FOI et LUMIERE. FINOANA sy FAHAZAVANA

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "FOI et LUMIERE. FINOANA sy FAHAZAVANA"

Transcription

1 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara hanomboka ny taom-pianarana Dia hanohy ny fifampitaizana sy ny fifanakalozana traikefa indray,tahaka ny efa nataontsika nandritra izay 15 taona niarahana niaina teto amin ity gazety ity izay. Ny mahagaga dia mitombo isam-bolana ny mpamaky ny gazety (amin ny alalan ny mailaka indrindra indrindra).mitombo ihany koa (fa tsy isam-bolana akory) ny mpandray anjara mivantana eto amin ny gazety (manoratra, manome lahatsoratra, manome toromarika). Isan ny mivaingana nandritra izay fiaraha miaina teto amin ny gazety izay ny fahatsoran ny tsirairay rehefa manoratra aty aminay manome toromarika : tsy mibiloka ary tena am-pitiavana, tsy mati-kenamaso. Raisinay, ohatra, fanamarihan ny namana iray nilaza hoe : «aoka mba ho maromaro ny lahatsorata amin ny teny malagasy». Dia novalianay tsotra hoe : «ekena ra-havana saingy vitsy ny mandefa lahatsoratra amin ny teny malagasy». Afaka fotoana vitsivitsy taty aoriana tokoa, raha tsikaritrareo, dia nitombo ny lahatsoratra na fampianarana amin ny tenintsika teto. Ny tsikaritry ny namana iray indray dia ity : «tsy mba misy takila hoan ny tanora na hoan ny zanatsika ka tokony eritreretinareo». Marina dia marina io voalaza io ary dia manao antso amintsika izahay amin izao taom-pidirana izao. Arakaraka ny fahazoana taona tokoa no isintonana lesona sy ahitana ny lesoka mila fenoina. Eo izany isika izao ary raisinay am-pitiavana tokoa io fanamarihana iray io. Koa amin izao fanombohan ny taona izao, ndao hiezaka isika mba hanintona ny zanatsika hamaky ny gazetintsika. Iza no afaka hanampy anay amin izany? Manao antso aminao izahay satria izay tsy mahay sobiky, mahay fatram-bary. Izay ela izay tokoa isika tsy dia nihevitra loatra ( na nihevitra ihany fa tsy ampy) ny fanintonana ny tanora na ny ankizy hamaky gazety amin ny tenin-drazany. Nisy dia nisy ny lalaon-tsaina ho an ny ankizy tany aloha tany fa tsy naharaka ary tsy ampy hanintonana azy ireny izany.koa mba manontany ny hevitrao mpamaky izahay satria sady tsy ampy fitaovana no tsy ampy traikefa. Rehefa mitombo taona, hono, dia tokony hitombo fahendrena ihany koa na miha hendry Isan ny fahendrena lehibe ny fitsinjovana ny taranaka mba ho tonga olombanona ary hahatsangy no hary. Izany angamba no mahatonga ny namana voaresaka etsy ambony hanipy hevitra mikasika ny takila hoan ny tanora? Ndao hiezaka ho amin izany isika fa fahendrena tokoa izany rehefa tena alalinina. Raha tarafina akaiky mantsy ny fiainan ny tanora hoavin ny firenena ankehitrio, indrindra ny any an-tanindrazana, dia tsorinay fa tena mahalasa eritreritra : ho aiza ireo tanora rehetra ireo aoriana??? Afaka Firy taona vao ho tafarina ity firenena ity? Izany no Mensuel Editeur Responsable : Hery Rasoamanana. Rue A.Chif CHATELINEAU. ALAHADY 30 SEPTAMBRA 2012 Fanompoampivavahana sy Fandraisana Matoandahatsoratra Mitombo taona Mitombo fahendrena Manomboka amin ny Telo ora (15h) Eglise protestante de Bruxelles-Botanique (métro Botanique). Taomy ny namana mifanena aminao hiaraha hivavaka. ambetin-teny re etsy sy eroa, apetraky ny maro isaky ny misy adihevitra na fifanakalozana...aza miandry taona rey olona fa atomboy dieny izao any amin ny fianakaviana, any amin ny fikambanana. Tozoy ny ezaka hatrizay tany amin ny amin ny fiangonana na fokontany.aza mifanome tsiny fa raiso ny adidy tandrify anao. Ny erikerika no mahatonga tondradrano koa alao hery fa misy vokany ny hetsika madinika efa natombotsika. Mahery ny fanatontoloana nefa raha maharitra isika dia tsy ho very hasina ny maha malagasy antsika. Samy efa mahazoazo taona ny ankamaroantsika ary afaka nisintona lesona ny tsirairay. Arakaraka ny itombon ny taona, hono, no itombon ny fahendrena!(?) koa aza sasatra mampita amin ny tanorantsika sy ny zanatsika ny fitiavana ny tenindrazana. Vita iny ny fankalazana ny faha-25 taona niorenan ny MKMB. Betsaka ny lesona notsoahina satria nitombo taona ny fiombonana. Ny irina : mba voataratry ny hafa fa mitombo fahendrena ihany koa isika fa tsy ara-taona fotsiny. Eto am-pamaranana dia aoka ho tsaroana fa ny fahendrena ambony indrindra dia ny tahotra an Andriamanitra. Ampitao amin ny zanatsika izany ry havana dieny izao ary manantenà fa ho to ny kinasa rehetra amin ity taona ity. 1 H.R

2 FAMPAHEREZANA : «Mampihavana ny marina ny Tompo». (Marka 12 :28-34) Izany andinin-tsoratra masina izany ry havana dia azontsika fehezina tahaka izao : mampihavana ny mino amin ny tsara sy amin ny marina ny Tompo mba hahaizin ny marina (amarini ny Jesoa Kristy) amin Andriamanitra. Endrika telo no isehon ny fampihavanana ateraky ny hazofijalian I Kristy hahatonga fiadanana ho an ny kristiana 1 - Mampihavana antsika amin ny tsara ny Tompo. 2 - Mampihavana antsika amin ny marina ny Tompo. 3 - Mampihavana ny marina ny Tompo. I -Mampihavana antsika amin ny tsara ny Tompo : Iza no tsara ary inona ny marina? Jesoa Kristy eto no mamaly ilay mpanapaka manao hoe : Nahoana aho no ataonao hoe TSARA? Tsy misy tsara afa-tsy iray iahny dia Andriamanitra. Ary hoy koa ny mpanao Salamo : Sady tsara ianao (Jehovah) no mpanao ny tsara ; ampianaro ahy ny didinao. Jehovah izany no tsara, ary izay ataony no tsara. Ny fihavanana araka ny Baiboly izany ry havana dia ny fiadanana araka an Andriamanitra, izany hoe firindram-piainana ivelany sy fahavelomana anaty ateraky ny fianarana sy ny fiainana ny Tenin Andriamanitra. Io ilay fiadanana ambaran I Jesoa amin ny mino Azy : fiadanana no avelako ho anareo; ny fiadanako no omeko anareo; tsy tahaka ny fanomezan izao tontolo izao no fanomeko anareo ; aza malahelo na matahotra ny fonareo. (Jaona 14 :27) Ṙaha nanaotany an I Jesoa ny amin ny didy voalohany amin ireo didy 600 mahery ity olona manampahaizana momba ny làlana ity dia tsy nihambahamba Jesoa nilaza : mihainoa ry Israely ; Jehovah Andriamanitsika dia Jehovah iray ihany. Io fanambarana io nataon I jesoa Kristy io dia fanamafisana izay voalazan I Mosesy ao amin ny Deotornomia 6 :4-5. Didy lehibe tsy maintsy tanterahin ny ray amandreny Jiosy voatokana handova ny tany kanana izany, ampitaina amin ireo taranaka mifandimby, atao fiainana mihitsy : Resaho na mipetraka ao an-tranonao ianao na mandeha any an-dàlana, namandry na mifoha Mba ho fampatsiahivana anao dia ataovy amin ny boaty famehy eny amin ny hato-tananao na eny an-kandrinao ireny, ary soraty amin ny tolanambaravaran ny tranonao na eo amin ny vavahadin ny tanànanao. (Deot.6 :7-9). Ry havana, ny fahalalana izany Jehovah Andriamanitra tokana izany no andrarana antsika mpino kristiana koa tsy hivavaka amin andriamani-kafa (izay rehetra anakinanao ny fonao). Ambaran ny Apostoly Paoly fa Andriamanitra ihany no ivelomantsika, ihetsehantsika ary iainantsika ary dia hoy izy ao amin ny II Kor.3/2 : Hianareo no Epistilinay voasoratra ao am-ponay sady fantatra sy vakian ny olona rehetra. Jesoa Kristy tsy maniraka antsika hianatra sy hampianatra ny tenin Andriamanitra ihany fa hihavana mihitsy amin Ilay TSARA araka ny Soratra manao hoe : mihavàna amin Andriamnitra anie ianareo mba handovantsika ny fiainana mandrakizay. II - Mampihavana antsika amin ny marina ny Tompo : Nambaran I Jesoa Kristy tamin ity mpahay làlana ity fa ny didy ambony indirndra dia ny fitiavana an Andriamanitra sy ny fitiavana ny namana.nampiaiky volana ity mpahay làlana ity ny valintenin I Jesoa fa Marina, nefa koa nampihavana mihitsy ilay mpanoradàlana tamin ny marina (mihoatra lavitra noho ny fanatitra marobe). Ry havana, hoy ny voasoratra ao amin ny I Jaona 4/19 : Isika tia satria Izy efa tia antsika taloha. Manao ahoana ny fitiavantsika an Andriamnitra manoloana ny fitantanany ny fiainantsika? Haintsika ve ny mankasitraka Azy amin ny lafin-javatra rehetra, ary vonona haneho izany amin ireo tsy mino? Manao ahoana ny fanehoam-pitiavana amin ireo mpiara-belona satria hoy Jesoa : Didy vaovao no omeko anareo dia ny mba ifankatiavanareo; eny aoka ho tahaka ny nitiavako anareo no mba ifankatiavanareo koa. Izany hoe fitiavana tsy mila tambiny, ary fitiavana mahafoy ny tsara indrindra izay ananana, toy ny nataon I Jesoa. III - Mampihavana ny marina ny Tompo : Ny atao hoe MARINA dia ireo kristiana manaiky an I Jesoa ho Tompo sy Mpamonjy azy. Voalaza ao amin ny Romana fa : tsy misy marina nadia iray aza ny olombelona rehetra satria samy efa nanota avokoa. Misy koa anefa ireo voalaza ao amin ny baiboly ho lehilahy marina. NOA, voalaza fa lehilahy marina tsy nisy tsiny teo amin ny olona niara-belona taminy. JOBA, izay nirehareah Anriamanitra teo anatrehan ny andriamanitra hafa fa marina sy mahitsy, sady natahotra an Andriamanitra ka nifady ny ratsy. Ao koa JOSEFA vadin I Maria. Ambaran ny Apostoly Paoly fa Andriamanitra efa nanendry andro iray, izay hitsarany izao tontolo izao amin ny alalan ny lehilahy iray voatendriny (Jesoa Kristy) koa efa nanome vavolombelona hampino ny olona rehetra izany Izy tamin ny nananganany Azy tamin ny maty (Asa 17/31). Koa ny fahamarinana amin ny alalan I Jesoa Kristy no iaingana sy iorenan ny fitsaran Andriamanitra. Ary ny fitsangananny tamin ny maty no endrika feno nanehoan Andriamanitra fa afaka mihavana tanteraka aminy ny olombelona : ny marina amin ny finoana no ho velona. (Habak.2/4). Ry havana, ny fampihavanana omen Andriamanitra ny marina izany dia ahafahantsika mamakivaky ny vanim-potoana rehetra sy ny anton-javatra rehetra, ary mitondra ny mino ho vahoakan ny fanjakan ny lanitra, fa tsy ho tahaka ny an ilay mpanoradàlana lizanay hoe: tsy lavitra ny fanjakan ny lanitra ianao. Ho Azy irery ny voninahitra. Adeline Razefania, Mpiandry FJKM-Fenoarivo Atsimondrano 2

3 Prédication : L'amour ou la paix? (Matthieu 5:3-13). Heureux les pauvres en esprit, car le royaume des cieux est à eux! Heureux ceux qui pleurent, car ils seront consolés! Heureux ceux qui sont doux, car ils hériteront la terre! Heureux ceux qui ont faim et soif de justice, car ils seront rassasiés! Heureux les miséricordieux, car ils obtiendront miséricorde! Heureux ceux qui ont le cœur pur, car ils verront Dieu! Heureux ceux qui procurent la paix, car ils seront appelés fils de Dieu! Heureux ceux qui sont persécutés à cause de la justice, car le royaume des cieux est à eux! Les Béatitudes de Matthieu 5 sont souvent commentées, on sait que sont heureux ceux qui procurent la paix, ceux qui ont le cœur pur, ceux qui ont faim et soif de justice etc mais très rarement fait-on attention aux récompenses promises correspondant à chaque cas. On sait que certains hériteront la terre, d autres seront appelés fils de Dieu, à d autres le Royaume des cieux sera à eux. Or bien peu nombreux sont ceux qui seraient capables de savoir quelle récompense s accorde avec quelle béatitude, et le lien entre la situation et la promesse associée est rarement commenté. En particulier, on peut se demander de qui il est dit qu «ils seront appelés fils de Dieu»? Seront-ce ceux qui ont le cœur pur, ceux qui sont pleins d amour, les miséricordieux, ceux qui font la paix, les doux et les humbles? On pourrait bien le dire de chacun. Or être appelé «fils de Dieu» est une très grande chose. C est même le titre du Christ. Le fils de Dieu, c est celui qui est vraiment son représentant, celui qui est le «lieutenant» de Dieu sur Terre et son serviteur, celui dont on peut dire que sa vie est issue de Dieu, qu elle vient tout entière de Dieu, que ce qu il est, et ce qu il fait est né de la présence de Dieu. D après les Béatitudes, seront appelés «fils de Dieu» : «ceux qui procurent la paix». C est en fait assez étonnant, aujourd hui, nous aurions plutôt dit que cela devrait être promis à ceux qui sont plein d amour, c est à dire les miséricordieux. Nous prêchons en effet sans cesse que «Dieu est amour», que l essentiel, c est l amour, qu être digne de Dieu, c est aimer et faire grâce, que la plus grande chose à donner, c est l amour. Bref nos messages chrétiens de nos jours sont tous centrés sur l amour et la grâce, et nous répétons que le seul commandement, la seule exigence, c est d aimer son prochain. Comment se fait-il que les Béatitudes, au lieu de centrer le message sur l amour, la grâce et la miséricorde, le font sur le fait de donner la paix? Peut-être y a-t-il là quelque chose à entendre de la part du Christ, justement parce que c est surprenant. Il faut bien dire tout d abord que le message d amour que les prédicateurs veulent faire passer est, le plus souvent, problématique. Tout d abord il est brouillé, le mot «amour» peut, en effet signifier bien des choses. Le grec qui est plus subtil que le français, lui, a plusieurs mots. Or de quoi parle-t-on quand on dit le mot «amour», de l «eros», de l «agape», de la «philia»? Cela fait qu on est sans cesse dans le contresens, ou tout au moins dans le flou. Ainsi certains ne comprennent pas que le Christ demande «d aimer ses ennemis», comment pourrait-on trouver sympathique quelqu un que l on n aime pas? Et les jeunes époux veulent régulièrement lire le chapitre 13 de 1 Corinthiens sur l amour éternel en pensant que cela parle du sentiment fort qui les uni. Mais le sentiment amoureux est tout sauf éternel, il est passager, il permet la rencontre, mais il demande à se prolonger dans un autre type de démarche. Et l amour éternel dont il est question chez Paul, ce n est pas l amour des amoureux, c est l amour que chacun doit avoir pour tout le monde. Et puis le message et brouillé, parce que nous ne savons pas très bien qui nous devons aimer comme nous mêmes. L Evangile dit «son prochain», mais qui a une idée claire de ce que cela peut représenter? Aujourd hui, on le comprend le plus souvent comme désignant le «semblable», c est-à-dire tout autre être humain, et on pense confusément que cet amour du prochain nous invite à être solidaires avec les pauvres du tiers monde. Mais il est plus facile d envoyer un chèque à une ONG que d aimer vraiment son beau-frère ou son voisin, voire vraiment son conjoint. Et à force de dire qu il faut aimer tout le monde, ce commandement d amour essentiel devient impossible et inopérant. Donc on ne sait plus très bien ce que veut dire aimer, et on sait encore moins qui nous devons aimer, mais on ressasse sans cesse tout de même cette exigence évangélique, peut être avec d autant de facilité que cela ne nous engage pas à grand chose de précis faute de savoir ce que cela veut dire ou implique pour nous. Par ailleurs, l amour est une belle chose, certes, mais il n est pas dénué de risques, il ne fait pas forcément que du bien. On pense parfois qu il suffit d aimer et qu alors on est forcément dans le bien selon cette belle parole de saint Augustin : «Dilige et quod vis fac» : «aime et fais ce qu il te plait». Beaucoup croient dans ce bel adage, en pensant que si on aime, alors on ne peut que faire du bien à l autre. Mais, en fait, rien n est moins certain. L amour peut être bon, mais il peut aussi être mauvais, il y a des mauvaises façons d aimer, on peut aimer, vouloir le bien de l autre, et pourtant se tromper, et faire du mal. Et il peut y avoir des amours mauvais, néfastes, pervers même, il y a des amours qui enferment, qui étouffent, et même parfois qui tuent. Celui qui a dit «délivre moi de mes amis, mes ennemis, je m en charge» (Georges Bernard Shaw?) a bien senti cette difficulté : le mal fait par les ennemis a quelque chose d objectif contre le quel il est possible de se défendre, mais le mal que nous font ceux qui nous aiment, et parfois en pensant nous faire du bien peut être extrêmement dangereux, l amour tisse des liens parfois pervers dont il est extrêmement difficile de se dégager, des amours qui génèrent des sentiments de culpabilité épouvantables chez ceux qui essaient s en sortir. A l extrême, il y a les parents qui font subir des violences à leurs enfants parce qu ayant été eux-même victimes, ils ne savent pas exprimer leur amour autrement. Et cette perversion de l amour n est pas réservée aux relations humaines, même dans le domaine religieux, une certaine idée de l amour de Dieu peut devenir pesante et destructrice. Il suffit de voir les ravages qu une prédication de la grâce a pu faire dans le monde puritain. Peut-on en effet supporter d être aimé quand on sait pertinemment qu on n est pas aimable? Et que faire d un amour qui maintient prisonnier, d un amour qui infantilise au lieu de permettre de devenir soi même libre et en marche, d un amour 3

4 qui crée un lien pour mieux anéantir? Le fait d être aimé risque toujours de nous imposer quelque chose, et peut nous rendre redevables, voire même enlever notre liberté. Certains parents le savent d ailleurs et disent à leur enfant : «si tu m aime tu ne peux pas faire ça ou partir» ou avec des plus grands enfants : «si tu m aimais, tu viendrait me voir». L amour risque toujours de ne pas être vraiment gratuit, il demande une réponse, exige des signes, impose des gestes, des devoirs, et nous fait retomber dans une théologie des œuvres, dans le devoir et la culpabilité. Cette culpabilité, c est de ne pas la mériter, de ne pas savoir aimer assez, de ne pas savoir le dire comme il faut, de ne pas agir avec assez d attention à l autre L amour donc est évidemment très bien mais jusqu à un certain point, et en tout cas n est pas dénué de risques ou de problèmes. Peut être donc, qu en effet, une chose plus importante encore, c est la paix. Et peut être que ce que donne Dieu avant tout, c est la paix. Et celui qui, dans ce monde, est fils de Dieu, il n est pas dit que c est celui qui aime, mais c est celui qui apporte la paix. La paix intérieure, d abord est une belle et grande chose. Quel beau cadeau de la part de Dieu que de pouvoir être en paix avec soi même, parce qu on ne sens pas coupable, parce que ses désirs sont harmonisés, parce qu on s assume comme on est, parce qu on n a pas de désirs exalté irréalisables qui nous feraient souffrir, parce qu on est heureux de ce que l on a! Et puis la paix avec Dieu est aussi une grâce. Quand il n y a pas d obstacle entre Dieu et nous, que le péché est dissout, qu il n y a pas de punition, pas de jugement, juste une relation de proximité et de transparence avec lui. Et enfin la paix avec l autre qui est si difficile, mais dont nous avons tant besoin. Cette paix, c est d accepter l autre, de le prendre comme un partenaire, un vis-à-vis, comme celui avec qui je peux parler, avec qui je peux partager un repas. L autre qui est libre et qui me laisse libre. L autre que je ne cherche à dominer, et qui ne veut pas me dominer. L autre que je ne possède pas et qui ne me possède pas. C est ça en fait le vrai amour, celui qui construit, qui respecte, pas celui de l amour gluant qui emprisonne. La paix les uns avec les autres, c est ça qui est la vraie forme d amour, loin de cet amour pathologique qui peut si vite se transformer en haine. C est comme cela qu est l amour du père du fils prodigue de la parabole : il donne, ne retient pas, ne fait pas de reproche, et n exige rien. Il est tout dans la joie de la présence de l autre qui est prise comme une grâce, sans rien attendre. Le contraire de cette paix, c est la jalousie, l acrimonie, la querelle, la revendication, la critique perpétuelle, c est usant, insupportable, destructeur, plus que de ne pas être aimé peut-être. Les gens qui donnent la paix, les gens pacifiques, sont infiniment précieux, constructifs. La paix, c est donc bien sans doute ce qu il y a de plus précieux dans ce monde, même pour vivre. Et nous, le mieux que nous puissions donner autour de nous, c est la paix. La paix, ce n est pas l ignorance ou l indifférence, ce n est pas le désintérêt, c est l amour libérateur, et nous devenons comme Dieu quand savons donner la paix. C est d ailleurs ce que le Jésus ressuscité donnera selon l Evangile de Jean. Il ne dira pas «je vous aime», mais «je vous donne la paix». La paix, c est le plus beau des cadeaux, et c est très concret. Et il est plus facile de comprendre de quoi il s agit que l mour qui est si compliqué qu il ne dit plus rien. Mais en fait, l amour que nous avons dénoncé, ce n est pas l amour dont parle l Evangile, c est l amour humain tout plein de contradictions. Le véritable amour de l Evangile, c est une manière de respecter l autre, de l écouter, de lui permettre d être lui-même, jamais de l enfermer ou de le contraindre. L amour Evangélique en fait, il contient la paix. Et d ailleurs, les Béatitudes, ne parlent pas d amour, parlent de miséricorde, ce n est pas tout à fait la même chose. Il ne s agit pas de l amour intelligent de l Evangile, mais d un sentiment, de l amour du ventre, des tripes. Or ça, c est précieux, mais ce n est pas l essentiel absolu, et ne devient le vrai «amour» que si se concorde avec la liberté, et la paix. Que le Seigneur de la paix vous donne lui-même la paix en tout temps, de toute manière! Que le Seigneur soit avec vous tous! 2Th 3:16 Amen. L. Pernot (Pasteur ERF) Fampianarana : 1.FAMARITANA a) Fanao tsy rotitra manoloana ny tsy rariny sy ny tsy marina mihatra amin ny tena. Fampanginana ny zo ananana. Fihetsika voafehin ny teny hoe : «Tsy maninona.» Toe-po sy fihetsika tsy mamaly ho setrin ny fanao tsy mendrika natao tamin ny tena. b) Teny mitovitovy hevitra : Faharetana, fahandrasana, faharipo (Rakibolana malagasy), famelan-keloka, famindram-po. d) Ny mifanohitra aminy : Lalàn ny Tsimbalivaly = «Maso solon nymaso» Tsy azo ivalozana Henjana amin ny fampiharan-dalàna. 2.FANDEFERANA : Toetra ampirisihan ny Soratra Masina a) Na ny fahendren ny fiaraha-monina Malagasy taloha aza dia manandratra izany : «Ny tsihy no fola-mandefitra.» «Ny fo tsy alefitra tsy ananan-kavana.» «Aleo mandefitra ho mandina toa laferana toy izay mitringitringy toa lohalika.» b) Mandefera hoy ny SoratraMasina : Kol. 3 12, 1Kor. 6 7 / 13 7, 1Tim. 3 3, Jak / 5 10, Filip. 4 5, 1Tes. 5 14, ary mihoatra noho izany aza : «Valio soa ny ratsy.» Rom d) Andriamanitra no modely harahintsika amin izany araka ny nandeferany tamintsika : Sal , Gen. 3, 1Tim , Lio NY VOKATSOAN NY FANDEFERANA : Na dia mety hisy voka-dratsiny aza ny fandeferana dia lehibe lavitra ny voka-tsoa avy aminy matoa ampirisihan ny Soratra Masina sy ataon Andriamanitra ary ampianarin ny fahendrena. a) Fiarovana sy fanatsarana ny fifandraisana : «Ananan-kavana.» na eo amin ny fifandraisan ny mpivady na fianakaviana, ny Fiangonana sy ny fiaraha-monina. b) Fanomezana anjara ho an ny nanao diso hiova syhihatsara (2Pet ) :«L erreur est humaine.» d) Fanomezana anjara ho an ny andeferana hanonitra mifanaraka amin izay tsaroany ho haben ny tsy mety nataony (1Tim ). e) Fahasambarana : Mat. 5 7, Sal. 32 1, 2, Jak

5 4.NY FETRAN NY FANDEFERANA : Ny fandeferana eo anivon ny fifandraisan ny mpivady no azo akana sary an-tsaina ny fetra : Mat. 19 9, mahazo misao-bady, rehefa noho ny fijangajangan ny andaniny. Kanefa ny fijangajangana, toy ny fahotana rehetra dia azo avela heloka (Jao. 8 11). Koa satria ny fandeferana dia efa fihoaran-dalàna, noho izany dia tsy misy lalàna afaka mametra ny azo andeferana (Mat ). Ireo tantara mampiseho ny famerana ny fandeferana dia azo heverina ho fitodihana kokoa amin ny manodidina mijery fa tsy noho ilay tsy andeferana (Jos. 7 26, Nom. 25 8). Ny fomba mazava ilazan ny Soratra Masina ny fetran ny fandeferana dia ny hoe : «Fitenenan-dratsy ny Fanahy Masina, Faniratsiran ny Fanahin ny fahasoavana, Fanomboana ny Zanak Andriamanitra indray.» Mat , Heb / Ny fandeferan Andriamanitra hita amin ireo tantara voalaza ireo dia azo ilazana fa tena misy fetra tokoa. Ny fahotana voatanisa eo anefa (halatra, fijangajangana) dia fahotana fahita mahazatra ihany, ary tsy hoe niverimberina aza fa vao notanterahina indray mandeha monja dia toa tsy nandeferan Andriamanitra avy hatrany. Fehiny : Tsy misy lalàna mamehy ny fetran ny fandeferana raha ny hita eo amin ny fandeferan Andriamanitra fa sady mandrakizay ny famindrampony no lazain ny Soratra Masina mazava koa ny fampitandremana hoe : «Zavatra mahatahotra ny ho azon ny tànan Andriamanitra velona.»heb RABELISON Manasse, Mpitandrina. NY FIFEHEZANTENA : FIFEHEZANTENA VOKATRY NY FANAHY MASINA (Gal ). Ny lazaintsika ho Fifehezantena ankehitriny, dia lazain ny Gal ho FAHONONAMPO. Ny teny frantsay ilazana azy dia ny maîtrise de soi. Hotsongaintsika ireto zavatra telo (3) ireto hanazavana ity Fifehezantena na Fahononampo ity. MAHALALA NY TSARA SY RATSY AMIN NY TENA Na iza na iza, dia misy lafy tsara sy lafy ratsy avokoa. Fihamboana diso toerana ny ankoatr izay. Rehefa mahalala tsara sy manaiky izany isika, dia lasa mahay miaraka aman olona : tsy mpanankiana be fahantany ny hafa, tsy masiaka fiteny aman olona,sns. Ireny lafy ratsy (points faibles) amin ny tena ireny, dia azo hatsaraina, azo ilaozana, satria fianarana hatrany ny fiainana. Ireny lafy tsara (points forts) amin ny tena ireny, dia andrianina fatratra ankehitriny, fa ho lesoka kosa any aoriana any. Ohatra, nahay nitendry masinina fahiny, fa izao tsy mahay mitendry solosaina. Tsy mahazo mihevitra ihany koa fa fananantsika samirery ny lafy tsara, ka ny olon-kafa tsy mba manana azy ireny. Ohatra, tsy isika irery no mahay mitendry solosaina. TSY MATAHOTRA TSIKERA Tsaroana eto ny tenin i W. CHURCHILL, Praiministra anglisy : tsy mahafinaritra ny tsikera, fa ilaina misintona hijery ny tsy mety io. Ao anatin ny tsikera tokoa, dia misy marina ihany na dia kely monja aza. Izay no tadiavina fa avela ireo teny maro feno fanaratsiana fotsiny ireo. Ny olona tia mitsikera aza no tena matahotra tsikera, raha ny fampianaran I Jesoa no raisina. Be lavitra noho ny an ny hafa ny kilemany, raha ny fampitahaina ny andry eo anoloany sy ny sombin-kazo eny amin ny hafa no raisina (Mat 7.5). hofikirina izay tratra, fa mikaroka ny tsara hatrany tsy manampahataperana. Ireo zavatra telo nambara ireo, dia omen ny Fanahy Masina izay rehetra manaiky hiasany, ka tonga olona hafa mihitsy fa olom-baovao ao amin i Kristy (2 Kor. 5.17). Fampianarana nalaina tao amin ny tranokala FJKM Koa raha misy olona ao amin i Kristy, dia olom-baovao izy; efa lasa ny zavatra taloha, indreo efa tonga vaovao ireo. MIEZAKA HO LAFATRA HATRANY Tsy mihevi-tena ho tonga amin ny lafatra mihitsy ny olona mahafehy tena na mahonon-tena. Ny olona tsirairay koa, dia samy manana izay ataony hoe lafatra, ka tsy misy fenitra iraisana izany. Izany hoe, raha 7 miliara ny olombelona ety an-tany ankehitriny, dia misy 7 miliara koa ny lafatra. Ny Soratra Masina dia mampianatra hikatsaka hatrany izay lafatra kokoa, na dia efa manana ny tsara aza (Fil. 3.13). Tsy zavatra natao 5

6 VAOVAON NY MKMB : *ALAHADY 16 septambra 2012 : fanompoampivavahana iarahana amin ny Paroasy loterana Arlon (Viville). Fiarahana amin ny namana rehetra any amin ny faritra Luxembourg belge sy Gd Duche Luxembourg. Hanafana ny fotoana ny Amboarampeon ny MKMB Ny Avana. Fanombohan ny fanompoampivavahana : amin ny Folo ora sy sasany maraina (10h30). Toerana : Eglise Protestante Lutherienne du Pays d Arlon. Rue de l Eglise, 6700 Viville-Arlon. Fiarahamisakafo : salle «la petite bergère» 8, rue St Paulin 6700 Freylange. Samy mitondra sakafo sy ranomboankazo isika ary iarahana toy ny fanao mahazatra. Ny vary sy ny kafe dia efa voaoman ny namana ao an-toerana mialoha.marihina fa tsy misy lakozia eo an-toerana. *Fiombonambavaka isaky ny herinandro : Mampatsiahy antsika mianakavy fa ny fiombonambavaka dia isaky ny Alakamisy hariva (18h30-20h) ao amin ny Fiangonana Botanique. Mandrisika antsika izahay fa tena mahasoa ny fiombonambavaka. Raha tahiny ka tsy afaka ianao dia aza adino ny miombombavaka isaky ny Alakamisy hariva (20h-20h30) any an-tokantranontsika avy. Entina am-bavaka amin izany : ny firenena, ny asan ny MKMB, ny marary sy ny mana-manjo. Mampanakarena ny mifampitondra am-bavaka koa mandrisika anao manokana izahay. *Alahady 28 Oktobra 2012 : Alahadin ny MKMB. Fandraisantsika ireo namana vao tonga eto Benelux rehetra. 12h : fiarahamisakafo (rihana voalohany) samy mitondra toy ny mahazatra. 15h : fanomoampivavahana sy fandraisana. 17h : Fiarahana maka sarim-pianakviana MKMB 2013! Alamino ny fotoananao. Ento ny vaovao hiara hivavaka amintsika. *Tranga Jolay Aogositra : Nandritra ny fotoana fialantsasatra dia nisy tokoa ny tranga samihafa ato amin ny fianan ny mpianakavin ny MKMB. Tao ireo mpianatra nandrato fianarana ary nahavita izany : nisy ny efa nody any an-tanindrazana ary misy ny mamita hatramin ny volana septambra. Eto dia faly miarahaba anareo rehetra nahatratra ny tanjona nokinasa. Isaorantsika Andriamanitra satria lehibe ny famindrampony sy ny fitahiany. Tantely amam-bahona ny fiaiana ary nisy tamintsika ny azom-boina : Atoa Yves Randrimabololona( Australie) dia namoy ny reniny ( Pr Randriambololona Aimée) tamin ny volana Jolay. Manantitra ny fampiononana ho azy sy ny fianakaviany indray isika eto amin ity gazety ity na dia efa nanao izany tamin ny alalan ny fitaovan-tserasera isika nandritra ny fialantsasatra. Atoa Hery Rivoson (Bruxelles) koa dia namoy ny reniny (Bodo Rivonirina). Ny famangiana sy fampaherezana ny fianakaviana dia efa notanterahina ihany koa tamin ny fiandohan ny volana Aogositra lasa teo. Andriamanitra manakarem-pitiavana sy famindrampo anie hiahy mandrakariva anareo sy ny fianakavianareo avy ary hanome anareo hatrany ilay fifaliana lalina mampionona ny fo sy ny saina. fanompoampivavahana ny Mpitandrina Rasamoelina Samson (FJKM Ambohimalaza) ary nitondra ny Tenin Andriamanitra (I Tesalon. 5 : 16-18) Rtoa Harizo Ratsimandisa (FJKM Iharamy). Deraina manokana eto ireo namana avy lavitra (Mahajanga, Ambositra, Besalampy,Mandritsara ) izay tsy nitsitsy fotoana na natahotra havizanana noho ny fitiavana hiara hivavaka sy hankalaza ny faha-25 taonan ny MKMB. Isaorana ireo mpanentana sy ny mpikarakara iny fotoana iny ary ny mpampiantrano fa lafatra ny fandraisana sy yn fandaharampotoana. Ny rakitra tamin ny fanompoampivavahana dia natolotr izy ireo manontolo ho an ny tsangambaton ny faha- 25 taona (Topaza sy Tangaina).Tsy adino ny fanao mahazatra : fiaraha-miala hetaheta, izay nahatsiarovan ny rehetra ny fiarahana tao Botanique. Ho an Andriamanitra irery ny voninihatra ary hifampitaona indray afaka roa taona (2014). *Hafanana 18 Aogositra 2012 : Hafanana (masoandro sy hafalina) no niarahana nigoka tamin ny fitsangatsanganan ny MKMB tany Chevetogne. Tamin ny folo ora maraina dia efa nisy tonga ireo namana ary talohan izany dia efa teo an-toerana ny tompon andraikitra nanaomana ny fandraisana. Lafatra ny fiarahana satria, ankoatry ny fiaraha-misakafo sy ny fotoana malalaka hoan ny tsirairay, dia nisy ny fifanakalozan ireo elaela tsy nihaona noho yn fahasahiranana isan-karazany. Ny tarehy vaovao dia misy hatrany. Teo ihany koa ny fifampiresahana tami nireo namana nanome toromarika manokana entina mampandroso hatrany ny fiombonana izay tena mampankarena sy manamafy orina MKMB. Mahasoa ary tena ilaina ny fisindàna tahaka ireny satria ankoatry ny rivotra madio sy ny masoandro azo dia manamafy ny fifandraisan ny mpikambana am-po ny ny fifankahitana ivelan ny fiarahamivavaka. Isaorana etoana ireo namana nikarakara iny fitsangatsanganana iny. Dia amin ny taona hoavy indray mifamotoana e! * Meteza. Miditra amin ny faha-16 taona niainana ny gazetintsika. Mitohy ny fifampitezana. Misy dia misy ny manan-talenta amin ny fanoratana. Misy ny te- handefa lahatsoratra fa misalasala. Misy amintsika manan-kolazaina fa mety sadaikitra ny hamosaka izany aminay. Manainga anao izahay : avia hifarimbona. Avia hifanoro. Izay heverinao fa mahasoa ny hafa : asehoy - METEZA HIZARA HO AN NY MPIANAKAVIN NY FINOANA - Aza misalasala mandefa izay lahatsoratra na taratasy tianao aseho. Alefaso alohan ny faha-5-ny volana amin ny tompon andraikitry ny gazety : Mankasitraka tompoko. *Tranainy MKMB : Tontosa an-tsakany sy an-davany ny fihaonan ny Tranainy MKMB fanao isaky ny roa taona tany Antananarivo ny Alahady 15 jolay lasa teo. Nitarika ny 6

7 VAOVAON NY NOSY : FIANGONAN I JESOA KRISTY ETO MADAGASIKARA. HAFATRY NY SYNODA LEHIBE FAHA XVII Ny fanantenana no namonjena ny mino. ( Rom. 8/24a) Ry havana, Ho aminareo anie ny fahasoavana sy ny fiadanana avy amin Andriamanitra Raintsika sy Jesoa Kristy Tompo. (Fil 1/2). Ny Synoda Lehibe faha XVII nivory teto Manakara ny Aogositra2012 dia mamangy sy maniry ny fitahian ny Tompo ho an ny Mpitandrina sy ny vahoakan Andriamanitra rehetra, ary mitondra izao hafatra izao : Isaorana Andriamanitra fa vita soa aman-tsara ny fivorian ny Synoda Lehibe faha XVII izay niompana tamin ny teny faneva iainantsika mandritra ny efatra taona indray hoe : Ny fanantenana no namonjena ny mino (Rom. 8/24a). Ny fanantenana mantsy dia hery ateraky ny Fanahy ao amin ny Fiangonana ka manosika azy handroso sy hiasa am-pitiavana sy am-pifaliana ary indrindra am-pinoana eo anivon ny fiarahamonina. Ny fanantenana ihany koa dia endrim-piainan ny mino vokatry ny fandraisany ny famonjen i Kristy ka hanambarany fa : izao zavatra hary rehetra izao dia hovotsorana amin ny fanandevozana ho amin ny fahafahana izay momba ireo zanak Andriamanitra (Rom. 8/21). Ny Fiangonana dia mijoro ho mpampihavana hatrany noho ny baikon i Kristy, Ilay fihavanantsika ary mpitondra fanantenana eo amin ny manodidina azy. Ny Synoda Lehibe faha XVII dia manentana antsika hanao ho vaindohan-draharaha ny fanohanana ny fanabeazana any amin ny Sekoly FJKM izay sady sehatra fitoriana ny Filazantsara no fanolokoloana ny ankizy sy ny tanora ho tonga olom-banona eo anivon ny fiangonana sy ny firenena. Manoloana ny fihanaky ny fikambanana isankarazany izay mivoy fampianarandiso sady tsy afa-miaraka amin ny maha kristiana, dia taomina isika hanamafy ny fianarana Soratra Masina sy ny fandalinam-pinoana ary ny fiainam-bavaka ka hiaina ny finoana an i Jesoa Kristy Tompo Tokana eo amin ny sehatra misy antsika avy. Misintona ny sain ny tompon andraikitra samihafa eto amin ny firenena ihany koa ny Synoda Lehibe faha XVII, mba hibanjina ny fiainam-bahoaka sy ireo valala tsy mandady harona ao anatin ny fahantrana lalina, ka hampandefitra ny hambom-po diso toerana. Ny fanantenana dia teraka mandrakariva ao anatin ny fotoan-tsarotra koa aoka isika hivavaka hoan ny Firenena sy ny vahoaka Malagasy. Manao antso ihany koa ny Fiangonana ny mba handalàna ny fahamarinana eo anivon ny fiarahamonina ary ny hiezahantsika rehetra hampanjaka ny fandriampahalemana. Taomina ihany koa ny vahoaka Malagasy manontolo hifankatia, hanaiky ny fahasamihafana ho hery mampandroso ary handà ny fanavakavahana miseho amin ny endrika maro samihafa. Amafisina ny ezaka ho fanokafana indray ny Radio Fahazavana ka hiaraka hifarimbona amin izany indrindra ny zanaky ny Fiangonana. Nofaranana teto Manakara ny fankalazana an Andriamanitra noho ny faha-175 taona ny maritiora, koa dia mampahery antsika hatrany amin ny fijoroana ho vavombelona sy ny filofosana amin ny fitoriana ny Filazantsara. Farany, mahereza ao amin ny Tompo sy ny heriny faherezany (Efes. 6/10). Ho an Andriamanitra irery anie ny voninahitra. Manakara, faha 22 Aogositra 2012 Ny Filohan ny Synoda Lehibe : Atoa IRAKO ANDRIAMAHAZOSOA Ammi, Mpitandrina. Ny Filohan ny Biraon ny Mpiandraikitra Foibe : Atoa RASENDRAHASINA Lala Haja, Mpitandrina. *Changement climatique : besoin de 50 à 100 millions de dollars pour y faire face. Le phénomène du changement climatique ne cesse d occasionner des dégâts en Afrique et dans la zone de l océan Indien dont Madagascar est le 3e pays au monde le plus exposé aux risques. Les dégâts ne se limitent plus sur l environnement mais s étendent sur l économie, le social et la politique. A cet effet, il reste beaucoup à faire car le besoin financier pour faire face au changement climatique est estimé entre 50 et 100 millions de dollars par an. Madagascar a eu le privilège d accueillir l atelier régional de formation sur les sauvegardes environnementales et sociales en vue de l intégration des changements climatiques aux programmes de la Bad depuis hier à l hôtel Ibis à Ankorondrano. Organisée par la Bad, cette formation s adresse à une quarantaine de participants provenant des bureaux extérieurs de la Banque et de sept pays membres régionaux, à savoir Madagascar, Maurice, Seychelles, Comores, Rwanda, Burundi et Djibouti. Et ce, vu l ampleur de la situation compte tenu des impacts et défis multiples posés au développement de l Afrique par les changements climatiques car ils constituent une menace planétaire. 24 fonds climatiques pour l Afrique Lors de l ouverture officielle de la formation, le représentant de la Bad, Abdelkrim Bendjebbour, a expliqué que la Banque a adopté une stratégie de gestion des risques climatiques et d adaptation aux changements climatiques et un plan d action sur le changement climatique (CCAP) couvrant la période Ce plan d actions s articule autour du développement à faible intensité de carbone, du développement à l épreuve du changement climatique et de la création d un instrument de financement pour aider les pays africains à renforcer leur capacité de faire face à l évolution du climat. Pour le moment, «24 fonds climatiques sont disponibles pour faire face au changement climatique dont 12% du flux de ce fonds sont destinés pour l Afrique, soit environ 700 millions de dollars alors que le besoin s élève entre 10 à 20 milliards de dollars par an dont 50 à 100 millions de dollars pour l Afrique», selon toujours ce premier responsable de la Bad. Croissance plus verte L acquisition du fonds dépend des réalisations de chaque pays et est soumise à des conditions. Pour le cas de Madagascar, par exemple, la volonté politique et le placement du pays en matière de développement doivent être pris en considération. Vient ensuite le contenu du plan d action national de lutte contre le changement climatique qui fera l objet d une requête en vue de déterminer l aide à apporter au pays. C est la Banque qui gère actuellement plusieurs instruments de financement des interventions climatiques. Par ailleurs, la Banque est en train d élaborer une stratégie à long terme qui appuiera la transition de l Afrique vers une croissance plus verte, en renforçant les capacités des économies africaines pour leur permettre d atteindre plus efficacement leurs objectifs de développement. Selon le premier ministre Jean-Omer Beriziky, l atelier de renforcement de capacités arrive à point nommé au moment où le pays subit les aléas du 7

8 changement climatique touchant l économie, le social et la politique. L atteinte des objectifs du Millénaire de développement est compromis nécessitant de déployer tous les efforts pour faire face à l atténuation et l adaptation au changement climatique. Et le ministre des Finances et du budget, Hery Rajaonarimanpianina de poursuivre que «Les effets du changement climatique doivent être pris en compte pour que nous puissions assurer un développement durable et en faire bénéficier aux générations futures». TONONKALO Amin izao taom-pidirana izao dia mahafaly anay ny manolotra ity tononkalo fijoroana vavolombelona avy amin ny namana Fredy Jaofera ity. Samia manamafy ny fiankinana amin Andriamanitra ry havana! ALAHA DY 30 Septambra 2012 Fanompoampivavahana voalohany amin ny taompianarana Manentana anao sy ny fianakavianao izahay. Manainga anareo namana vao ho tonga ihany koa. Toerana : Eglise Protestante de Bruxelles-Botanique (Métro Botanique). Manomboka amin ny telo ora hariva (15h) Miaraka amin ny Amboarampeo «Ny Avana» Misy ny fandraisana ny fanasan ny Tompo. Mpitandrina : Patrick Evrard. Ny rakitra faharoa dia entitsika hanefana ny adidy amin ny asa tohanan ny MKMB any an-tanindrazana. Aorian ny fanompoampivavahana dia misy fiarahana miala hetaheta sy fifankahalalana. Alahady 16 Septambra Fotoana iarahana amin ny Paroasy Loterana ao Viville-Arlon. ANDRIAMANITRA Andriamanitra irery No mahita ny ato am-poko, Ka mbola nahay nijery Fony tojo izay toloko! Andriamnitra ihany No mahita ny ato an-tsaiko, Ka atokisako avy hatrany Rehefa reraka ny aiko! Andriamanitra tsitoha No mihazona ny fiainako, Ka n inon inona manjo, Mbola izy no itarainako. Andriamanitra tsy foy No Mpitarika ny làlako, Ka na tsisy izay fivoy, Mbola Izy no tsy halako. Fredy Jaofera 10h30 : Fanompoampivavahna sy Fandraisana, handray anjara amin izany ny amboarampeo Ny Avana. 12h30 : Fiarahamisakafo sady famangiantsika ny namana ao Arlon sy ny manodidina. Samy mitondra sakafo sy ranomboankazo toy ny mahazatra isika ary iarahana amin ny rehetra. (Marihina fa tsy misy fatana ao an-toerana) Toerana iarahana mivavaka : Eglise Protestante Lutherienne du Pays d Arlon. Rue de l Eglise, 6700 Viville-Arlon. Fiarahamisakafo : salle «la petite bergère» 8, rue St Paulin 6700 Freylange. Manantena ny fahatongavantsika marobe. Aoka tsy hisalasala isika vaovao. Azonao antsoina :

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

Noely 2009 Taom-baovao 2010

Noely 2009 Taom-baovao 2010 FMM Fiombonana Miara-mivavaka eto Münich. Noely 2009 Taom-baovao 2010 Fa Zaza no teraka ho antsika, Zazalahy no omena antsika, ary ny anarany atao hoe Mahagaga, Mpanolon-tsaina, Andriamanitra Mahery, Rain

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg 0 UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

FINOANA SY FAHAZAVANA FOI ET LUMIERE

FINOANA SY FAHAZAVANA FOI ET LUMIERE FINOANA SY FAHAZAVANA FOI ET LUMIERE BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 Gazety avoakan ny Mpiaramivavaka Kristianina Malagasy eto Bénélux (M.K.M.B.) Bulletin de liaison et d information de la

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. "Dieu qualifie ceux qui sont appelés", hoy Rakotolehibe Mamy, Talen ny FMMB

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. Dieu qualifie ceux qui sont appelés, hoy Rakotolehibe Mamy, Talen ny FMMB Taniketsa - Laharana faha 58 - Septambra 2014 1 Gazetin ny Sampana Sekoly Alahady FJKM Andrainarivo Taniketsa Miseho isan-telo volana. Laharana faha 58. Septambra 2014. Vidiny: 400 Ariary. Tranokala: www.sa-andrainarivo.mg

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

EDITORIAL. Un bon projet ALAHADY 26 SEPTAMBRA 2010. Fanompoampivavahana voalohany amin ny taona 2010-2011.

EDITORIAL. Un bon projet ALAHADY 26 SEPTAMBRA 2010. Fanompoampivavahana voalohany amin ny taona 2010-2011. BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 1 - Septembre 2010 EDITORIAL Un bon projet Mensuel - Editeur Responsable:

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

Ny Vaovao Mahafaly. La Bonne Nouvelle

Ny Vaovao Mahafaly. La Bonne Nouvelle Ny Vaovao Mahafaly La Bonne Nouvelle Ary tamin ny fahenim-bolana dia nirahin Andriamanitra ny anjely Gabriela ho any an-tanàna anankiray any Galilia atao hoe Nazareta, ho any amin ny virijina anankiray,

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

AMBATONAKANGA SY NY MISIONERA ;

AMBATONAKANGA SY NY MISIONERA ; AMBATONAKANGA SY NY MISIONERA ; Raha miteny hoe Ambatonakanga isika protestanta amin izao andro ankehitriny izao dia ny trano fiangonana vita amin ny vato no tonga ao an-tsaintsika voalohany ary vitsy

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

M o t d u P rov i n c i a l Temps de grâces

M o t d u P rov i n c i a l Temps de grâces Mot du Provincial Temps de grâces Plusieurs événements de la province et de l Église à Madagascar constituent nos sources d action de grâce à adresser au Seigneur. La visite fraternelle et édifiante du

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

Note pratique. Réseau PRATIQUES

Note pratique. Réseau PRATIQUES Note pratique Ny Herin ny hafatra / Le pouvoir des messages pour la santé préventive Expérience du programme de santé materno-infantile mené par Inter Aide à Farafangana, Madagascar Notice Type de document

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

MpANAMORY RAdO RABARILALA

MpANAMORY RAdO RABARILALA ENIM-BOLANA TSY TAFATSANGANA FANJAITRA MIISA 21 NO NESORINA TAO AN-KIBON i LALAINA P.06 N 3190 L u n d i 2 9 j u i n 2 0 1 5 PRIX : Ar 400 zatovolahy NANGALATRA volamena P.06 TENY AM-pASANA : NANONOFY

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE -----------------------

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- MINISTERE DES TRANSPORTS ET DE LA METEOROLOGIE -------------- RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- I. CONTEXTE Malgré

Plus en détail

Conversations en ligne : descriptions, perspectives. Louise Ouvrard

Conversations en ligne : descriptions, perspectives. Louise Ouvrard Conversations en ligne : descriptions, perspectives Eléments théoriques La variation Quelques caractéristiques du discours électronique La langue malgache Le corpus Présentation Analyse Quels apports à

Plus en détail

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent cyan magenta jaune noir PROGRAMME P.7 RENCONTRE DE VONTOVORONA POSSIBLE ECHEC Les partis et associations de GRATUIT QUOTIDIEN D INFORMATION N 0137 DU Mercredi 25 Août 2010 FIARAHAMONINA HADIHADIANA NY

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA TATITRA ANIVON NY ANTENIMIERAM- PIRENENA Praiminisitra Jean RAVELONARIVO 1 TATITRA MANOLOANA NY ANTENIMIERA I 21 MAY 2015 21 MAY 2015 Andininy 54.- Ny Filohan ny Repoblika no manendry ny Praiminisitra

Plus en détail

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES DEPARTEMENT INTERDISCIPLINAIRE DE FORMATION PROFESSIONNELLE COMMUNICATION ET DYNAMIQUE LOCALE RAPPORT

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

Février - mars 2016 n 47 TRAIT D UNION

Février - mars 2016 n 47 TRAIT D UNION Février - mars 2016 n 47 TRAIT D UNION Le journal en ligne de la RNS Train Manakara-Fianarantsoa Éditorial 2 Lyon et ses incontournables 3 La tribune du coordinateur 4 Itinéraire d un sportif gâté 5 Lalaina

Plus en détail

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar HUMBOLDT-UNIVERSITÄT ZU BERLIN Landwirtschaftlich-Gärtnerische Fakultät Schriftenreihe des Seminars für Ländliche Entwicklung VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail