biby sy fikorontanan ny toe-piainan ny zavaboahary miainga avy any amin ny taha antonony nankany amin ny taha ambony taorian ny fampiarana ny fepetra fampitoniana naroson ireo mana-pahaizana momba ny biby any antoerana. Misaraka ny fanombanana ireo fiantraika samihafa mifandraika amin ny foto-drafitrasa toy ny lalàna famoaham-bokatra, sy ny trano fanaovan-taozavatra USM. Izany dia nohon'ny antony fisian'ny safidy solo vaika ho an ireo singa sasany, ary ny fanaovana tombana misaraka dia mampisongadina ny safidy mifanentana tsara amin ny fiantraika amin ny biby. Noho izany, dia tapaka fa: ireo fiantraika mafonja dia mahakasika ny làlana fitaterana vokatra. Izany dia nohon ny fahaverezana betsaka eo amin ny toeram-ponenana sy ny fivakivakisana ateraka ny fanorenana sy ny fandaminana ny lalam-baovao ao anatin ny fizaran-tanin ny alan-tsilo ao Ranobe izay misy fiantraikany mivantana eo amin ny karazan-java-miaina sy ireo karazany tsy fahita firy sy / na madiva ho ringana, sy misy fiantraikany an-kolaka nohon ny fikorontanan ny biby ary ny mety ho fampidirana karazam-biby sy zava-maniry maro avy any amin ny tany hafa; Mandritra ny fitrandrahana ny harena an-kibon ny tany, ny fivezivezena amin ny làlana dia midika ho famonoana tsikekikely ny biby sy ireo karazan-javatra hafa nomena laharampahamehana. Izany fivezivezena izany koa dia hampitombo ny fahalotoan ny tontolo iainana (vovoka, vokatra simika, tabataba) ary tsy azo ialana ny mety hampitombo ny doro tanety izay mety hitarika fahafatesana ho an ny biby. Ambivitra ihany ny fampihenana mety azo atao manoloana ireo tranga ireo Toerana roa no hisafidianana amin ny fametrahana ny USM (na eny amin ny toerampitrandrahana na eny amin ny toeram-pandraisana entana eny amin ny seranan-tsambon'i Toliara) no nodihina sy notombanana. Ny fametrahana mitokana ny USM eny anivon ny toerana fitrandrahana dia midika fa tsy dia betsaka ny fitaterana amin ny làlana raha ny momba ireo vokatra efa miondrana. Ny fametrahana 16

20 Famintianana tsy ara-teknika - Jona 2014 ny USM manakaiky kokoa ny seranan-tsambo dia mitaky arak izany fivezivezena maro amin ny làlana avy any amin ny toeram-pitrandrahana mankeny amin ny toerana hanaovana ny famindrana eny amin ny reniranon i Fiherenana, izay atahorana hisy akony fanampiny amin ny fisian ny fantsomben ny CML mamakivaky ny ambany ranomasina sy ny honko, ary ny fitomboan ny fahafatesan ny biby mandritra ny fotoam-pitrandrahana, nohon ny fitomboan ny filana fitaterana amin ny làlana. Noho io antony io, dia tsara kokoa ny fametrahana ny USM eny amin ny toeram-pitrandrahana (safidy 1). Ny tombana notontosain ireo manam-pahaizana mikasika ny biby dia nandalina kokoa ny fiantraika mianjady amin ny fampiasana ny tany, ny toeram-pitrandrahana ary ireo foto-drafitrasa mifanindran-dàlana aminy toy ny làlana sy ny fefiloha vato. Niainga tamin ny vokatr io tombana io, dia ireto no toro-marika naroso: Mba hialana amin ny fiantraika mitohy eo amin ny tontolo iainana, indrindra ho an ireo toera-pivelomana marefo, dia tsara ity tetikasa ity sy ny tetikasa hafa manodidina raha ampidirina ao anaty rindran-damin ny faritra iarahana amin ireo manam-pahefana malagasy misahana ny fiarovana ny tontolo iainana; Tokony atao hatrany izay tsy hisian ny fahavoazana mihatra amin ireo toeram-ponenan'ny biby noho ny fandinihina ankehitriny na ny ho avy sy noho ny fandaminana ny toerampitrandrahana. Hiha hanan--danja kokoa izany rehefa vita ny làlana vaovao satria hitondra indray ho any amin ny fandringanana haingana ireo harena (ny fanamboarana arina fandrehitra ohatra); Heverina fa ilaina ny fametrahana aro afo manodidina ny foto-drafitrasa rehetra; fanampin izany, tokony atao ny fambolena zava-maniry zanatany, fohy nefa mahatanty afo mba iarovana ny fahalanian ny tany na ny fahasimban ny ny làlan ny fivarinan ny rano; Ny fivarotana na fampiasana ny zavatra tsy maharitra nalaina (ohatra ny arina fandrehitra noloarana tao amin ny toerana tsy nodiovina noho ny fitrandrahana) dia voarara ao amin ny toerana rehetra misy ny fitrandrahana; Ny fanabeazana ara-tontolo iainana ny mponina manodidina dia tokony hanamafy ny fiantraika ratsy sy tsy tanty vokatry ny fandripahana mitandavana ala kely mivondrona, ny fampiasana diso tafahoatra ny hazo hanaovana arina fandrehitra, ary ny fampiasana ny afo tsy amin ny antony enti-manavao ny kijana iraofan ny biby fiompy. Fandinihana ny fomba sy toetran ny trondro Na dia tsy mandavataona aza ny fikorinan ny reniranon i Fiherenana amin ny ampahan ny morontsiraka mandritra ny main-tany, dia mitahiry trondro mpifindrafindra izy izay mandrafitra betsaka ny andavanandron ny jono. Io fomba fampiantoana ara-pizaran-taona, izay mitovy any amin ireo renirano any atsimo andrefan I Madagasikara, dia anisan ny nahatonga ny isan ny trondro misy ao amin izy ireo ho vitsy ary anjakan ny trondro an-dranomasina mpifindra monina. Ny mety ho fiantraikan ny tetikasa fitrandrahana harena an-kibon ny tany Ranobe eo amin ireo tontolo mivelona anaty rano sy ny zava-manan aina dia arakaraka ny fametrahana ireo fotodrafitrasa vaovao (fefiloha, rarivato) eny amin ny fanambanin ny reniranon i Fiherenana, izay hitaterana ireo voakatra voatrandraka ho eny amin ny fefiloha vato vaovao. Anisan ireo fiantraikany ireo koa ny fitomboan ny atsanga sy ny mety fahalotoan ny rano amin ny faritra midina manaraka ny renirano ary ny tsy hahafahan ireo trondro mpisava làlana miakatra ny renirano, toy ny amalona sy ireo hazan-drano misy akorany (patsa sy foza). Raha tsy misy fepetra fampitoniana dia tombanana ho anisan ny manana ny halehibeny ireo fiantraikany ireo. 17

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY MINISTERAN NY FAMBOLENA NY FIOMPIANA ARY NY JONO ----------------------------------- REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana ---------------------------------- MINISTERAN NY TOEKARENA

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA TATITRA ANIVON NY ANTENIMIERAM- PIRENENA Praiminisitra Jean RAVELONARIVO 1 TATITRA MANOLOANA NY ANTENIMIERA I 21 MAY 2015 21 MAY 2015 Andininy 54.- Ny Filohan ny Repoblika no manendry ny Praiminisitra

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

Évaluation de l impact environnemental et social

Évaluation de l impact environnemental et social RÉPUBLIQUE DE MADAGASCAR Tanindrazana - Fahafahana - Fandrosoana PRÉSIDENCE PROJET PÔLE INTÉGRÉS DE CROISSANCE Secrétariat National Évaluation de l impact environnemental et social Cadre de politique de

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar HUMBOLDT-UNIVERSITÄT ZU BERLIN Landwirtschaftlich-Gärtnerische Fakultät Schriftenreihe des Seminars für Ländliche Entwicklung VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA Public Disclosure Authorized a REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana JIRAMA JIRO SY RANO MALAGASY E1 403 VOL. 1 Public Disclosure Authorized Public Disclosure Authorized ÉVALUATION

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville

SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville TOERANA ALEHA FIAINGANA ZOTRA RAISINA DESTINATION DEPART TANA LIGNE A PRENDRE A Ambohitrapeto Isotry D Itaosy Itaosy

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Ventin-kevitra Matoan-dahatsoratra Fampahafantarana an i Madagasikara 4 Ny Nosy Telma, mpandraharaha nasionaly manara-penitra iraisam-pirenena

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

PROJET DE LOI N 027/2007

PROJET DE LOI N 027/2007 REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PROJET DE LOI N 027/2007 DU 25 OCTOBRE 2007 PORTANT LOI DE FINANCES POUR 2008 IMPRIMERIE NATIONALE 2007 - 2 - PROJET DE LOI N 027/2007 PORTANT

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

LANY TAMINGANA ETO AMINTSIKA

LANY TAMINGANA ETO AMINTSIKA cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent cyan magenta jaune noir PROGRAMME P.7 RENCONTRE DE VONTOVORONA POSSIBLE ECHEC Les partis et associations de GRATUIT QUOTIDIEN D INFORMATION N 0137 DU Mercredi 25 Août 2010 FIARAHAMONINA HADIHADIANA NY

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

MpANAMORY RAdO RABARILALA

MpANAMORY RAdO RABARILALA ENIM-BOLANA TSY TAFATSANGANA FANJAITRA MIISA 21 NO NESORINA TAO AN-KIBON i LALAINA P.06 N 3190 L u n d i 2 9 j u i n 2 0 1 5 PRIX : Ar 400 zatovolahy NANGALATRA volamena P.06 TENY AM-pASANA : NANONOFY

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

d une solution malgachomalgache

d une solution malgachomalgache cyan magenta jaune noir PROGRAMME P.7 ECONOMIE TRANSITOIRE FANANAN-TANY DECHETS URBAINS Interventionnisme critiqué BIRAO FOTOTRA A VALORISER L inaccessibilité aux intrants notamment aux engrais induit

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

LALANA LAHARANA FAHA2005-029

LALANA LAHARANA FAHA2005-029 REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA LALANA LAHARANA FAHA2005-029 TAMIN NY 29 DESAMBRE 2005 MOMBA NY LALANA MIFEHY NY FITANTANAM-BOLAM-PANJAKANA AMIN NY

Plus en détail

DISPOSITIONS COMMUNES

DISPOSITIONS COMMUNES ORDONNANCE N 62-074 du 29 SEPTEMBRE 19 62 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics. ( J.O. n 248 du 12.10.62 p. 2248 ) modifiée et complétée

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

FANILO MIAMPITA. TÉLÉPHONIE FIXE La honte. Encore sous le monopole Après le drame libanais, voilà que resurgit

FANILO MIAMPITA. TÉLÉPHONIE FIXE La honte. Encore sous le monopole Après le drame libanais, voilà que resurgit cyan magenta jaune noir PROGRAMME P.7 L accès sans peine à l information QUOTIDIEN D INFORMATION GRATUIT N 080 DU Vendredi 18 Juin 2010 AFFAIRE LILA FANILO MIAMPITA TÉLÉPHONIE FIXE La honte TONGA NY ORA

Plus en détail

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE -----------------------

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- MINISTERE DES TRANSPORTS ET DE LA METEOROLOGIE -------------- RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- I. CONTEXTE Malgré

Plus en détail

M o t d u P rov i n c i a l Temps de grâces

M o t d u P rov i n c i a l Temps de grâces Mot du Provincial Temps de grâces Plusieurs événements de la province et de l Église à Madagascar constituent nos sources d action de grâce à adresser au Seigneur. La visite fraternelle et édifiante du

Plus en détail