NY FIRAISANKINA NO HERY

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "NY FIRAISANKINA NO HERY"

Transcription

1 ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY

2

3 L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika antsika handroso amin ny fampiharana andavan andro ny BPH, ny nahazoan-tsika ny fiantohana HACCP sy ny mbola nanavaozana izany dia nanome ainga indray ny lamin asan-tsika, ampy ve izay anefa? TSIA, ny fahazarana andavan andro dia isan ireo mitarika risika, ka noho izany indrindra, izay afaka vakin-tsika ao amin-ny takelakin ny departemanta HSE fa tena manery ny ekipa rehetra mba ihazonana ny lentan - ny mpiara-miasa. Mampatsiahy ireo zavatra tena ilaina vitsivitsy amin ny BPH ny tenako eto Ny fitsipika arahina eo ampibatana ny vokatra ara-tsakafo, manomboka hatrany amin ny toeram-pamokarana ka hatrany amin ny fotoana hanjifana azy,mamaritra ny kalitaon ny sakafon tsika izany Ireo fomba fanao ankapobeny mikasika ny fahadiovana ara-tsakafon ny «codex Alimentarius» dia mamaritra ireo fitsipika fototra mba ikirakirana, itehirizana, anodinana, itsinjarana ary farany ny anomanana ireo vokan tsika amin ny ambaratonga ny tohilany famokarana ara-tsakafo. Voakasik io avokoa ny departemanta rehetra tsisy ankanavaka: Ny Sampana teknika, izay mijery manokana ireo izay tsy maintsy atao mifanaraka amin ny fananganana ireo foto-drafitr asa, eo amin ny fanamboarana sy ny fanatsarana. Bonnes pratiques d'hygiène (B.P.H.) rehetra: physico chimiques sy bactériologiques, isakin ny sampan samihafa. Ny departemanta HSE, ny fahadiovan ny mpiasa sy ny fampiofanana ireo mpiasa. Ny fampiharana mahomby ny fahadiovana dia tafiditra ao anatin ny sehatra ara-pitantanana ny aroloza ara-pahasalamana ny sakafo, aisan izany ny système des points de contrôle critiques pour l analyse de risqué (HACCP) ny vokatra vokarin-tsika. Ao anatin ny orin asa, hitan-tsika ireo fampiharana mahomby ireo fa toy ny mpitarika sy fanampim-piofanana. Ny tena zava-dehibe dia ny fazahoana fa ny fitsipikin ny fahadioavana no loha-laharana ato anatin ny rafitra misy antsika. Ny fahafahana manamboatra ny fitondrantena sy ny fahaiza-manao eo amin ny asa mba hananana antoka ho ara-pahasalmana Raha fintinina : Ny fampiharana eny ifotony no tena fomba mahomby Ny fanarahana ny fampiasana ny fitsipikin ny fahadiovana Ny fanajana ny fampiharana mahomby ny famokarana sy ny fahadiovana Fanasana tanàna, ny fomba fitafiana sy ny fitondran tena eo ampiasana Ny Departemanta ny kalitao, ny fanarahamaso ny asa famokarana sy ny fitsinjarana (tafiditra ao anatin izany ny hafanana, ireo akora fototra, izay iarahana miasa amin ny tompon andraikitry ny magazay), ireo antontan-taratasy ny asa fampatsiahivana. Ny fandraisana ny akora fototra sy ny famonosana azy, ny fanajana ny hafanana, ny fanajana ireo DLC, DLUO Famehezana ny fampiharana mahomby ny fanadiovana sy ny désinfection» Ny laboratoara,ny fanaraha-maso ny famatsiana rano, ireo fitiliana Nosoratan i / Ecrit par Philippe PENOUTY (Tale Jeneraly / Directeur Général)

4 Bonnes pratiques d'hygiène (B.P.H.) La non amélioration dans le pays de l environnement sanitaire, nous amène à développer au quotidien nos bonnes pratiques d hygiènes, notre certification HACCP et son renouvellement nous conforte dans notre organisation, cela est-il suffisant? NON, les habitudes du quotidien sont un facteur de risque, c est pour cela, comme vous pourrez le lire dans l article du service HSE, nous maintenons une forte pression sur nos équipes pour garder l ensemble de nos collaborateurs à niveau. Je rappellerai ici quelques fondamentaux des B.P.H. Ils fixent un certain nombre de grands principes (principe de recours à l analyse des risques par les autorités compétentes, principe de précaution, principe de transparence, principe d innocuité ) et définit des obligations spécifiques à tous les intervenants : obligation de traçabilité, obligation de retrait de produits susceptibles de présenter un risque pour la santé publique, obligation d information des services de contrôle. Ces grands principes se retrouvent dans tous les départements de notre entreprise. Les conditions de manutention des produits alimentaires, depuis le lieu de production jusqu'au moment de leur consommation, déterminent la qualité de notre nourriture. Les principes généraux d'hygiène alimentaire du Codex Alimentarius définissent les règles fondamentales pour manipuler, stocker, transformer, distribuer et finalement préparer tous nos produits aux divers stades de la chaîne de production alimentaire. Tous les services sont concernés avec le même niveau d implication : Services Techniques, Ils spécifient les impératifs relatifs à la conception des installations, à l'entretien et l'assainissement, Sommaire EDITORIAL P.3 /P.4 COMMERCIAL P.5 DIRECTION D USINE P.6/P.7 DIRECTION QUALITE P.8 RESSOURCES HUMAINES P.9 COMMUNICATION INTERNE P.10 Edité par SOCOLAIT S.A Route Mandaniresaka Antsirabe 110 MADAGASCAR Directeur de publication: Philippe PENOUTY Département qualité, les contrôles des opérations de fabrication et de distribution (y compris la température, les matières premières, en collaboration avec les responsables magasins). En collaboration étroite avec le département logistique/distribution l organisation de la traçabilité, la gestion des retraits de produits si besoin est. Le laboratoire, le contrôles de l'approvisionnement en eau, toutes les analyses : physico chimiques et bactériologiques, dans les différents services. Le département H.S.E. l'hygiène du personnelle et la formation des employés. Les bonnes pratiques d'hygiène font partie intégrante de notre système de gestion de la sécurité sanitaire des aliments, dont le Système des points de contrôle critiques pour l'analyse des risques (HACCP). Dans l entreprise, nous trouvons ces bonnes pratiques sous forme de guide et de support de formation. L important c est de comprendre les règles d hygiène essentielles dans notre structure. De pouvoir adapter ses comportements et méthodes de travail en vue d assurer la sécurité sanitaire de tous nos produits En conclusion : La pratique sur le terrain reste la meilleure approche Suivi de l application des règles d hygiène Le respect des bonnes pratiques de fabrication et d hygiène Lavage des mains, la tenue vestimentaire et les comportements au travail. La réception des matières premières et leur conditionnement, le respect des températures, le respect des DLC, DLUO Maitriser les bonnes pratiques de nettoyage et de désinfection. Comité de rédaction: David De La Fuente, Vincent Lucas, Rosa Andriamifidy, Hanitriniaina Raveloarimino, Emmanuelle Rasoarahona Ont collaboré à ce numéro: Marina Ramandaniarivo, Miora Rakotoarivony Crédit photos: Socolait, Source internet Régie Publicitaire: SOCOLAIT 3ème étage Imm. DIGITAL Ivandry Antananarivo 101 Tél.: Impression: Print Express Nombre d exemplaires: 350 Rédacteur en chef: Doria GIZY

5 Ny tsenan ny ronono mandry mamy dia nivoatra be nohon ny fahatongavan ireo vokatra avy any ivelany, izay sokajina ao anatin ny creamer izay ankafizin ny mpanjifa Malagasy noho izy ireo mora vidy. Miambina hatrany ny fivoaran ny tsena, Socolait dia nanararaotra izany ary namokatra ny marika kaoatry izay misokajy creamer ary afaka mifanina tsara amin ireo vokatra avy any ivelany. Ny anarany Kaoatry, izay tenin-jatovo midika Kafé, ary ny fonosany izay nalaina tahaka avy amin ny kopy gasy, ny marika Kaoatry dia tena ankafizin ny mpanjifa Malagasy. Ny kaoatry dia tsy misaraka tokantrano Malagasy ary mitondra ny vitamine: A, B sy D3 rehefa fotoana fisotroana kafé sy dité. Ny famerenana ny kaoatry teny an-tsena dia tena nandrasan ny mpanjifa Malagasy tokoa ary ny vokatra lafo dia nihoatra lavitra ireo vinavinan ny orin asa ary izay indrindra no niteraka fahatatapahana kely teo amin ny fitsinjirana herinandro vitsivitsy tao aorina ny fiverenany teny an-tsena. Fametahana afisy teny antsena izay nametraka ny marika vita malagasy izay nanome fahatokisana ny mpanjifa ary ireo fanentanana ara-barotra no nanamafy ny fiverenan ny kaoatry teny antsena. Amin ny fitazomana ny kalitao, kaoatry dia tsy mitsahatra ny miakatra hatrany ary tsy mitrahatra ny mahazo anjara toerana eo an-tsena Ny fiverenan ny Kaoatry eny an-tsena La relance de Kaoatry Le marché du lait concentré sucré a évolué avec l arrivée en masse des marques imports de type «creamer» répondant aux besoins des consommateurs par son prix accessible. Restant en veille sur le marché, Socolait a saisi cette opportunité en lançant une nouvelle marque «Kaoatry» qui est un produit type «creamer» et qui pouvait concurrencer les marques imports. De son nom «Kaoatry», mot argot signifiant «Café», et de son packaging inspiré du «kopy gasy» (tasse malgache), la marque est très appréciée par les consommateurs malgaches. A l heure des boissons chaudes : du thé ou du café, Kaoatry accompagne les foyers malgaches en apportant des vitamines A, B et D3. La relance avec la nouvelle formule a été très bien accueillie par les consommateurs malgaches et les réalisations ont même dépassé les estimations de la société d où la micro-rupture après quelques semaines de lancement. Une campagne d affiche, au niveau des points de ventes, qui met en avant le «vita malagasy» pour assurer les consommateurs et des animations auprès des points de ventes ont accompagné la relance de Kaoatry. Avec la qualité maintenue, Kaoatry continue dans sa progression et continue à s emparer des parts de marché prise par les marques imports. Ny antom-pisan ny Marketing Ny marketing dia ireo hetsika rehetra izay mitondra ny vokatry ny mpamokatra mankany amin ireo mpanjifa. Matetika adika ho dokam-barotra mandeha amin ny fahitalavitra sy onjam-peo, ny marketing dia mikasika ireo famaliana filana sy fanirin ny mpanjifa ary ny fivarotana ireo vokatra amin ny fepetra tsara indrindra ho an ny orin asa. Mivoatra ao anaty tsena feno fifaninana ary miatrika ireo mpanjifa izay manomboka hentitra, ny marketing dia tena ilain ny Socolait mba ahafahany mitazona ny toerana izay misy azy eny an-tsena. Ny marketing ho an ny Socolait dia manana andraikitra hitady ireo lalam-barotra tokony hidirana ary hitondra ireo fivoarana amin ny fanolorona vokatra mifanaraka amin ny filan ny mpanjifa Malagasy. Ny marketing dia miara miasa akaiky amin ireo departemanta rehetra eto amin ny orin asa. La nécessité du marketing Le marketing comprend toutes les activités qui dirigent les produits des producteurs au consommateur. Souvent définie par la publicité à la radio et à la tété, le marketing intervient à la satisfaction des besoins et des désirs des consommateurs et aussi à la commercialisation des produits dans les meilleures conditions de profit pour la société. Evoluant dans un marché concurrentiel et se trouvant face à des consommateurs qui deviennent exigeants, le marketing devient une nécessité pour Socolait pour garder sa place de leader dans son domaine. Le marketing pour Socolait a pour mission de trouver les bons segments à exploiter et d apporter des innovations en proposant des produits adaptés aux besoins des consommateurs suivant le contexte de marché malgache. Le marketing est en étroite collaboration avec les autres départements de la société. Nosoratan i / Ecrit par Vincent LUCAS (Tale Ara-Barotra / Directeur Commercial et Marketing)

6 QUALITE : La certification HACCP obtenue l année dernière reste chaque jour un challenge pour l équipe de SOCOLAIT. En effet, nous sommes fiers d avoir pu passer avec succès notre audit de vérification réalisé par SGS durant le mois de Juillet. Grâce à la collaboration active de chacun, SOCO- LAIT continue de gagner la confiance de ses consommateurs en démontrant, plus que jamais, son engagement d assurer la sécurité alimentaire de ses produits. Dans cette optique, afin d être toujours plus réactif, SOCOLAIT prévoit de moderniser son laboratoire l année prochaine. Responsable Audit : NOMENA ONITIANA Ny firaisankianan no hery mivohatra hatrany ny Socolait L union est la force Socolait est en progression KALITAO : Mijanona ho fanamby ho an ny ekipan ny SO- COLAIT hatrany ny certification HACCP azo tamin ny taona lasa. Noho izany, ampifaliana no nandraisana ny vokatra tsara no azo nandritra ny fanamarinana ny «audit» nataon ny SGS tamin ny volana jolay lasa teo. Nohon ny fifanampiana mavitrika nataon ny tsirairay, tsy mitsahatra mahazo ny fahatokisan ny mpanjifa amin ny fampisehoana, mihoatra ny taloha, ny finiavana hanome ny aro voina ara-tsakafo ny vokatra. Ao anatin izay tanjona izay, ary mba hanome ny tsara hatrany, SOCOLAIT dia maminavina laboratoara moderna anin ny taona ho avy. HSE : Une collaboration gagnante : La santé du personnel conditionne le travail et l hygiène. C est pour cette raison que nous sommes en collaboration très étroite avec le service médical SMIA. Ces interventions ont été menées par le Médecin Directeur Alain KAPISY et son équipe. En effet, ils assurent des formations et des sensibilisations au sein de notre usine en ce qui concerne maladies transmissibles, la qualité bactériologique des repas de la cantine, et les suivis rigoureux de la santé du personnel. Nous accordons une vigilance particulière à la santé des nouveaux entrants (nouvel employé, stagiaires, visiteurs) afin de garantir la salubrité de nos produits. HSE : Fiaraha-miasa mamokatra: ny fahasalaman ny mpiasa no antoky ny asa sy ny fahadiovana. Izany no antony iarahana miasa akaiky amin ny SMIA. Io fiaraha-miasa io dia nataon ny Dokotera Tale Alain KAPISY sy ny mpiaramiasa aminy. Izany hoe, nanao fanentanana sy fampafantarana teto anivon ny orinasa mikasika ny areti -mifindra, ny «qualité bactériologique» amin ny sakafo ao amin ny trano fisakafoanana, ary fanaraha-maso ny fahasalaman ny mpiasa. Mandray fepetra matotra kokoa ho an ireo olona vaovao vao hiditra ato amin - ny orinasa (mpiasa vaovao, mpiofana arak asa, mpitsidika) mba hafahana manamafy ny dion ny vokatra. Coordinatrice HSE : Rachel RAZAFIMAHENINA COLLECTE : L appuis de proximité des techniciens avec les collecteurs apporte qualité et volume. Formation et suivis sur terrain entre nos techniciens et collecteurs jusqu'aux éleveurs de la région du Vakinankaratra est notre quotidien pour garantir notre niveau de collecte de lait frais. FANANGONANA RONONO : Ny fanampian ireo teknisianina akaiky ireo mpanangona ronono no ahafahana mahazo kalitao sy fatra ambony. Fampiofanana sy fanaraha-maso any an-toerana an ireo teknisianina sy mpanangona ronono ary hatrany amin - ny mpiompy ny faritra Vakinankaratra no atao isan andro mba ahazaona manangona ronono izay tsara indrindra. Actuellement nous mettons à dispositions des VTT équipés de bidons alimentaires pour les pré-collecteurs Technicien de collecte: ERICA VEROMALALANIRINA eny ifotony. Ankehitriny, omena VTT misy «bindons alimentaires» ny mpanangona ronono

7 TECHNIQUE : En constante amélioration, nous collaborons avec SMEF qui a remplacé le groupe froid par un accumulateur de glace afin le maintenir la croissance de nos volumes de lait frais en parallèle d autres activités avec une température constante de 4. L isolation des conduites de froid nous permettent d optimiser le cout du fonctionnement. Un nouveau poste a été créé pour optimiser le fonctionnement du département : Gestionnaire technique assuré par ROBENE Hery Setra ingénieur en génie industriel. Responsable Technique : José RAKOTOHASIMBOLA TEKNIKA : Mba ho fanatsarana hatrany, niara-niasa tamin ny SMEF isika izay nanolo ny «groupe froid» ho «accumulateur de glace»mba hitazomana ny fiakaran ny fatran ny ronono, na dia misy asa hafa miara-miodina aza ka ahazoana maripana 4 hatrany. Ny fitazomana ny maripana ambany dia mananpy antsika amin ny fampidinana ny saran ny fampandehanan-draharaha. Asa vaovao no noforonina mba handrindrana ny fomba fitantanana ao amin ny departemanta : «Gestionnaire technique» izay iandrekatan i Andriamatoa ROBENE Hery Setra «ingénieur en génie industriel». PRODUCTION : FAMOKARANA : La ligne de conditionnement de la yaourterie a été modifiée par la mise en place de tableau de pontage et l élimination des angles à 90 des tuyauteries. Ceci facilite désormais les manipulations et permet l indépendance des cuves/machines. Il est actuellement possible d utiliser deux conditionneuses en parallèle afin d augmenter par 2 notre capacité de production. Il est également constaté une nette amélioration de la texture de nos produits. Trois équipes sont assignées à la production 7/7jours tout en assurant leur repos durant 48h. Depuis peu, OKE est sur le marché. C est une boisson lactée enrichie en vitamines et minéraux à conseiller aux sportifs et aux adolescents. D autre part, la formule du KAOTRY, ayant fait l objet d études et recherches approfondies, a été innovée. Il est à présent plus onctueux avec un goût mielleux inégalable. L utilisation de sleeve intégrale sur le OKE et bientôt sur le Yao garantie la protection du consommateur et l inviolabilité des produits. Directeur de production : Mamy ANDRIAMBOAVONJISOA Nohavaozina ny «ligne de conditionnement» ao amin ny famokarana yaourta amin ny alalan ny fametrahana ny «tableau de pontage» sy ho fanafoanana ny zoro 90 ny fantsona rehetra. Izany dia nanamora ny fikirakirana sy ny fitokanan ny milina. Ankehitriny dia afaka ampiasaina miaraka ireo milina famonosana mba apitombo roa hehy ny taham-pamokarana. Voatsikaritra ihany koa ny fahatsarana hatrany ny vokatra. Ekipa 3 no miara-miasa ao amin ny famokarana 7 andro isan-kerinandro ary manana fakana aina 48 ora avy ny mpiasa. Vao haingana izay dia efa hita manerana ny tsena ny OKE. Zava-pisotro vita avy amin ny ronono izay be vitamina sy mineraly tsara ho an ny mpanao fanatanjahantena sy tanora izy io. Ankoatr izay koa dia nanaovana fikarohana manokana ary noavaozina ny fomba fanaovana ny KAOA- TRY. Ankehitriny dia tsapa fa nihatsara ny tsirony. Ny fampiasaina ny etikety feno amin ny OKE sy amin ny Yao atsy ho atsy dia manamafy ny fiarovana ny mpanjifa sy ny fiarovana ny vokatra amin ireo mpaka tahaka. L USINE : Elle vie au quotidien de manière naturelle la certification HACCP, le management MHG Europe, la performance et le résultat. Ces deux dernières années ont nécessités courage et force de toutes les équipes pour accomplir la Socolait d aujourd'hui. «second de personne» NY ORINASA : Iainany amin ny andavanandrony ny «certification HACCP», ny «management MHG Europe», fahaiza-manao ary ny vokatra. Tao anatin ny 2 taona izay dia nilaina ny faherezana sy ny herin ny ekipa rehetra mba nahatonga ny Socolait tahak izao. «second de personne» Cette culture se ressent en interne par l envie du progrès et en externe par la fidélité et nos nouveaux consommateurs croissants. Nosoratan i / Ecrit par David DE LA FUENTE (Talen ny Ivo-Toerana / Directeur d Usine) Izany toen-tsaina izany dia tsapa ato anatin ny orinasa amin ny alalan ny finiavana te-hivoatra ary amin ny alalan ny fitiavana sy fitomboan ny mpanjifa.

8 DINGANA LEHIBE AMIN NY FAMPANDROSOANA NY FAHAIZA-MANAON NY MPIASA Arakaraka ny fandrosoan ny fahaizan ny mpiasa no mampatanjaka ny orinasa Ho fanatsarana hatrany dia manao zava-dehibe ny fahaizan ny mpiasa ao aminy ny orinasa SOCOLAIT. Aminy, ny fitambaran ny fahaizan ny mpiasa tsirairay no tanjany. Nanomboka tamin ny ity taona 2015 ity ny orinasa dia nametraka ny atao hoe GPEC, na fomba fitantanana ny asa sy ny fahaizana araka asa manomana ny ho avy. Izy io dia fitaovana hahafahana mitsimbina sy mampifanentana ny zava-misy ankehitriny sy ny tiana hotratrarina eo amin ny lafiny asa, isan ny mpiasa ary fahaizana araka asa. Araka izany dia mijery lavitra kokoa io fomba fitantanana io mba hahafahana miatrika ny toe-javatra maro mety hisy fiantraikany amin ny fitantanana ny mpiasa (fandehanana misotro ronono, fahafatesana, fandroahana, sns) sy ny fahaiza-mamokatry ny orinasa. Fanaovana tombana ny fahaizan ny mpiasa no dingana voalohany amin ny GPEC, izay hahafahana: Mijery ny mety sy izay tokony hatsaraina Mamantatra ireo fiofanana mifanaraka amin ny filàn ilay mpiasa Mamantatra ireo fahaiza-manokana izay mbola azo trandrahina Mamantantra ireo mpiasa afaka misondrotra na mifindry asa vaovao Fomba fiasa roa no natao hahafahana manatanteraka izany, fanadinana an-tsoratra ny voalohany hamantarana ny fahalalana sy ny fahaiza-manao ara-teknika. Ny faharoa kosa dia fihaonana mitokana hahafahana mifampiresaka sy mifanakalo hevitra momba ny asa amin ny ankapobeny sy izay mety ho vina araka asa. Io fotoana io ihany koa ho hahafahana mijery ireo fiofanana tokony homena azy sy izay mety fivoarana na koa fiovan asa kasainy. Aorian ireo dingana ireo dia misy ny tatitra atao, eo ihany koa drafi-piofanana sy ny fanondrotana anatiny raha ilaina izany. NY FANOMBANANA NY FAHAIZANA ARAKA ASA L EVALUATION DES COMPETENCES, ETAPE CRUCIALE DU DEVELOPPEMENT DES RESSOURCES HUMAINES Plus les salariés développent leurs compétences, plus l entreprise est forte sur son marché Dans le cadre de sa démarche d amélioration continue, le développement des compétences de ses ressources humaines se trouve au centre des préoccupations de la SOCOLAIT. Pour elle, la force de l entreprise est égale à la somme des compétences des salariés. Depuis cette année, la société met en place la GPEC (Gestion Prévisionnelle des Emplois et des Compétences), un outil de prévention et d adaptation, qui lui permettra de réduire l écart entre la situation actuelle et la situation souhaitable en termes d emplois, d effectifs et de compétences. La GPEC permet ainsi de passer d une vision à court terme à celle à moyen ou long terme, afin d éviter des surprises par des événements pouvant avoir une incidence sur la GRH (retraite, décès, licenciement) et la productivité de l entreprise. La première étape de la GPEC consiste à évaluer les compétences des salariés. Cette étape permet ainsi de : Faire un bilan sur les points forts et les points à améliorer Déterminer les besoins futurs en formation Détecter les potentiels des équipes Identifier les talents pour la mobilité interne Afin de mener à bien le processus, la méthode utilisée s effectue en deux étapes, dont la première consiste à faire faire des tests écrits qui permettent d évaluer les connaissances et le savoir faire techniques liés au poste. Puis, la deuxième étape concerne l entretien individuel, qui est un moment d échange et de dialogue permettant de faire le point avec le salarié sur son activité professionnelle, ses compétences et penser à son parcours professionnel. C est aussi l occasion de formaliser ses besoins en formation, ses souhaits d évolution, de changement de poste, etc. A partir des résultats, un rapport d évaluation et un plan d actions sont élaborés, notamment le plan de formation et la proposition de promotion interne le cas échéant. FAHATERAHANA/ NAISSANCES NY AINA Mannuely Fenosoa (ANDRIAMANANTENA Harifidy)/ SAFIDINIAINA Mitantsoa Hirah (RABEARISOA Tahina Aimé) / FELANIAINA Safidiniriantsoa Nekena (RAFENOMANANA Fidélis)/ RABEHANITRINIONY Mialisoa Lalie Midget (ANDRIANARILALA Midget) Nosoratan i / Ecrit par Marinà RAMANDANIARIVO (Tompon'Andraikitry ny sampana RH / Responsable RH)

9 Laharana faha10 izao ny SOCO SERA SOCO'SERA N 10 Raha vao nanomboka ity gazetibokintsika ity dia resy lahatra isika fa ny serasera anatiny dia singa fototra miantoka ny fahombiazan ny orinasa iray na inona sehatra misy azy na aiza firenena ivelarany.ny endrikin ny drafitra ireo toerana misy ny orinasantsika koa moa dia manery antsika amin io filana serasera anatiny io. Laharana faha 10 sahady izao ny SOCO SERA ka ny fiverenana mamaky ny laharana tsirairay dia ahafahantsika manao jery todika ny dingana rehetra nandalovantsika nandritra izay 2 taona izay.raha jerena hatrany amboalohany dia nitombo sy nihatsara hatrany ny mpiaramanantontosa sy ny kalitaon ny lahatsoratra anatin ity gazety bokintsika ity.ny sampanasa tsirairay afaka namelabelatra ny fomba fiasany,ireo fanamby napetrany ary indrindra ny fomba nentiny handrosoana sy hivoatra hatrany. Lorsque nous avons lancé ce journal interne, nous étions convaincus que la Communication Interne est un élément déterminant dans la réussite d'une Entreprise, dans quelque secteur d'activité ou dans quelque pays elle soit. Notre organisation spatiale renforçait ce besoin. Nous en sommes actuellement au 10ème numéro de SO- CO'SERA. Une relecture de chaque numéro permet de faire une rétrospective des étapes que nous avons franchi depuis un peu plus de deux ans. Depuis le lancement, le nombre de contributeurs et la qualité des articles ont continuellement augmenté. Et plusieurs départements ont pu exposer leur travail, les défis qu'ils relèvent, et les moyens qu'ils mettent en œuvre pour réussir. Tao koa ireo hafatra napetrakin ny mpitantana noezahina nampitain ny SO- CO SERA.Tanatin ny laharana voalohany dia efa napetraka ireo soatoavina iainan ny orinasantsika :ORINASA MITSINJO NY MAHAOLONA,FANAJANA NY MA- HAIANAO ANAO, FAMORONANA MANKANY AMIN NY TSARATSARA HA- TRANY.Ka dia mifantoka manodidina ireo ny paikady rehetra nentina niasana :natao nanara-penitra ny ozinina,naka fiantohana HACCP sy fenitra ISO 22000,hamafisina ny fanagonana ny akora fototra,hatsaraina sy hitarina ny resaka lojistika sy marketing,hampiharina ny GPEC amin ny fitantanana ny mpiasa sy ny asany.nazava izany ny drafi-pitantanana sy ny fomba fiasa teto amin ny orinasa. Ny fandrindrana ny laharana tsirairay navoaka dia asa tena nanahirana tao ny sakana ara-teknika,ny olana amin ny fandrindrana kanefa na izany aza dia azo lazaina fa tafita sy nivoatra ity gazety bokintsika ity. Les messages de la Direction ont été véhiculés dans SOCO'SERA. Les valeurs qui sous tendent toutes nos actions ont été partagées dès le premier numéro : ENTRE- PRISE CITOYENNE, ETHIQUE et INNOVA- TION. Les axes de travail ont été annoncés et mis en œuvre : mise aux normes de l'usine, Certifications HACCP et ISO 22000, renforcement de la Collecte, développement de la logistique, développement marketing, gestion prévisionnelle des emplois et compétences... Notre organisation et nos règles de fonctionnement ont été exposés. L'élaboration de chaque numéro de SOCO'SERA a été laborieuse. Les difficultés techniques et organisationnelles ont été nombreuses. Les axes d'amélioration existent. Il reste que les personnes suivantes méritent un hommage particulier pour leur implication dans la réussite de chaque numéro: RASOARAHONA Emmanuelle, RAVELOARIMINO Hanitriniaina et ANDRIAMIFIDY Rosa. Merci à vous. Ireto olona manaraka ireto dia tsara raha tolorana fisaoarana manonkana eto tamin ny fandavantenan izy ireo teo ampanatontosana ny famoahana izay gazety boky SOCOSERA 10 izay ka nahatomombana tsara izany : RA- SOARAHONA Emmanuelle, RAVELOARIMINO Hanitriniaina et ANDRIAMIFIDY Rosa. Mankasitraka tompoko. Nosoratan i / Ecrit par Doria GIZY (Talen ny Fitantanana sy ny Ara-bola / Directeur Administratif et Financier)

10 Quiz sur le yaourt 1 - Quel est le principal ingrédient du yaourt? a) Le lait b) L'eau c) La crème 2 - Combien de types de ferments ajoute-t-on au lait pour obtenir un yaourt? a) 1 type de ferment b) 2 types de ferments c) 3 types de ferments 3 - A la maison, où le yaourt doit-il être conservé? a) Au réfrigérateur b) Dans le placard c) Dans le congélateur 4 - A quelle famille alimentaire appartient le yaourt? a) La famille des produits laitiers b) La famille des fruits et légumes c) La famille des céréales, pains, féculents 5 - Quelle quantité de produits laitiers est recommandée par jour? a) 1 produit laitier par jour b) 2 produits laitiers par jour c) 3 produits laitiers par jour 6 - Quel minéral apporté par le yaourt est essentiel à la solidité des os? a) Le fer b) Le calcium c) Le potassium Les bonnes réponses du quiz sur le yaourt Question 1: La bonne réponse est la «A». Le principal ingrédient du yaourt est le lait. Les ferments qui lui sont ajoutés permettent d obtenir du yaourt. Question 2: La bonne réponse est la «B». Deux types ferments sont ajoutés au lait pour obtenir du yaourt. Ce sont toujours les mêmes et il n est pas possible de les changer. Question 3: La bonne réponse est la «A». Le yaourt est un produit frais fragile. Il est nécessaire de le conserver au réfrigérateur. Question 4: La bonne réponse est la «A». Le yaourt appartient à la famille alimentaire des produits laitiers. Question 5: La bonne réponse est la «C». La quantité recommandée par jour est de 3 produits laitiers. Question 6: La bonne réponse est la «B». Le minéral apporté par le yaourt essentiel à la solidité des os est le calcium

11

12

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg 0 UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA TATITRA ANIVON NY ANTENIMIERAM- PIRENENA Praiminisitra Jean RAVELONARIVO 1 TATITRA MANOLOANA NY ANTENIMIERA I 21 MAY 2015 21 MAY 2015 Andininy 54.- Ny Filohan ny Repoblika no manendry ny Praiminisitra

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar HUMBOLDT-UNIVERSITÄT ZU BERLIN Landwirtschaftlich-Gärtnerische Fakultät Schriftenreihe des Seminars für Ländliche Entwicklung VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY MINISTERAN NY FAMBOLENA NY FIOMPIANA ARY NY JONO ----------------------------------- REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana ---------------------------------- MINISTERAN NY TOEKARENA

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

RAPPORT DE FORMATION

RAPPORT DE FORMATION RAPPORT DE FORMATION CHANGEMENT DE COMPORTEMENT ET DE CARACTERE Dans la Lutte contre la Corruption Commune ANTSIRABE Région VAKINANKARATRA Organisation de la Société Civile Hotel IMPERIAL Antsirabe 20

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

Note pratique. Réseau PRATIQUES

Note pratique. Réseau PRATIQUES Note pratique Ny Herin ny hafatra / Le pouvoir des messages pour la santé préventive Expérience du programme de santé materno-infantile mené par Inter Aide à Farafangana, Madagascar Notice Type de document

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA Public Disclosure Authorized a REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana JIRAMA JIRO SY RANO MALAGASY E1 403 VOL. 1 Public Disclosure Authorized Public Disclosure Authorized ÉVALUATION

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

Évaluation de l impact environnemental et social

Évaluation de l impact environnemental et social RÉPUBLIQUE DE MADAGASCAR Tanindrazana - Fahafahana - Fandrosoana PRÉSIDENCE PROJET PÔLE INTÉGRÉS DE CROISSANCE Secrétariat National Évaluation de l impact environnemental et social Cadre de politique de

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

Le malgache. L exemple d une langue sans test

Le malgache. L exemple d une langue sans test Le malgache L exemple d une langue sans test 1. Pourquoi n existe t il pas de cer:fica:on? Peu d échanges commerciaux avec l extérieur Pas d immigra:on importante de «cols blancs» Peu d étudiants étrangers

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

PROJET DE LOI N 027/2007

PROJET DE LOI N 027/2007 REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PROJET DE LOI N 027/2007 DU 25 OCTOBRE 2007 PORTANT LOI DE FINANCES POUR 2008 IMPRIMERIE NATIONALE 2007 - 2 - PROJET DE LOI N 027/2007 PORTANT

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Ventin-kevitra Matoan-dahatsoratra Fampahafantarana an i Madagasikara 4 Ny Nosy Telma, mpandraharaha nasionaly manara-penitra iraisam-pirenena

Plus en détail

SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville

SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville TOERANA ALEHA FIAINGANA ZOTRA RAISINA DESTINATION DEPART TANA LIGNE A PRENDRE A Ambohitrapeto Isotry D Itaosy Itaosy

Plus en détail

La Gestion des talents entre dans une nouvelle ère

La Gestion des talents entre dans une nouvelle ère La Gestion des talents entre dans une nouvelle ère Tom Pfeiffer Partner Audit Deloitte Sacha Thill Senior Consultant Operations Excellence & Human Capital Deloitte Soucieuses du bien-être et du développement

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

hôtels cafés restaur ants tr aiteurs formation et conseil

hôtels cafés restaur ants tr aiteurs formation et conseil hôtels cafés restaur ants formation tr aiteurs et conseil 2015 Parce que la vie professionnelle est en perpétuelle évolution, parce l on ne peut pas se charger de tout, parce que la remise en question

Plus en détail

DATA CRUNCHING Cabinet d étude en marketing et sondage d opinion. www.datacrunching.co.ma

DATA CRUNCHING Cabinet d étude en marketing et sondage d opinion. www.datacrunching.co.ma DATA CRUNCHING Cabinet d étude en marketing et sondage d opinion 2015 www.datacrunching.co.ma 1 Agenda Présentation du cabinet Pourquoi nous? Métiers du cabinet Méthodologie & Outils Références significatives

Plus en détail

Référentiel de système de management SYSTEME DE MANAGEMENT DES ENTREPRISES D INSERTION (EI) ET/OU DE TRAVAIL TEMPORAIRE D INSERTION (ETTI)

Référentiel de système de management SYSTEME DE MANAGEMENT DES ENTREPRISES D INSERTION (EI) ET/OU DE TRAVAIL TEMPORAIRE D INSERTION (ETTI) Référentiel de système de management SYSTEME DE MANAGEMENT DES ENTREPRISES D INSERTION (EI) ET/OU DE TRAVAIL TEMPORAIRE D INSERTION (ETTI) sommaire 1 Préambule P. 4 2 Champ d application P. 6 3 Système

Plus en détail

Edition Juin 2015 Propriété de Charvet la Mure Bianco. 2 - Code de conduite

Edition Juin 2015 Propriété de Charvet la Mure Bianco. 2 - Code de conduite Code de conduite 1 Edition Juin 2015 Propriété de Charvet la Mure Bianco 2 - Code de conduite Sommaire CODE DE CONDUITE RESPECT - RESPONSABILITE - EXEMPLARITE Message du Président Qu est-ce que le Code

Plus en détail

«Rien n est permanent

«Rien n est permanent «Rien n est permanent sauf le changement» Pour nous contacter en France et à l étranger: Téléphone: +33 1 45 46 50 64 Télécopie: +33 1 71 33 10 32 Par courriel: contact@dfacto.fr Sur notre site rubrique

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

Vous cherchez une bonne boîte?

Vous cherchez une bonne boîte? RESPONSABLE DES VENTES SECTEUR Lidl recrute Vous cherchez une bonne boîte? + d infos sur www.lidl.fr Réinventons les métiers de la distribution! RÉINVENTONS LES MÉTIERS DE LA DISTRIBUTION! www.lidl.fr

Plus en détail