Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA"

Transcription

1 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA MALAGAS Y -- SAMPAN-- DRAHARAHAN NY FIIRENENA MIIKAMBANA MIISAHANA NY FAMPANDROSOANA" PROGRAMME MAG/97/007 DAP 1 "Gouvernance et Politiques Publiques pour un Développement Humain Durable" SSEPTTAMBRA

2 2

3 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA MALAGAS Y -- SAMPAN-- DRAHARAHAN NY FIIRENENA MIIKAMBANA MIISAHANA NY FAMPANDROSOANA" PROGRAMME MAG/97/007 DAP 1 "Gouvernance et Politiques Publiques pour un Développement Humain Durable" SSEPTTAMBRA

4 FIZAHAN-TAKELAKA 1 FAMPIDIRANA NY KAOMININA IREO TOMPON'ANDRAIKITRA AO AMIN'NY KAOMININA NY FIFIDIANANA NY MPANOLONTSINA SY NY BEN'NY TANÀNA Fanaikana ny mpifidy Fepetra ilaina hahafahana milatsaka ho fidina ho Mpanolontsaina sy ho Ben'ny tanàna Ny amin'ny tsy fahazoana mampirafy raharaha sy ny fanonganana NY MPANOLONTSAINA MONISIPALY NA KAOMINALY Isan'ny Mapnolontsaina monisipaly na kaominaly Ny biraon'ny Filankevitra Ny fiasan ny Filankevitra Ny fiantsoana ny Filankevitra Ny vaomiera Ny andraikitry ny Filankevitra Ny sora-draharahan'ny Filankevitra Ny tambi-karama NY BEN'NY TANANA - LEHIBEN'NY FITONDRAN-DRAHARAHA KAOMINALY Fandaminana ny mpanantanteraka Ny andraikitry ny Ben'ny tanàna..28 4

5 3.3.3 Ny sora-draharahan'ny Ben'ny tanàna Ny tambim-bola samihafa FANDAMINANA NY KAOMININA NY RAFITR'ASA NY FANDAMI NANA NY KAOMININA ARA-PARITRA : NY FOKONTANY NY FITANTANANA NY MPIASA FOTO-KEVITRA ANKAPOBE FANAOVANA NY FISIN'NY MPIASA FANDRAISANA MPIASA Paika anatiny arahina Paika ivelany arahina NY POLITIKAN'NY KARAMA FANOMBANANA NY MPIASA NY FAMPIROBOROBOANA NY MPIASA SY NY OLONA AMPIASAINA Ny fanofanana Ny fifandraisana anatiny FITONDRANA NY MPIASA Ny fifanekem-piasana Ny fialan-tsasatra Ny tsy-fiasana sy ny fanomezan-dàiana tsy hiasa Ny iraka..47 5

6 5.7.5 Ny fitsipi-pifehezana 48 6 IREO SAMPAN-DRAHARA KAOMINALY NY SEKRETARIA ARA-PITONDRANA Ny fomba fanehoana ny taratasy ifandefasana ara-pitondrana Ny taratasy ifandefasana tonga Ny taratasy ifandefasana miainga Ny fandaminana ny fitehirizana ny taratasy NY RAHARAHA ATAO AMIN'NY ANARAN'NY FANJAKANA NY FAHASALAMAM-BAHOAKA SY NY FANABEAZANA FOTOTRA NY FAMPANDROSOANA KAOMINALY Famantarana Ny fandaharan'asa Fanomanana ny antotan-taratasin'ny tetik'asa Ny fikarohana famatsiam-bola na fiombonan'antoka Ny fanatanterahana Ny fanombanana NY FIRAISAN'NY SAMY KAOMININA NY LOHARANOM-BOLAN NY KAOMININA NY HETRA MIVANTANA NY HETRA TSY MIVANTANA NY SARA SY HABA FANORATANA NY SORADRAHARAHA NA 6

7 FAMINDRAM-PANANANA NY SARA SY HABA NY VOLA FANDOA NY TARATASIN-DRAHARAHA ARA-TETI-BOLA SY SORA-BOLA NY TARATASIN-DRAHARAHA ARA-TETI-BOLA Ny teti-bolam-panombohana Ny teti-bola fanampiny Ny fanapahana enti-manova Fandaharan-dohatenyamin'nyteti-bola FANOKANANA NY SORA-BOLA VOTOATIN'NY TETI-BOLA VOLA MIDITRA HOFAMPANDEHAN-DRAHARAHA NY FANDANIAM-BOLA FAMPANDEHAN-DRAHARAHA Vola miditra momba ny asam-pamokarana Ny fandaniam-bola hanaovana asam-pamokarana NY FIFANDRAISANA ARA-BOLAN'NY SOKAJY ROA FANDANIANA SY FANARAHA-MASO NY TETI-BOLA NY FANOMANANA NY TETI-BOLA : FEPETRA FAMPIFANDANJANA FOMBAFOMBA FANOMANANA FOTO-KEVITRA AN-KAPOBE VOTOATIN'NY FOTO-KEVITRA MIORINA AMIN'NY FISARAHAN'ANDRAIKITRA 73 7

8 12.2 NY ASAN'NY MPANALALANA NY ASAN NY MPITÀNA KAONTY ANJARA RAHARAHAN NY MPANALALANA NY FANATANTERAHANA NY VOLA MIDITRA Foto-kevitra Ny fandefasana ny taratasy fanamarinam-pitakiana Fanitsiana, fampihenana na fanafohanana taratasy fanamarinam- pitakiana vola miditra Fampitana ny taratasy fanamarinam-pitakiana vola miditra any amin ny mpitàna kaonty Ny fotoana fandefasana ny taratasy fanamarinam-pitakiana ny vola miditra NY FANATANTERAHANA NY FANDAMINAM-BOLA Ny raharaha momba ny fanekena hamoaka vola Ny fikajiana ny fandaniana Ny baiko fampandoavam-bola Fandefasana ny taratasy mibaiko any amin ny mpitàna kaonty Fotoana famoahana NY KAONTIN NY MPANALALANA Foto-kevitra Ny fanaovana ny kaontin ny vola miditra 87 8

9 Ny fikaontina ny fandaniana NY RAHARAHA AMIN NY FARAN NY TAONA : ASA FANAO AMIN NY FIFARANAN NY TAOM-PIASANA FAMARANANA NY FITANANA NY KAONTY ARA-PANJAKANA ANJARA RAHARAHAN NY MPITÀNA KAONTY NY FANAOVAN-DRAHARAHA AMIN NY VOLA MIDITRA Fiandraiketana an-tsoratra ireo taratasy fanamarinan-jo hampidi- bola Famoriana ny vola miditra NY FANAOVAN-DRAHARAHA AMIN NY VOLA MIVOAKA Ny fanaraha-maso Ny sazy Ny fanefàna Ny fanaovan-drahararha manokana FITANANA KAONTY Ny fandaminana ny fitànana ny kaontin ny kaominina Fanoritsoritana ireo raharaha atao amin ny fitànana kaonty Ny raharaha atao mikasika ny tahirim-bola Fanitsiana ny asa soratra Raharaha atao tsy ara-teti-bola FITANANA KAONTY IREO TARATASY MISY VIDINY INACTIVES 111 9

10 15 TOE-JAVATRA MANOKANA MIKASIKA NY KAOMININA AMBANIVOHITRA NY ASA 1SAN'ANDRO SY MIVERIMBERINA SAHAN'NY BEN NY TANANA NY SORA-PIANKOHONANA Ny mpiandraikitra ny sora-piankohonana Ny mpitantsoratry ny sora-piankohonana Ny rejisitry ny sora-piankohonana Sora-pahaterahana Sora-pananganana Fanovana anarana Sora-panjanahana Ny fanambadiana Ny Fifidianana Fanisana ny tanora ho amin'ny fanompoam-pirenena NY FANDRIAMPAHALEMANA Anjara raharahan ny Ben ny tanàna eo amin ny lafiny fitantanana ny fandriampahalemana Ny fahefana eo amin ny fitandroana ny filaminana FIVORIANA AN-KALAMANJANA SY FITANGORONGORONANA NY BIRAO MONISIPALY MOMBA NY FAHADIOVANA SY NY FITANDREMANA NY FAHASALAMANA (BMFF)

11 Famoronana Fandaminana Anjara raharaha sy andraikitra NY TANIN'NY KAOMININA Ny tanim-bahoaka Anjara raharahan ny kaominina eo amin ny fitantanana ny tanim- panjakana, Faritany na Faritra NY FANATSARANA NY TANANA Ny drafitra fanatsarana ny tanàna Fanomezan-dàlana hamangitra sy ny fanomezan-dàlana hanorina Ny fikilasiana ny fanokanan-tany ao amin'ny tanim-panjakana NY TOBY FANAGIAZANA Ny fanagiazana Ny fe-potoana hiazonana Ny famoahana avy ao amin'ny toby fanagiazana Ny taratasin-draharaha tazonina FANDEVENANA - FAMADIHAN-DRAZANA -FITONDRANA RAZANA Ny fandevenana Ny fanomezan-dàlana handevina Ny famadihan-drazana Ny fitondrana razana

12 16.9 NY FANAMARINAN-TSONIA Ny fanamarinana ireo sora-draharaha tsy maintsy asiana hajia Saran ny fanamarinana Ny soratra fametraka NY HETRAN-TANY Famaritana Sehatra iharany Ny toerana anaovana ny hetra Ny fikajiana ny hetra NY HETRAN-TRANO Famaritana Sehatra iharany Ireo tany tsy hampiharana azy Ny fototra hanorenana ny hetra Ny toerana anaovana ny hetra Ny sata mifehy ny hetra Ny fikajiana ny hetra HABA ATOVANA AMN NY HETRAN-TRANO Famaritana Sehatra iharany Ny fototra hanorenana ny haba

13 Ny toerana anaovana ny haba Ny fikajiana ny haba NY HETRA ANTSOINA HOE " SYNTHETIQUE " Famaritana Sehatra iharany Ny toerana anaovana ny hetra Ny fototra iorenan'ny hetra Ny famoriana ny hetra Ny andraikitry ny mpandoa hetra NY SATA MOMBA NY FIVAROTANA ALIKAOLA SY NY VOKATRA MISY ALIKAOLA Fepetra ankapobe Ny fanafahana amin'ny fandoavan-ketra Ny aliokaola "éthylique" tsy nasiana fangarony Ny alikaola nasiana fangarony Ny sata mifehy ny fampandoavan-ketra Ny fitsinjarana ny vokatry ny hetra momba ny fahazoan-dàlana

14 1 FAMPIDIRANA Ity boky ity dia natao ho fitaovam-piasana, arak izany dia tsy natao ho vakiana manomboka amin'ny voalohany ka hatramin'ny farany izy ity, fa natao kosa mba ho jeren'ny Ben'ny tanàna na ireo tompon'andraikitra ao amin'ny Kaominina isaky ny misy loha-hevitra voafaritra mazava mampisalasala azy amin'ny andraikiny. Noho izany, dia mitana toerana lehibe ao anatin'ity boky ity ny momba ireo andraikitra sy rafitra na paika fanatanterahan'asa. Ny zava-kendren'ity boky ity dia ny hanamora araka izay azo atao ireo raharaha andavan'andron'ny tompon'andraikitry ny Kaominina sy hanatsara ny vokatra azo amin'ny asa monisipaly/kaominaly sady mikendry ny ahafahan'ireo tompon'andraikitra ireo manokana fotoana bebe kokoa amin'ny asa fihariana ho fampandrosoana. 2 NY KAOMININA Araka ny famaritana ao amin'ny Lalàmpanorenana, ny Kaominina dia vondrombahoakam-paritra itsinjaram-pahefana. Tahaka ny faritrara, izy dia "faritra iray eto amin ny Firenena ka ny fitambaran'ireo mponina ao aminy izay mpifidy sy mizaka ny zompirenena malagasy no mitondra ny asa aman-draharaha isamparitra sy eo an-toerana mba hampiroboroboana ny fampandrosoana ara-toe-karena, ara-tsosialy, arapahasalamana, ara-koltoraly, ara-tsiansa sy ara-teknolojia eo amin ny faripiadidiany". (Lalàna Lf , and. voalohany). Ny Kaominina, izay vondromparitra fehezin'ny lalàna mifehy ny Fanjakana dia manaraka ny zo aman'andraikitra ananan'ny isambatan'olona sy fizakan-tena ara-bola sy ara-pitondrana. Ireo rafitra ao aminy, ny Ben'ny tanàna sy ny mpanolontsaina dia fidin'ny daholobe mivantana, ary mitondra malalaka ny Kaominina. Tsara marihina anefa fa ny andininy faha-126, andalana faha-4 ao amin'ny Lalàmapanorenana dia milaza fa : "ny faritany mizakatena voalamina, ho vondrombahoakamparitra itsinjaram-pahefana dia ahitàna faritra sy Kaominina samy manana rantsana mandray fanapahan-kevitra sy rantsana mpanatanteraka". Ny fahefana sy tandrifim-pahefana ary loharanom-bolan'ny vondrom-paritra anapariaham-pahefana dia fehezin'ny lalàna lf

15 tamin'ny 26 avrily 1995 izay manamafy orina ny asa ara-pitondrana sahanin'ny Kaominina, nefa tsy manohintohina ny toeran'ny Fanjakana foibe mba ahafahany misahana tsara ny andraikiny. Ireo sehatry ny tandrifim-pahefan'ny Kaominina dia mikasika indrindra : - ny famantarana izay tena zava-dehibe ilaina sy olana lehibe ara-tsosialy misy ao amin'ny ambaratongan'ny Kaominina ; - ny fisahanana ireo raharaha mifandrohy amin'ireo zavatra ilaina sy olana ireo; - ny famaritana sy fanatontosana ireo lamin'asa momba ny fanatsarana ny toeram-ponenana sy ny fampitaovana ataon'ny Fanjakana miendrika fampandrosoana ny tanan-dehibe ; - ireo asa rehetra iandraiketana momba ny sorampiankohonana sy ny faripiadidiana miaramila ary ny fanisana ny mponina ; - ny fanatontosana izay asa atao ho fanampiana ny mpiarabelona ; - ireo fanatontosana ny asa momba ny fikarakarana sy fanaovana làlana, momba ny fanadiovana ny tanàna sy ny fitandremam-pahasalamana ary ny fanesorana ireo fako ao an-tokantrano ; - ny fanorenana sy fitantanana ny toerana falehan'ny besinimaro sy tsenambahoaka mbamin'ny sombin'ny sombim-paritra ijanonan'ny fiarakodia sy izay rehetra fampitaovana hafa mampidi-bola toy ny toerana famonoam-biby sy toerana misy ahi-maitso ; - ny fisorohana dieny mialoha ireo doro-tanety ary ny ady atao amin'izany ; - ny fitantanana ny fari-pananana izay azy manokana ny fananganana sy fitantanana fitaovana ary ny foto-drafitr'asa momba ny sosialy sy ny fanatanjahan-tena ; - ny fandavorariana any amin'ny ambaratonga misy azy izay asa atao sy fepetra raisina ka mifanentana amin izany mba hiarovana amin'ireo loza voajanahary ; 15

16 - ny fitantanana ny mpandraharaha iadidiany, noraisin'ny Vondrom-paritra anapariaham-pahefana mivantana hiasa ao aminy, nafindra asa na nomen'n'ny Fanjakana hampiasainy. Amin'ny maha-olomboafidy voalohany azy ao amin'ny Kaominina, ny Ben'ny tanàna amin'ireo sehatra ireo no tompon'andraikitra. Ny fahefana izay nomen'ny lalàna azy dia manome fahefam-pitondrana azy hahafahany mandray fanapahan-kevitra amin'ny anarany sy amin'ny anaran'ny Fanjakana, ary izany no mahatonga azy ho mpanelanelana manokana ny olompirenena ao amin'ny Kaominina misy az sy ny Solontenam-panjakana. 3 IREO TOMPON'ANDRAIKITRA AO AMIN'NY KAOMININA 3.1 NY FIFIDIANANA NY MPANOLONTSINA SY NY BEN'NY TANANA Fanaikana ny mpifidy Ny mpifidy dia antsoina handatsa-bato amin'ny didimpanjakana atao eo am-pivorian'ny Governemanta avoaka ao amin'ny Gazetim-panjakan'ny Repoblika telopolo andro farafahakeliny alohan'ny andro anaovana ny fifidianana. Ny didim-panjakana hanaikana ny mpifidy dia manondro: - Ny votoatin'ny fanaikana ny mpifidy ; - Ny andro hanaovana ny latsabato, ny ora tsy maintsy hanombohana azy ary ny ora tsy maintsy hifaranany; - Ny fari-potoana fanavaozana manokana ny lisitry ny mpifidy Fepetra ilaina hahafahana milatsaka ho fidina ho Mpanolontsaina sy ho Ben'ny tanàna Ireo kandidà amin'ny fifidianana ho Mpanolontsaina na Ben'ny tanàna dia tsy maintsy mahafeno ireto fepetra ireto : mizaka ny zom-pirenena malagasy ; 16

17 monina na mpandoa hetra ao amin'ny kaominina ; feno iraika amby roapolo taona katroka amin'ny andro anaovana ny fifidianana ; mizaka ny zon'ny isam-batan'olona sy ny zony politika ; voasoratra anarana amin'ny lisitry ny mpifidy ao amin'ny faripiadidiana iray eto amin'ny tanim-pirenena ; manana firaketan-tsazy ara-pitsarana madio ; mahafeno ny fepetra voalazan'ny lalàna sy ny fitsipika momba ny hetra ary indrindra efa nahaloa ireo hetra sy haba isan-karazany takiana aminy tato anatin'ny taona efatra farany. Ambonin'izany, ireo mpandraharaha na ireo mpitrandraka ny tolotanim-panjakana voarohy amin'ny alalan'ny fifanarahana natao niaraka tamin'ny Kaominina mametraka azy ireo hiankinan-doha na hiombon-tombontsoa amin'ny Kaominina dia tsy mahazo mirotsaka ho fidina Ny amin'ny tsy fahazoana mampirafy raharaha sy ny fanonganana Tsy azo ampirafesina amin'ny andraikitry ny olomboafidy ao amin'ny Kaominina izay rehetra andraikitra hafa mahavoafidy amin'ny asambahoaka. Ny fisahanana ny andraikitry ny Mpanolontsaina na ny Ben'ny tanàna dia tsy azo ampirafesina amin'ny fanaovana ny asan'ny : mambran'ny Fitsarana Avo momba ny Lalàmpanorenana mambran'ny Filan-kevi-pirenena momba ny Fifidianana mpanelanelana mpampihavana mambran'ny Govememanta Sekretera Jeneraly, Tale Jeneraly, Talen'ny Andrimpanjakan'ny Repoblika sy ny Minisitera mpiasa karamain'ny Kaominina 17

18 mpitana ny kaontin'ny Kaominina Ny fisehoan'ny iray amin ireo antony tsy mahavoafidy ireo na ny fisian'ny fanamelohana manafoana ny zo isam-batan'olona mandritra ny fiandraiketana asa nahavoafidy dia mitarika ny fanonganana ilay olomboafidy. Na manao ahoana na manao ahoana ny fisehoan-javatra, ny fanonganana dia hamarinin'ny fanapahana ataon'ny ambaratongam-pitsarana mahefa araka ny fitoriana nataon'ny Solontenam-panjakana mahefa, na izay mpifidy rehetra ao amin'ny Kaominina. 3.2 NY MPANOLONTSAINA MONISIPALY NA KAOMINALY Isan'ny Mapnolontsaina monisipaly na kaominaly Ny isan'ny Mpanolontsaina monisipaly na kaominaly dia ferana ho". (Lalàna lf mikasika ny fifidianana isam-paritra) - Mpanolontsaina kaominaly 8 any amin'ny Kaominina ambanivohitra izay latsaka na sahala amin'ny ny isan'ny mponina ao aminy; - Mpanolontsaina kaominaly 14 any amin'ny Kaominina ambanivohitra izay mihoatry ny ny isan'ny mponina ao aminy; - Mpanolontsaina monisipaly 15 any amin'ny Kaominina ambonivohitra izay latsaky na sahala amin'ny ny mponina ao aminy ; - Mpanolontsaina monisipaly 17 any amin'ny Kaominina ambonivohitra izay miisa ka hatramin'ny ny mponina ao aminy; - Mpanolontsaina monisipaly 19 any amin'ny Kaominina ambonivohitra izay miisa ka hatramin'ny ny mponina ao aminy; - Mpanolontsaina monisipaly 21 any amin'ny Kaominina ambonivohitra izay miisa ka hatramin'ny ny mponina ao aminy; - Mpanolontsaina monisipaly 23 any amin'ny Kaominina ambonivohitra izay miisa ka hatramin'ny ny Inponina ao aminy ; 18

19 - Mpanolontsaina monisipaly 25 any amin'ny Kaominina ambonivohitra izay mihoatry ny isan'ny mponina ao aminy Ny biraon'ny Filankevitra Ny toeram-piasan'ny Filankevitra monisipaly na kaominaly dia ao amin'ny Lapan'ny tanàna na ao amin'ny biraon'ny Kaominina. Amin'ny fanavaozana ankapoben'ny Filankevitra, ny fivoriana voalohany dia atao, araka ny fiantsoana ataon'ny Solontenampanjakana, ny zoma voalohany raha aingana indrindra, ary ny alahady faharoa manaraka ny dimy ambinifolo andro aorian'ny ny famoahana amin'ny fomba ofisialy ny voka-pifidianana izay nahavoafidy ny Mpanolontsaina rehetra raha ela indrindra (and. 5 amin'ny lalàna lf ) Ny biraon'ny Filankevitra dia fidin'ny Mpanolontsaina ary ahitàna : - Filoha iray (1) - Filoha Lefitra iray (1) - Mpampakateny roa (2) Lalàna lf tamin ny 26 avrily 1995 mikasika ny fandaminana sy ny tomba fiasa ary anjara raharahan ny Vondrom-paritra anapariaham-pahefana, and Ny fiasan ny Filankevitra Ny Filankevitra no mametra ny fepetra momba ny fiasany ao amin'ny Fitsipika anatiny izay lanian'ny Filankevitra. Antsoina hivory ara-potoana in-droa isan-taona ny Filankevitra. Folo andro raha be indrindra ny faharetan'ny fotoam-pivoriana ara-potoana, izay atao 15 andro amin'ny fivoriana handinihina ny tetibolam-panombohana. Ny fiantsoana ny Filankevitra hivory dia hatao araka ny fandaharam-potoana voafaritra tsara didin'ny Ben'ny tanàna sy ny Filohan'ny Filankevitra miaraka. Ny faharetan'ny fotoam-pivoriana dia faritana araka ny habetsaky ny fandaharam-potoana. Ny fotoam-pivoriana voalohany isan-taona dia handinihina ny kaontimpitantanan'ny taom-piasana teo aloha sy ny teti-bola fanampiny. Ny fotoam-pivoriana faharoa dia handinihina ny teti-bola amin'ny taom-piasana manaraka. Ny Filankevitra dia mivory tsy ara-potoana isaky ny mitaky izany ny raharahan'ny Kaominina, na noho ny fangatahan'ny Ben'ny tanàna, ny iray ampahatelon'ny Mpanolontsaina 19

20 na ny Solontenampanjakana, araka ny fandaharam-potoana voafaritra tsara. Kanefa na manao ahoana na manao ahona dia tsy mahazo atao mihoatra ny telo andro ny faharetan'ny fivoriana tsy ara-potoana (and. faha-8 amin'ny lalàna lf ), Mandray anjara amin'ireo asa sy adihevitra ataon'ny Filankevitra ny Ben'ny tanàna, nefa dia ho fakana hevitra fotsiny izy amin'izany. Horaiketina ao anatin'ireo fitanana an-tsoratra momba ny fivoriana ny firotsahany mandray fitenenana. (and. faha-11 amin'ny lalàna lf ). Ny solontenam-panjakana dia afaka, raha mangataka izany, ho henoin'ny Filankevitra sy mandray anjara amin'ny adi-hevitra. Horaiketina ao anatin'ireo fitanana an-tsoratra momba ny fivoriana ny firotsahany mandray fitenenana (and. faha-9 amin'ny lalàna lf ). Afaka mandray fanapahan-kevitra ara-dalàna ny Filankevitra rehefa manatrika ny fivoriana na voasolo-tena ny ankamaroan'ny mambra amperin'asa ao aminy, raha tsy izany dia asiana fiantsoana fivoriana faharoa handinihina ny fandaharam-potoana teo ihany saingy tsy misy fitakiana fepetra momba ny fahatongavan'ny mambra intsony. Ny fanapahan-kevitra dia raisin'ny ankamaroan'ireo mambra. Ny fiandanian'ny Filoha no mavesa-danja (afa-tsy ireo fifidianana miafina). An'ny tena irery ihany ny zon'ny Mpanolontsina handatsa-bato, nefa azo atao ny mamindra izany amin'ny Mpanolontsaina hafa. Tsy mahazo mandray afa-tsy fanomezam-pahefana iray ihany ny Mpanolontsaina iray. Ampahibemaso ny fivorian'ny Filankevitra. Afaka mangataka hanao fanapahan-kevitra tsy ampahibemaso ny Filoha, ny Ben'ny tanàna na ny ampahefatry ny Mpanolontsaina. Atao peta-drindrina ny tatitra momba ny fivoriana. Tsy maintsy soratana ao amin'ny rejisitra izay voaisa ravina sy vitan'ny Solontenampanjakana rango-pohy ireo fanapahan-kevitra arakaraka ny taona nanaovana azy. Ny fanapahan-kevitra dia soniavin'ireo Mapnolontsaina rehetra manatrika ny fivoriana. Ny fanapahan-kevitry ny Filankevitra dia omen'ny Ben'ny tanàna fampiharana ary alefa any, amin'ny Solontenam-panjakana hanaovany ny fanaraha-maso ny fanarahan-dalàna Ny fiantsoana ny Filankevitra. Ny Filohany no manaika ny Filankevitra hivory. Fiantsoana vita an-tsoratra no tsy maintsy alefa any amin'ny Mpanolontsaina tsirairay any an-tranony farafahakeliny folo andro katroka mialoha ny fivoriana, izay ahena ho telo andro raha toa ka fiantsoana faharoa mikasika 20

21 fandaharam-potoana mitovy ihany rehefa tsy nahavory ny ankamaroan'ny mambra amperinasa ny fivoriana voalohany. Ny Fiantsoana dia ahitàna : - ny fandaharam-potoanan'ny fivoriana ny andro ; - ny ora ary ny toerana hivoriana ; - ny faharetan'ny fivoriana ; - ny sonian'ny Filohan'ny Flankevitra - naoty famintinana ireo raharaha handraisana fanapahankevitra. Isaky ny mitaky izany ny raharahan'ny Kaominina ary araka ny fandaharam-potoana voafaritra tsara, dia mivory tsy ara-potoana ny Filankevitra, izay tsy mahazo mihoatra ny telo andro no faharetany rehefa nagatahan'ny : - birao mpanatanteraka ; - na ny ampahatelon'ny Mpanolontsaina ; - na ny Solontenam-panjakana (and. faha-8 amin ny lalàna lf ). Azon'ny Filohan'ny Filankevitra afohezina ny fe-potoana iantsoana ny fivoriana tsy arapotoana araka ny fangatahan'ny Solontenam-panjakana, kanefa tsy azo atao latsaky ny iray andro katroka izany Ny vaomiera Ny vaomiera dia atsangana amin'ny alalan'ny fanapahan-kevitry ny Filankevitra. Ny vaomiera no manomana ny asan'ny Filankevitra. Ny karazan'ny vaomiera isan isany, ny isan'ny mambra, ny fomba fanendrena ary ny fitsipika mikasika ny fomba fiasany dia faritan'ny fitsipika an-tokantrano mifehy ny Filankevitra. Tsy maintsy mambra anatina vaomiera iray farafakeliny ny Mpanolontsaina tsirairay avy. Ny asan'ny vaomiera dia tsy handoavana tambin-karama ary tsy azo hatao amin'ny andro tsy fiasana na aorian'ny ora fiasana. Azon'ny vaomiera antsoina 21

22 amin'ny asany, hakan-kevitra ny olona mahasolo-tena ny vahoaka na ireo teknisiana manampahalalana manokana amin'ny raharaha dinihina. Ny vaomiera tokony ajoro dia : - ny vaomieran'ny vola ; - ny vaomieran ny sosialy, ny fanatanjahan-tena ary ny kolotsaina - ny vaomieram'ny fanatsarana ny tanàna, ny fanajariana ary ny fampandrosoana; - ny vaomieran'ny fifandraisana sy ny fampahalalam-baovao Ny andraikitry ny Filankevitra Ny Filankevitra no mandamina amin'ireo fanapahan-kevitra ataony ireo raharaha nankinin'ny lalàna mba hiantsorohany araka ny tandrifim-pahefany, indrindra indrindra : - ny teti-bola sy ny kaontim-pitantanana atolotry ny Ben'ny tanànany - fananganana sampan-draharaha sy antokon-draharaha ary tranon'asa isamparitra sy eo an-toerana ; - ireo lahasa momba ny fananana (fivarotana, famindrana,...) na ny famonoana ny fanoratana tany atao antoka ; - ny findramam-bola ; - ny drafitra fanatsarana ny tanàna ; - fanovàna ireo fotodrafitrasan'ny Kaominina (làlana, rantsandàlana,... ) ; - ny fanekena handray fanomezana sy lova - tolotra fanekena hiombona antoka ; - ny famaritana ny fombafomba fandraisan'ny Kaominina anjara amin'ny lahasa iaraha-manao amin'ny vondromparitra hafa ; 22

23 - ny fahafoizana na fanofana sampan-draharaham-panjakana na fotodrafitrasa ; - ny fanaovana Dina ; - fandaniana sy famerana hetra sy haba neken'ny lalàna ; - ny famerana ny saran'ny asa vita sy ny fampiasana ny fananana ; - ny fanendrena ny solontenan'ny Kaominina ao amin'ny Vaomieram-panjakana miandraikitra ny famaranana ny lisi-pifidianana. Ny Filankevitra no mankatò ny tatitra atolotry ny Ben'ny tanàna ary manamarina izany Ny sora-draharahan'ny Filankevitra a) Ny fitanana an-tsoratra ny fivoriana Ny fitanana an-tsoratra ny fivoriana dia raketina ao amin'ny rejisitra voaisa ravina sy vitan'ny Solontenam-panjakana rango-pohy ary ahitàna : - ny andro sy toerana nanaovana ny fivoriana ; - ny anaran'ny Filoha sy ny mpampaka-teny ; - ny fandaharam-potoana ; - ny laharana ary ny andro nanaovana ny fiantsoana ny Mapnolontsaina ; - ny tatitry ny adi-hevitra ary fanamarihina ireo fanapahan-kevitra tsirairay miaraka amin'ny isan'ireo Mpanolontsaina nandray anjara tamin'ny latsa-bato sy ny vokatr'izany ; - ny anarana sy fanampin'anaran'ireo Mpanolontsaina tonga nivory, ireo tsy tonga niera ary ireo tsy tonga tsy niera ; - ny anarana, fanampin'anarana ary andraikitr'ireo olona nasaina. 23

24 Ny fitanana an-tsoratra voasonian'ny Mpitarika ny fivoriana sy ny Mpampaka-teny dia tsy maintsy ampiarahana amin'ny fanamarinam-pahatongavana isan'andro voasonian'ny Mpanolontsaina tena tonga marina. b) Ny dinan'asa Ny dinan'asa dia arafitra sy laniana mitovy tsy misy valaka amin'ny fanapahan-kevitra. Afa-tsy raha misy fepetra manokana na mifanohitra voalaza amin'ny fifanarahana iraisampirenena nataon'ny Repoblikan'i Madagasikara, ny dinan'asa dia tanterahan'ny mponin'ny kaominina izay mampihatra azy (and. 42 amin ny lalàna lf ). d) Ny fanapahan-kevitra Ny fanapahan-kevitry ny filan-kevitra, nomena laharana amin'ny antotan-daharana manomboka amin'ny 1 ny 1 janoary dia raketina ao amin'ny rejisitra vitan'ny solontenampanjakana rangopohy. Ny fanapahan-kevitra dia arafitra araka ny modely toy izao: 24

25 REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana Faritany Mizakatena MAHAJANGA Faritr'i SOFIA Kaominina Ambanivohitr i BEALANANA Fanapahan-kevitra laharana faha-56/1999 nataon'ny Filankevitra monisipaly/kaominalin ny Kaominina ambonivohitra/ambanivohitr i Bealanana, nivory ny 15 desambra 99 araka ny fiantsoana laharana faha-25 tamin ny 5 desambra 99. Ny Filankevitra monisipaly/kaominalin ny Kaominina ambonivohitra/ambanivohitr'i Bealanana, Araka ny lalàna lf ; Araka ny lalàna lf ; Araka ny tolo-kevitra nataon Atoa/Rtoa (1) Rehefa nohenoina ny famelabelaran Atoa/Rtoa (2) Rehefa avy nanapa-kevitra Niarahan'ny rehetra nandany na neken ny...(3) Tamin ny (4) Dia mandray izao fanapahan-kevitra izao : Andininy voalohany : (5) Ny mambra rehetra tonga dia nanasonia ny fitanana an-tsoratra afa-tsy (6) Natao sy notapahana tao Bealanana, ny 15 desambra 99 Ny Filohan'ny Filankevitra, Ny Mpanolontsaina, Nomen-kery mba ho hampiharina tao Bealanana, ny 19 désambra 99. Ny Ben'ny tanàna (1) anaran'ny ben'ny tanàna na ny Mpanolontsaina nanao ny tolo-kevitra (2) anaran'ireo Mpanolontsaina nandray fitenenana nandritra ny adi-hevitra (3) isan'ny Mpanolontsaina nandany ny fanapahan-kevitra (4) isan'ny Mpanolontsaina nanatrika ny fivoriana (5) filazalazana ny famintinana ny fanapahan-kevitra (6) anaran'ireo Mpanolontsaina nadà ny hanao sonia 25

26 3.2.8 Ny tambi-karama Ny asa atao ao anatin'ny Filankevitra dia maimaimpoana. Azon'ny Filankevitra hatao anefa ny mandany fanomezana tambin-karama isan'andro amin'ny fivoriana omena ny Filoha sy ny Mpanolontsaina tena nanatrika ny fe-potoam-pivorian'ny Filankevitra araka ny fetra voafaritry ny didim-panjakana lf araka izao : Sokajina Kaominina Fi1oha Mpanolontsaina Kaominina ambonivohitra ivelan ny Sokajy Ariary 8000 ariary Kaominina ambonivohitra Sokajy voalohany ariary 6000 ariary Kaominina ambonivohitra Sokajy faharoa 9600 ariary 4800 ariary Kaominina ambanivohitra Sokajy voalohany 7200 ariary 3600 ariary Kaominina ambanivohitra Sokajy faharoa 5600 ariary 2800 ariary Azon'ny Filankevitra atao koa ny manome tambim-pandraisana isan-taona ny Filohan'ny Filankevitra araka iazo famaritana izao : Sokajina Kaominina Farafahakeliny Farafahabetsany Kaominina ambonivohitra ivelan'ny Sokajy ariary ariary Kaominina ambonivohitra Sokajy voalohany ariary ariary Kaominina ambonivohitra Sokajy faharoa ariary ariary Kaominina ambanivohitra Sokajy voalohany ariary ariary Kaominina ambanivohitra Sokajy faharoa ariary ariary 26

27 Ny tambim-bola amin'ny mety ho fandehandehanana dia fehezin'ny fepetra fampihatra amin'ny mpiasam-panjakana araka ny fisokajiana toy izao (Didim-panjakana lf tamin ny 7 septambra 1960) : - Kaominina ambonivohitra ivelan'ny Sokajy sy Sokajy voalohany - Kaominina ambonivohitra Sokajy faharoa - Kaominina ambanivohitra Sokajy voalohany sy faharoa Mandritra ny fe-potoam-pivoriana, ny Mpanolontsaina dia manana ny zo fidirana amin'ny trano fitsaboam-panjakana fanome ny mpiasam-panjakana. Ny lany amin'ny fitsaboana araka ny sarany fampihatra dia zakain'ny teti-bolan'ny kaominina hatramin'izay mifanadrify amin'ny sorabola, ka zakain'ny mahazo tombo-tsoa araka izao 80% no anjaran'ny Kaominina ary 20% zakain'ny voakasik'izany. Ny tambim-bola dia tsy isan'ny fandaniana tsy maintsy ataon'ny kaominina. 3.3 NY BEN'NY TANANA - LEHIBEN'NY FITONDRAN-DRAHARAHA KAOMINALY Fandaminana ny mpanantanteraka Ny Ben'ny tanàna no manendry ny mambran'ny birao mpanatanteraka amin'ireo tompon'andraikitry ny sampan-draharaham-panjakana naorina sy zakain'ny volan'ny kaominina na ireo sampan-draharaha omen'ny Fanjakana, izay hisahana ny fanampiana azy amin'ny fitondran-draharahan'ny Kaominina. Ny Birao mpanatanteraka no mifidy amin'ny mambra ao aminy ireo Lefîtry ny Ben'ny tanàna. Ny Ben'ny tanàna no mametra ny isan'ny mambran'ny Birao mpanatanteraka sy ny Lefiny. Ny Ben'ny tanàna no lehiben'ny fitondran-draharahan'ny Kaominina. Azon'ny Ben'ny tanàna omena ny lefiny, amin'ny alalan'ny didim-pitondrana ataony, ny sasantsany amin'ireo andraikiny ka eo ambany fanarahany maso sy andraikiny. Tsara raha ferana ny isan'ny mambran'ny Birao mpanantateraka hifanaraka amin'ny isan'ireo Lefitry ny Ben'ny tanàna azo omem-pahefana tena handray anjara amin'ny fitondran-draharaha ao amin'ny kaominina. 27

28 3.3.2 Ny andraikitry ny Ben'ny tanàna Ny Ben'ny tanàna dia manana andraikitra azy manokana tanisain'ny lalàna lf sy ny didim-panjakana lf sy andraikitra omen'ny Filankevitra azy amin'ny alalan'ny fanomezam-pahefana. Ny Ben'ny tanàna no : manomana sy manolotra ny teti-bola eo amin'ny Filankevita ; manatanteraka ny teti-bola nolaniana eo amin'ny vola mivoaka sy eo amin'ny vola miditra ; misolotena ny Kaominina amin'ireo raharaha mikasika ny fiainana ara-tsivily sy arapanjakana ary misolotena azy eo amin'ny fitsarana ; mandray mpiasa sy manendry olona amin'ny asa rehetra araka ny ambaratongandrafitr'asa nankatoavin'ny Filankevitra araka ny fetran'ny sora-bola ao amin'ny tetibola. mampiasa ireo sampandraharaham-panjakana amin'ny fanomanana sy ny fanatanterahana ireo fanapahan-kevitry ny Filankevitra rehefa nanao fangatahana tamin'ny Solontenam-panjakana ; manana fahefana ara-pitandroana ny filaminana manome ny alalana amin'ny famangitana ny fetran-tany sy ny alalana hanorina ; manamarina sonia mandray anjara amin'ny fanaovana ny lisi-pifidianana sy ny fandaminana ny fifidianana mirakitra ny soram-piankohonana sy manoratra ny fanambadiana ; mambra araka ny lalàna ao amin'ny Komitim-paritry ny Fampandrosoana. 28

29 Ankoatr'izany, azon'ny Filankevitra Monisipaly na Kaominaly atao amin'ny alalan'ny fanapahan-kevitra, ny manome fahefana ny Ben'ny tanàna mandritra ny fe-potoam-piasany, amin'ireto : mifanaiky amin'ny findramam-bola entina hamatsiana asam-pamokarana izay tsy mahazo mihoatra ny mari-bola feran'ny Filankevitra ny habetsany ; manao fifanaraham-barotra araka ny fetran'ny sora-bola misy ao amin'ny teti-bola ; manao fifanarahana amin'ny trano fiantohana manao fanekena handray tolo-pananana sy lova izay tsy manisyfepetra izany na andraikitra ; mivarotra na mividy fanana-mifaka izay tsy mahazo mihoatra ny mari-bola nofaritan'ny Filankevitra ny vidiny mametra ny karaman'ny mpisolovava, notera, vadin-tany. Azon'ny Filankevitra foanana amin'ny fotoana rehetra ny fanomezam-pahefana. Raha tsy nanao fanomezam-pahefana ny Filankevitra dia raisina amin'ny alalan'ny fanapahan-kevitra ny fanapahana tsirairay Ny sora-draharahan'ny Ben'ny tanàna Ny Ben'ny tanàna no manome hery fampiharana ny fanapahan-kevitry ny Filankevitra ary mandray didim-pitondrana amin'ireo fahefany manokana sy ireo fahefana nomena azy. Ny didim-pitondrana ataon'ny Ben'ny tanàna dia soratana ao amin'ny rejisitra vitan'ny Solontenampanjakana rango-pohy ary omena laharana mifanaraka amin'ny vanim-potoana nanaovana azy isan-taona ka manomboka amin'ny 1 ny 1 janoary. Tahaka izao modely manaraka izao no hanoratana ny didim-pitondrana : 29

30 REPOBLIKAN I MADAGASIKARA Tanindrazana -Fahafakana Fandrosoana Faritany Mizakatenan'i... Faritr'i... KaomininaAmbanivohitra/Ambonivohitr'i... Didim-pitondrana lf.../1999 Ny Ben ny tanànan'ny Kaominina Ambanivohitra/Ambonivohitr'i... Araka ny Lalàmpanorenana Araka ny lalàna lf , indrindra ny andininy faha-83, Dia mandidy : Andininy voalohany Ny fandehanana sy fijanonan'ny fiara dia raràna isaky ny zoma manomboka amin ny 6 ora Maraina ka hatramin ny 2 ora tolakandro eo amin ny tsena voafatitra toy izao... Andininy 2 Ny fandikana izao didim-pitondrana izao dia iharan ny sazy voalaza ao amin'ny andininy faha-473 ao amin ny fehezan-dalàna famaizana. Andininy 3 - Ny mpandray haban-tsena, ny kaomiseran ny polisy ary ireo mpiasa mpitandro filaminana dia miandraikitra ny fampiharana ity didim-pitondrana ity izay ho soratana, haseho ampahibe-maso ary halefa na aiza na aiza ilàna azy. Natao tao... ny... Ny Ben'ny tanàna Ny Ben'ny tanàna no misahana ny famoahana sy ny fametrahana ny fanapahan-kevitra sy didim-pitondrana (na fanapahana) any amin'ny Solontenam-panjakana hanaovana ny fanarahamaso amin'ny fanarahan-dalàna. Ny daty handraisana izany any amin'ny Vaki-pileovana no hanombohan'ny 30 andro omena ny Soprefe hitondrana ny sora-draharaha any amin'ny Chambre Administrative. Noho izany dia tsara ihany ny hangatahan'ny Ben'ny tanàna ny hanoratan'ny mpiraki-draharaha ao amin ny Vaki-pileovana ny daty nadraisany ny soradraharaha amin'ny dika mitovy iray faharoa ho tehirizin'ny Kaominina. 30

31 3.3.4 Ny tambim-bola samihafa Ny tambin-karaman'ny Ben'ny tanàna dia kajiana amin'ny fampiharana ny régime ny marikarama amin'ny Asam-panjakana amin'ny mari-karama fonctionnel feran'ny fanapahan-kevitry ny Filankevitra izay tsy mahazo mihoatra ny (didim-panjakana lf-96170) : marik isa any amin'ny kaominina ambonivohitra ivelan'ny sokajy ; marik'isa any amin'ny Kaominina ambonivohitra sokajy voalohany ; marik'isa any amin'ny Kaominina ambonivohitra faharoa ; marik'isa any amin'ny Kaomiriina ambanivohitra sokajy voalohany ; marik'isa any amin'ny Kaominina ambanivohitra sokajy faharoa ; tanàna. Ny tambin-karaman'ny Lefitra dia ferana ho ny 2/3-n ny tambinkaraman'ny Ben'ny Ny tambin-karaman'ny mambran'ny Birao mpanatanteraka, ankoatry ny Lefitra, dia feran'ny fanapahan-kevitry ny filankevitra, anefa tsy mahazo mihoatra ny : ariary isam-bolana any amin'ny Kaominina ambonivohittra ivelan'ny sokajy ; ariary isam-bolana any amin'ny Kaominina ambonivohitra sokajy voalohany; ariary isam-bolana any amin'ny Kaominina ambonivohitra sokajy faharoa; ariary isam-bolana any amin'ny Kaominina ambanivohitra sokajy voalohany ariary isam-bolana any amin'ny Kaominina ambanivohitra sokajy faharoa. 31

32 Mandritra ny fe-potoana fiasany dia mahazo ny tombo-tsoa fanome ny mpiasampanjakana amin'ny régime hidirana any amin'ny trano fitsaboam-panjakana ny Ben'ny tanàna sy ireo Lefitra. Ny lany amin'ny fitsaboana araka ny sarany fampihatra dia zakain'ny mahazo tombo-tsoa sy ny teti-bolan'ny kaominina hatamin'izay mifanadrify amin'ny sora-bola, ka : 80% no zakain'ny Kaominina ary 20% zakain'ny voakasik'izany. Ny tambim-bola dia tsy isan ny fandaniana tsy maintsy ataon ny kaominina, afa-tsy ny karama ara-mari-karama, omena ny Ben ny tanàna sy ireo Lefiny. Famintinana ireo tambim-bola azon'ny tomponlandraikitra monisipaly/kaominaly : Ny mahazo Kaominina Kaominina Kaominina Tombontsoa Ambonivohitra ivelan'ny Sokajy Ambonivohitra Sokajy voalohany Abonivohitra Sokajy faharoa Tambi-karama isam-bolana Ben'ny tanàna Mari-bola farany Mari-bola farany Mari-bola farany Kaominina Kaominina Abnivohitra Sokajy Abanivohitra voalohany Sokajy faharoa Mari-bola farany Mari-bola farany ambony Marikaraina ambony Mari- ambony Mari- ambony Mari- ambony Mari karama 2000 karama 1500 karama 1200 karama 1000 Lefîtry ny Ben'ny Latsaka na Latsaka na Latsaka na Tanàna mitovy2/3 Marikarama300karaina mitovy2/3 Mari- mitovy2/3 Mari karama 1500 Birao Mari-bola farany Mari-bola farany Mari-bola farany mpanatanteraka ambony ambony ambony ariary ariary ariary Tambi-karama isam-pivoriana Latsaka na mitovy Latsaka na mitovy 2/3 Mari-karaina 2/3 Mari-karama Mari-bola farany Mari-bola farany ambony ambony ariary ariary Filohan'ny ariary ariary 9600 ariary 7200 ariary 5600 ariary Filankevitra Mpanolontsaina 8000 ariary 6000 ariary 4800 ariary 3600 ariary 2800 ariary Tambim-bola omena amin ny fandehanana manatrika ny fivorian'ny Filankevitra isan'andro Filohan'ny Filankevitra Saran-dàlana hatramin'ny 3000 Saran-dàlana hatramin'ny 3000 Saran-dàlana hatramin'ny 3000 Saran-dàlana hatramin'ny 3000 Saran-dàlana hatramin'ny 3000 ariary ariary ariary ariary ariary Mpanolontsaina Saran-dàlana hatramin'ny 3000 Saran-dàlana hatramin'ny 3000 Saran-dàlana hatramin'ny 2400 Saran-dàlana hatramin'ny Saran-dàlana hatramin'ny ariary ariary ariary fmg fmg Indemnité de déplacement pour mission par jour Ben'ny tanàna/ Saran-dàlana Saran-dàlana Saran-dàlana Saran-dàlana Filohan'ny hatramin'ny 3000 hatramin'ny 3000 hatramin'ny 3000 hatramin'ny 3000 Filankevitra/Lefîtra / Mpanolontsaina ariary ariary ariary ariary Saran-dàlana hatramin'ny 3000 ariary 32

33 Remboursement des frais de transport Ben'ny tanàna/ Famerenam-bola Famerenam-bola Famerenam-bola Filohan'ny atao araka ny atao araka ny atao araka ny Filankevitra/Lefîtra /Mpanolontsaina taratasy fanamarinana taratasy fanamarinana taratasy fanamarinana Tambim-bola noho ny fisoloan-tena Ben'ny tanàna Mari-bola feran'ny Mari-bola feran'ny Mari-bola feran'ny latsabato ataon'ny latsabato ataon'ny latsabato ataon'ny Filankevitra Filankevitra Filankevitra Tambim-bola noho ny fandraisana isan-taona Filohan'ny Eo anelanelan'ny Eo anelanelan ny Eo anelanelan'ny Filankevitra sy ariary sy ariary sy ariary Tambim-bola noho ny fitehirizam-bola omena ny Mpitahiry Vola Mpitahiry vola And. 14 amin'ny And. 14 amin'ny And. 14 amin'ny didim-panjakana lf- didim-panjakana lf- didim-panjakana lf tamin'ny tamin ny tamin'ny 1 Aogositra 1990 Aogositra 1990 Aogositra 1990 Famerenam-bola atao araka ny taratasy fanamarinana Mari-bola feran'ny latsabato ataon'ny Filankevitra Eo anelanelan'ny sy ariary And. 14 amin'ny didim-panjakana lf tamin'ny 1 Aogositra 1990 Famerenam-bola atao araka ny taratasy fanamarinana Mari-bola feran'ny latsabato ataon'ny Filankevitra Eo anelanelan'ny sy ariary And. 14 amin'ny didim-panjakana lf tamin'ny 1 Aogositra FANDAMINANA NY KAOMININA 4.1 NY RAFITR'ASA Ny rafitr'asan'ny Kaominina dia mametra ireo foto-kevi-pandaminana ireo sampandraharahan'ny Kaominina. Fisy isan-toerana no mamaritra ny andraikitra mazavan'ny tsirairay isaky ny toerana ao amin'ny rafitr'asa. Ny tanjona kendrena amin'ny rafitr'asa dia ny hanatsarana ny fahombiazan'ireo sampandraharaha amin'ny fanondroana mazava ireo andraikitra sy fitoeran'ny tsirairay isan'ambaratonga. Ny baiko omena ny mpiasa ao amin'ny Kaominina dia tsy maintsy manaja ny ambaratongam-pahefana voafaritry ny rafitr'asa. Ny toeran'ny mpandrindra ankapobe (na ny Sekretera Jeneraly) dia apetraka eo amin'ny fara-tapony ao amin'ny fitondran-draharaha kaominaly. Ireo baiko omen'ny Ben'ny tanàna sy ireo Lefiny ho an'ireo sampan-draharaha dia mandalo amin'ny tompon'andraikitry ny fandrindran'asa izay mampanatanteraka izany ny sampandraharaha sy manao ny tatitra. Io fepetra io dia sady manala ny Ben'ny tanàna amin'ny asam-pitantanana, miantoka ny rindrandamina ankapobeny, ahafahana miala amin'ny baiko mifanohitra no manamora ny fanaraha-maso ny fanatanterahana ny fanapahana. 33

34 Matetika ny rafit'asa vaovao dia mitarika famoronana toerana maro ilaina noho ny fitombon'ny asa sahanin'ny kaominina sy ireo raharaha ilàna fahaizana manokana izay antoky ny hatsaran'ny asa avo lenta. Tsara raha ampiharina miandalana ny rafitr'asa arakaraky ny haben'ny Kaominina, ny loharanom-bola azony hampiasaina ary ny fiantsorohany andraikitra vaovao. Amin'ny voalohany dia azo omena mpiasa iray na ny tompon'andraikitra isaky ny ambaratongam-pahefana ny toerana sasantsasany. Tokony ho latsaky ny isan'ny mpiasa ao amin'ny Kaominina misy mponina mihoatra ny , ny isan'ny mpiasa ao amin'ny Kaominina misy mponina latsaky ny ary noho izany dia tokony tsy havesatra loatra ny rafitr'asa. Raha toa ka tsy ampy hosahanin'ny mpiasa raikitra ny asa amin'ny toerana iray kanefa tsy misy mpiasa afaka hisahana ny andraikitra amin'izany toerana izany, dia tsara ny hampiharana ny fanaovana asa amin'ny fotoana tsy mitohy. Ao amin'ny rafitr'asan'ny Kamoninina ambanivohita sokajy faharoa, dia eo ambany fahefan'ny Ben'ny tanàna mivantana sy eo ambany fanaraha-mason'ny Soprefe ny sekretera mpitahiry vola, kanefa amin'izany izy dia tsy misy fifandraisana ara-ambaratonga amin'ireo sampan-draharaha Kaominaly hafa. Ny fanendrena sekretera mpitahiry vola dia fepetra manamora ireo raharahan'ny Kaominina amin'ny toerana tsy misy mpitana kaontin'ny Fitehirizam-bolampanjakana, kanefa ny fisarahan'asa aman'andraikitra dia tazonina ho zavadehibe mba ahatsara ny fampiasana ny volam-panjakana. Ny fametrahana sekretera mpitahiry vola ao amin'ny trano fiasan'ny Kaominina dia midika ny tsy ilàna famoronana fitantanana famoriam-bola. Ny fandoavam-bola dia tanterahana mivantana avy amin'ny tahiry tazoniny ary ny percepteurs dia mipetraka eo ambany fahefany. Any amin'ny Kaominina hafa, ny mpitàna kaonty dia ny Receveur principal. Manamora ny famoriam-bola ny fanendrena mpitantana famoriam-bola izay misahana ny fandraisana ireo fandoavam-bola sy mitarika ireo mpiasa miandraikitra ny fanangonam-bola. 4.2 NY FANDAMI NANA NY KAOMININA ARA-PARITRA : NY FOKONTANY Ny Kaominina no Vondrom-paritra fototra ary izany dia mitarika ny fanovàna ny Fokontany ho rafitra ara-pitondrana tsy manana zo aman'andraikitra azy manokana araka ny lalàna sy fahatapahantena ara-bola. Ny fiasan'ny Fokontany dia fehezin'ny didim-pitondrana lf tamin'ny 30 oktobra

35 Ny Fokontany dia entin'ny Komity misy mambra 5 ka hatrami'ny 10 fidin'ny fivoriamben'ny Fokontany tarihin'ny Ben'ny tanàna. Ny isan'ny mambra dia feran'ny Ben'ny tanàna. Ny fe-potoana iasan'ny mambra dia tapitra miaraka amin'ny an'ny Ben'ny tanàna. Ny anaran'ireo mambran'ny Komity dia alefan'ny Ben'ny tanàna any amin'ny Soprefe izay mizaha fototra amin'ny alalan'ny didim-pitondrana ny fanendrena ny Filoha sy ny Filoha Lefitra. Ny Komitim-pokontany dia mpanampy ny Delegem-panjakana amin'ny Boriborintany amin'ireo andraikiny momba ny fitondrana sy ny hetra sy mpiasa mpanatanteraka ny Ben'ny tanàna amin'ireo raharaha ifandraisana mivantana amin'ny vahoaka. Amin'izay lafiny izay, ny Komitim-pokontany, eo ambany fahefan'ny Ben'ny tanàna dia mandray anjara amin'ny fandriampahalemana sy ny fitantanana ny fananam-bahoaka (paompin-drano, fanasan-damba,...), amin ny fahadiovana, amin'ny fanangonan-ketra sy haba ary vola fandoa kaominaly. Tsy manana teti-bola manokana ho azy ny Fokontany. Ny fandaniam-bolan'ny Fokontany dia tsy maintsy soratana ao amin'ny teti-bolan'ny Kaominina ary nahazo alalana tamin'ny Ben'ny tanàna. Torak'izany koa ny vola miditra dia apetraky ny fanapahan-kevitry ny Filankevitra monisipaly/kaominaly, soratana ao amin'ny teti-bolan'ny Kaominina ary didin ny Ben'ny tanàna. Ny vola voavory dia arotsaka manontolo ao amin'ny teti-bolan'ny Kaominina. Ny fitsipiky ny kaomtim-panjakana ampiharina amin'ny kaominina dia mihatra amin'ny fampidiram-bola sy ny fandaniam-bola tanterahana any amin'ny Fokontany. Mikasika ireo fandaniam-bola madiniky ny Fokontany lavitry ny Ben'ny tanàna dia azon'ny Ben'ny tanàna atao ny manangana tahiry vatsim-bola ary ny fitantanana izany dia azony ankinina amin'ny mpiasan'ny Kaominina napetraka ao amin'ny Fokontany. Ny asan'ny Filoha, Filoha Lefitra ary mambran'ny Komitim-pokontany dia maimaimpoana. Kanefa azon'ny Filankevitra atao ny mandray fanapahan-kevitra manome tambin-karama indray mamaritra araka ny toe-bolan'ny Kaominina ary mifanahantsahana amin'ny asa takiana. 5 NY FITANTANANA NY MPIASA 5.1 FOTO-KEVITRA ANKAPOBE Ny hitsivolana lf izay mandamina ny sata mifehy ny mpiasam-panjakana dia milaza ao amin'ny andininy voalohany fa "ity sata ity dia ampiharina amin ireo olona, izay 35

36 voatendry hanao asa maharitra ka notendrena ho mpiasa raikitra ao amin ny laharana misy amin ny ambaratongan ny efi-draharahan'ny mpiasampanjakana tafiditra amin ny fahefan ny Praiminisitra, Lehiben ny Govememanta". Izany no antony tsy hiharan'ny sata mifehy ny mpiasam-panjakana amin'ireo mpiasan'ny Kaominina, eo ambany fahefan'ny Ben'ny tanàna izay tokony ho fehezin'ny lalàna ikambanan'ny mpiasa ivelan'ny Fanjakana. Kanefa raha araka ny zava-misy, dia mitovy laharana amin'ny mpiasam-panjakana ny mpiasan'ny Kaominina. Ny Kaominina tsirairay avy dia tsy maintsy mamoaka fitsipika momba ny raharaha sy ny karaman'ireo mpiasany. Ny Mpiasam-panjakana ampiasain'ny Kaominina dia tsy maintsy mitoetra amin'ny fisarahan'asa mba ahafahany mitahiry ny zo raiketin'ny sata maha mpiasampanjakana azy. Ny mpiasan'ny Kaominina, raha araka ny fitsipika ankapobe, dia mikambana amin'ny Tahirim-pirenena Fiahiana ny Mpiasa ivelan'ny Fanjakana. Kanefa azon'ny Kaominina atao ny mangataka ny hikambanan'ny mpiasany amin'ny Tahiry Fitsinjovana sy Fisontroandronono (CPR) izay mahatratra ny 3% ny karama faoben'ilay mpiasa ary 6% ho ajaran'ny Kaominina. Ny mpiasam-panjakana mitoetra tsy ho eo am-perin'asa dia afaka manohy ny fikambanany amin'ny Tahirim-pisotroan-dronono Sivily sy Miaramila (C.R.C.M.). 5.2 FANAOVANA NY FISIN'NY MPIASA Ny fitantanana ny mpiasa dia manomboka amin'ny fametrahana ny fisin'ny mpiasa izay ilaina amin'ny fanarahana ny antotan-taratasy ara-panjakana (fialan-tsasatra, tsy fahatongavana, sazy, toe-pahasalamana), ny fisondrotan-karama (politikan'ny karama), ny fampandrosoana arak'asa (fivoaran'ny asa, fanofanana). Ny fisin'ny mpiasa dia ahitàna ireto tondro ireto - Fanamarinana ny maha-izy azy - Tondrom-pilazana mifandraika amin'ny karama; - Tondrom-pilazana mifandraika amin'nyfampandrosoana arak'asa ; - Ny antotan-taratasin'ny tsirairay dia ahitàna: - sosony iray amin ny fisin ny toerana - ny filazalazana ny momba ilay mpiasa misy sary tapaka ; 36

37 - ny fangatahan'asa - dika mitovy an'ireo diplaoma sy fanamarinana amin'ny asa ; - taratasy fanamarinana ny nadraisana asa - sosony iray amin'ny fifanarahan'asa voasonian'ny Ben'ny tanàna sy ilay mpiasa ; - fisy famakafakana ny fahombiazana - fanomezana alalana hiala sasatra na tsy hiasa - taratasy fanamarinana avy amin'ny dokotera tamin'ny fotoana nidirana niasa; - ny sazy - taratasy fametraham-pialana na izay karazan-taratasy rehetra manazava ny antony nadehanana tsy hiasa. Ny fanaovana sy ny fitantanana ny fisin'ny mpiasa dia andraikitry ny sekretera arapitondrana. 5.3 FANDRAISANA MPIASA Mandray fanapahan-kevitra mikasika ny rafitr'asa sy ny tabilao manondro ny tena isan'ny mpiasa atolotry ny Ben'ny tanàna ny Filankevitra ary manome alalana isan-taona ny fanoratana amin'ny teti-bola ny sora-bola ilaina amin'ny karaman ireo mpiasa ireo. Ny Ben'ny tanàna no lehiben'ny mpiasa, noho izany izy no mandamina sy manapa-kevitra amin'ny fandraisana mpiasa. Ny paika arahina amin'ny fandraisana mpiasa dia misy ireto. Araka ny fangatahana misy fanazavana ny antonantony ataon'ny tompon'andraikitra amin'ny ambaratongam-pahefana dia manamarina ireto ny sekretera ara-pitondrana na ny tompon'andraikitra amin'ny fitantanana ny mpiasa amin'ny Kaominina lehibe : 1) ny fisoratan'ilay toerana amin'ny rafitr'asa 2) ny fisian'ny fisoratan'ny sora-bola ao amin'ny teti-bola 37

38 3) ny fisin'ny toerana ; 4) vao manolo-kevitra ny Ben'ny tanàna hiroso amin'ny fandraisana ilay mpiasa Raha tsy misy ny fisin ny toerana dia manoratra izany miaraka amin ny tompon'andraikitra amin ny ambaratongam-pahefana misy ilay toerana ny sekretera arapitondrana ary manolotra izany amin ny Ben'ny Tanàna. Ny sekretera ara-pitondrana no mamory ny mpitsara amin'ny fandraisana mpiasa, izay ahitàna ny tompon'andraikitra amin'ny ambaratongam-pahefana misy ilay toerana hitadiavana mpiasa sy ny sekretera ara-pitondrana ary tarihin'ny Ben'ny tanàna na ny Lefiny nomem-pahefana na ny mpandrindra jeneraly Paika anatiny arahina Aelin'ny sekretera ara-pitondrana any amin'ny sampandraharaha ny filazana fandraisana mpiasa sy ny fisin'ny toerana mba handraisana ny filatsahana ao anatiny. Ny filazana dia tsy maintsy mampiseho ny anarana sy fisokajiana ilay toerana, ny toetoetry ny kandidà tadiavina (fiofanana akademika, fahalalana ara-teknika, traikefa takiana) ary ny daty ferana hametrahana ny antotan-taratasy filatsahana. Ny filatsahan-ko raisina dia omena ny sekretera ara-pitondrana izay mameno izany miaraka amin'ireo antotan-taratasy ny kandidà tsirairay avy. Manomana tabilao fampitahana ny fari-pahaizan'ny kandidà tsirairay sy ny fari-pahaizana takian'ny fisin'ny toerana ny sekretera ara-pitondrana ary mikarakara fivoriana voalohan'ny mpitsara mba hahafahana mifidy ny filatsahan-ko raisina 3 tsara indrindra. Isaky ny tsy mahafeno ny fepetra takian'ilay toerana handraisana mpiasa ny tombana sy ny isan'ny filatsahanko raisina anatiny dia manao fitadiavana mpiasa any ivelany ny sekretera ara-pitondrana Paika ivelany arahina Ny filazana fandraisana mpiasa dia aseho amin'ny alalan'ny peta-drindrina na avoaka amin'ny fampahalalam-baovao (fampielezam-peo, gazety). Io filazana io dia mampiseho ny anarana sy fisokajiana ilay toerana, ny toetoetry ny kandidà tadiavina (fiofanana akademika, fahalalana ara-teknika, traikefa takiana), ny tokony ho hita ao amin'ny antotan-taratasimpilatsahana (taratasy milaza ny antony nisafidianana ilay toerana, filazalazana ny momba ilay 38

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg 0 UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA TATITRA ANIVON NY ANTENIMIERAM- PIRENENA Praiminisitra Jean RAVELONARIVO 1 TATITRA MANOLOANA NY ANTENIMIERA I 21 MAY 2015 21 MAY 2015 Andininy 54.- Ny Filohan ny Repoblika no manendry ny Praiminisitra

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY MINISTERAN NY FAMBOLENA NY FIOMPIANA ARY NY JONO ----------------------------------- REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana ---------------------------------- MINISTERAN NY TOEKARENA

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

Évaluation de l impact environnemental et social

Évaluation de l impact environnemental et social RÉPUBLIQUE DE MADAGASCAR Tanindrazana - Fahafahana - Fandrosoana PRÉSIDENCE PROJET PÔLE INTÉGRÉS DE CROISSANCE Secrétariat National Évaluation de l impact environnemental et social Cadre de politique de

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar HUMBOLDT-UNIVERSITÄT ZU BERLIN Landwirtschaftlich-Gärtnerische Fakultät Schriftenreihe des Seminars für Ländliche Entwicklung VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

DISPOSITIONS COMMUNES

DISPOSITIONS COMMUNES ORDONNANCE N 62-074 du 29 SEPTEMBRE 19 62 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics. ( J.O. n 248 du 12.10.62 p. 2248 ) modifiée et complétée

Plus en détail

SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville

SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville TOERANA ALEHA FIAINGANA ZOTRA RAISINA DESTINATION DEPART TANA LIGNE A PRENDRE A Ambohitrapeto Isotry D Itaosy Itaosy

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA Public Disclosure Authorized a REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana JIRAMA JIRO SY RANO MALAGASY E1 403 VOL. 1 Public Disclosure Authorized Public Disclosure Authorized ÉVALUATION

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

46 Ordonnance n 62-074 du 29 septembre 1962

46 Ordonnance n 62-074 du 29 septembre 1962 Ordonnance n 62-074 du 29 septembre 1962 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics (J.O. n 248 du 12.10.62, p. 2248), modifiée et complétée par

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Ventin-kevitra Matoan-dahatsoratra Fampahafantarana an i Madagasikara 4 Ny Nosy Telma, mpandraharaha nasionaly manara-penitra iraisam-pirenena

Plus en détail

PROJET DE LOI N 027/2007

PROJET DE LOI N 027/2007 REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PROJET DE LOI N 027/2007 DU 25 OCTOBRE 2007 PORTANT LOI DE FINANCES POUR 2008 IMPRIMERIE NATIONALE 2007 - 2 - PROJET DE LOI N 027/2007 PORTANT

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

FANILO MIAMPITA. TÉLÉPHONIE FIXE La honte. Encore sous le monopole Après le drame libanais, voilà que resurgit

FANILO MIAMPITA. TÉLÉPHONIE FIXE La honte. Encore sous le monopole Après le drame libanais, voilà que resurgit cyan magenta jaune noir PROGRAMME P.7 L accès sans peine à l information QUOTIDIEN D INFORMATION GRATUIT N 080 DU Vendredi 18 Juin 2010 AFFAIRE LILA FANILO MIAMPITA TÉLÉPHONIE FIXE La honte TONGA NY ORA

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

d une solution malgachomalgache

d une solution malgachomalgache cyan magenta jaune noir PROGRAMME P.7 ECONOMIE TRANSITOIRE FANANAN-TANY DECHETS URBAINS Interventionnisme critiqué BIRAO FOTOTRA A VALORISER L inaccessibilité aux intrants notamment aux engrais induit

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

LANY TAMINGANA ETO AMINTSIKA

LANY TAMINGANA ETO AMINTSIKA cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana EXPOSE DES MOTIFS Loi n 2001007 autorisant la ratification de l Accord de Crédit de Développement conclu le 22 mai 2001 entre la République de Madagascar et l Association Internationale de Développement relatif au financement

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. "Dieu qualifie ceux qui sont appelés", hoy Rakotolehibe Mamy, Talen ny FMMB

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. Dieu qualifie ceux qui sont appelés, hoy Rakotolehibe Mamy, Talen ny FMMB Taniketsa - Laharana faha 58 - Septambra 2014 1 Gazetin ny Sampana Sekoly Alahady FJKM Andrainarivo Taniketsa Miseho isan-telo volana. Laharana faha 58. Septambra 2014. Vidiny: 400 Ariary. Tranokala: www.sa-andrainarivo.mg

Plus en détail

LALANA LAHARANA FAHA2005-029

LALANA LAHARANA FAHA2005-029 REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA LALANA LAHARANA FAHA2005-029 TAMIN NY 29 DESAMBRE 2005 MOMBA NY LALANA MIFEHY NY FITANTANAM-BOLAM-PANJAKANA AMIN NY

Plus en détail

AMBATONAKANGA SY NY MISIONERA ;

AMBATONAKANGA SY NY MISIONERA ; AMBATONAKANGA SY NY MISIONERA ; Raha miteny hoe Ambatonakanga isika protestanta amin izao andro ankehitriny izao dia ny trano fiangonana vita amin ny vato no tonga ao an-tsaintsika voalohany ary vitsy

Plus en détail

N 015 DU 27 mars 2010 ceni Neutralité introuvable La CENI est chargée d une difficile

N 015 DU 27 mars 2010 ceni Neutralité introuvable La CENI est chargée d une difficile QUOTIDIEN D INFORMATION GRATUIT N 015 DU 27 mars 2010 ceni Neutralité introuvable La CENI est chargée d une difficile L accès sans peine à l information mission, celle de garantir la transparence BUSINESS

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail