ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

Dimension: px
Commencer à balayer dès la page:

Download "ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7"

Transcription

1 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7

2 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin de promouvoir le bilinguisme, la culture malgache et la lecture auprès des enfants de Madagascar. L ONG Bel Avenir mène, depuis 2003, un programme éducatif, inclusif et de développement communautaire dans le Sud de Madagascar. Ce 7ème titre est le fruit de la collaboration entre l ONG Bel Avenir et l association française ENFANTS DU MONDE qui œuvre ensemble à la réalisation de projets dans le cadre de la lutte contre la malnutrition dans le Sud de Madagascar (construction de cantines, distribution de compléments alimentaires, construction de puits ). L histoire de Balita est liée au projet de production de Moringa où la feuille de cet arbre est pilée puis distribuer comme complément alimentaire à des enfants malnutris et à pour but de sensibiliser la population à la production et l utilisation de compléments alimentaires. Une grande partie de ce titre est distribué dans les écoles et les bibliothèques de Madagascar, un autre partie est vendue dans le but d autofinancer les projets de l ONG Bel Avenir. ONG BEL AVENIR: ENFANTS DU MONDE: 1

3 Omby Mena le zébu et Chipi le lémurien passaient souvent leur journée ensemble au bord de la rivière asséchée du Sud de Madagascar. Ils s amusaient, ils discutaient et se chamaillaient pour finir Indray andro hono, nisy omby iray nantsoina hoe Ombimena sy gidro iray nantsoina hoe chipi. Matetika izy roa ireo no mandany andro eny amonron ny renirano efa ritra ao atsimon i Madagasikara. Miara- milalao, miady hevitra izay miafara aminy fifamaliana indraindray... 2

4 Soudain ils entendirent les pleurs d un enfant qui paraissait bien malheureux. Chipi sauta sur la bosse d Omby Mena et ils s approchèrent près d un buisson pour apercevoir l enfant. Tampoka teo, injay nisy feonjazakely, mitomany sy mitaraina mafy.nitsambikina teo ambonin ny trafon i Ombimena i chipi dia nanantona moramora nisavasava ny bozaka izay niavian ny feo izy roa. 3

5 4 L enfant était assis sur une grosse pierre et se tenait le ventre tout en pleurant. L enfant paraissaient si triste Indro ary nisy zaza iray, nipetraka teo ambonin ny vatolampy, sady nitambokona no nitomany. Rakotra alahelo ny tavany

6 Omby Mena s approcha de l enfant. «Bonjour petit garçon! Pourquoi pleures-tu?» Nanantona ilay zaza I Ombimena, ka hoy izy: Manao ahoana ry tovolahy, fa inona ity mampitomany anao toy izao? 5

7 La pluie ne vient pas, rien n a poussé dans le champ de mon père, nous n avons plus rien à manger mon ventre me fait mal, j ai faim 6 Tsy misy ny orana, ka tsy misy na dia zava-maniry iray aza ao an-tanimbolin I dada, tsy mana-kohanina intsony izahay.marary mafy ny kiboko, noana aho.

8 7 Chipi s en alla rapidement dans la forêt puis revenu avec quelques fruits de baobab, des mangues, des papailles et des feuilles de moringa. Lasa faingana nankany anaty ala i Chipi, ka poa toy izay dia niverina niaraka tamin ny voankazo: renala, manga, papay ary koa ananambo.

9 8 L enfant retrouva le sourire et à peine dit merci il se jeta sur les aliments Nitsiky ilay zaza vao nahita ireo, ka vao vita ny fisaorana dia nandrapaka ireto sakafo

10 9 Comment t appelles-tu et d où viens-tu? demanda Omby Mena Nanontany azy I Ombimena : Iza moa no anaranao, ary avy aiza ianao?

11 Mon nom est Balita, je viens du village de Tsiranobe, nous sommes des agriculteurs depuis des générations répondit l enfant la bouche pleine, Ny anarako dia Balita, avy ao Tsiranobe, ary fambolena no iainanay, izay nolovainay tamin ny razambenay. hoy ilay zaza namaly azy, ny vava mbola feno voankazo. 10

12 Les aliments presque terminés, Balita regarda les feuilles vertes et s adressa à Omby Mena et Chipi. «Pourquoi vous me faites manger des feuilles, je ne suis pas un animal?» Nony nadiva ho lany anefa ny sakafony dia nitompy teny amin ireto ananambo ny mason I Balita ka velom-panontaniana an ireto namany indray izy: Fa maninona aho no ampihinaninareo ravin-kazo, izaho anie tsy biby ê? 11

13 Les deux compères éclatèrent de rire «Ceux sont des feuilles de Moringa, elles sont remplies de calcium et de protéines si tu les rajoutes à ton alimentation, tu récupéreras toutes tes forces» Toran ny hehy ireto namany roa no sady nanazava hoe: Ananambo no anaran io, anana, feno kalisiôma sy proteina., raha afangaro amin ny sakafo hohanina dia manome hery sy tanjaka tokoa. 12

14 L enfant mangea les feuilles de Moringa faisant confiance au zébu et au lémurien. Nohanin ilay zaza ireto ananambo, tamin ny fo feno fahatokisana an ity omby sy gidro namany. 13

15 14 Rassasié l enfant s endormi au pied du rocher avec le sourire. Nony voky izy dia natory tamim-pitsikitsikiana teo ampototr ilay vatolampy.

16 A son réveil, Omby Mena et Chipi était là. «Bonjour Balita! Bonjour les amis Nous t avons préparé des pieds de Moringa pour ta famille, plante les près de ta maison, arrose les de temps en temps, tu pourras récupérer les feuilles rapidement Fais les ensuite sécher puis pille les pour quelles se transforment en poudre verte Fotoana fohy taorian izay, nifoha I Balita, mbola teo akaikiny ireto namany, Salama I Balita Salama ry namako! hoy izy namaly Indreto misy zanaka ananambo, nomaninay ho an ny fianakavianao, amboleo eo akaikin ny trano fonenanareo, ary karakarao sy tondraho matetika, afaka fotoana vitsy monja dia afaka tangosanareo ny raviny.amaino dia totoy ka hahazo vovoka maintso azo tehirizina ianareo 15

17 16 Rajoute cette poudre au repas de ta famille, elle vous permettra d avoir les forces nécessaires pour faire face à la période de sécheresse Afangaroy amin ny sakafonareo io dia hahazo hery ianareo sy ny fianakaviana rehetra hisedrana ny haintany.

18 17 Tu sais Balita la nature apporte beaucoup de solutions aux problèmes des Hommes, il faut donc la respecter et savoir l écouter Fantatr I Balita ve fa ny natiora dia mitondra vahaolana maro amin ny fiainan ny zanak olombelona, ka tokony hahay hihaino sy hanaja azy isika.

19 Balita s éloigna de ces deux amis avec ses pieds de Moringa afin de rejoindre son village. 18 Nandao ny namany I Balita ka lasa namonjy ny tanànany miarakamin ireto zanak ananambo.

20 Du haut de la colline, Omby Mena et Chipi regardèrent Balita raconter à sa famille son aventure et planter les pieds de moringa. Indro mitazana azy avy eny ambonin ny vatolampy i Ombimena sy Chipi, nitantara amin ny fianakaviany ny zava-nitranga I Balita avy eo namboly ireto zanaka ananambo izy mianakavy. 19

21 Écrit et traduit par l équipe de l ONG Bel Avenir Dessin de Nady Benjamin RATSIMBAZAFY Dans la même collection: ZEBULON TURLUTUTU La Tortue TOKY Et le Roi Soleil LOVA La Sirène AINA Au pays des orpailleurs RAKOTO et la Poudre Magique Publié par l ONG Bel Avenir C/O Cinéma Tropic Bd Gallieni BP 87, Tuléar 601 Madagascar Tel: ( ) Web: Édité avec le partenariat de: ENFANTS DU MONDE 46, rue du Berceau MARSEILLE Tel: Fax: //

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

Note pratique. Réseau PRATIQUES

Note pratique. Réseau PRATIQUES Note pratique Ny Herin ny hafatra / Le pouvoir des messages pour la santé préventive Expérience du programme de santé materno-infantile mené par Inter Aide à Farafangana, Madagascar Notice Type de document

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

Conversations en ligne : descriptions, perspectives. Louise Ouvrard

Conversations en ligne : descriptions, perspectives. Louise Ouvrard Conversations en ligne : descriptions, perspectives Eléments théoriques La variation Quelques caractéristiques du discours électronique La langue malgache Le corpus Présentation Analyse Quels apports à

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

Ny Vaovao Mahafaly. La Bonne Nouvelle

Ny Vaovao Mahafaly. La Bonne Nouvelle Ny Vaovao Mahafaly La Bonne Nouvelle Ary tamin ny fahenim-bolana dia nirahin Andriamanitra ny anjely Gabriela ho any an-tanàna anankiray any Galilia atao hoe Nazareta, ho any amin ny virijina anankiray,

Plus en détail

Hafatra fisaorana avy amin-dramatoa Mialy Rajoelina, filohan ny fikambanana Fitia

Hafatra fisaorana avy amin-dramatoa Mialy Rajoelina, filohan ny fikambanana Fitia Le rideau est tombé sur la levée de fonds et de dons organisée par l association Fitia, fondée et présidée par l épouse du président de la Haute Autorité de la Transition de Madagascar. Cette opération

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

Cela va trop loin! Sabbat Fais l activité de cette semaine à la page 80. Dimanche

Cela va trop loin! Sabbat Fais l activité de cette semaine à la page 80. Dimanche LEÇON Cela va trop loin! Sabbat Fais l activité de cette semaine à la page 80. Dimanche Lis «Cela va trop loin!». Dessine un signal routier. Ajoute ton verset à mémoriser et place-le en évidence. Commence

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

Février - mars 2016 n 47 TRAIT D UNION

Février - mars 2016 n 47 TRAIT D UNION Février - mars 2016 n 47 TRAIT D UNION Le journal en ligne de la RNS Train Manakara-Fianarantsoa Éditorial 2 Lyon et ses incontournables 3 La tribune du coordinateur 4 Itinéraire d un sportif gâté 5 Lalaina

Plus en détail

Poésie Ando 1 Les poètes malgaches d'expression française 1 Le bouddhisme malgache (ou la civilisation malgache) 1

Poésie Ando 1 Les poètes malgaches d'expression française 1 Le bouddhisme malgache (ou la civilisation malgache) 1 Documents disponibles au Centre de Ressources en Malagasy Genre Titre Nb d'exemplaires BD Aventures dans l'océan Indien 6 L'axe lourd 1 La ballade africaine 1 Madabulles 2004 2 Madabulles 2005 2 Contes

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

Le malgache. L exemple d une langue sans test

Le malgache. L exemple d une langue sans test Le malgache L exemple d une langue sans test 1. Pourquoi n existe t il pas de cer:fica:on? Peu d échanges commerciaux avec l extérieur Pas d immigra:on importante de «cols blancs» Peu d étudiants étrangers

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

Alors, quand il est rentré, il a fallu tout lui expliquer. Et comme c est un tonton littéraire, il lui a raconté ce conte imaginaire:

Alors, quand il est rentré, il a fallu tout lui expliquer. Et comme c est un tonton littéraire, il lui a raconté ce conte imaginaire: C est l histoire d une petite fille, Noéline, et de son tonton qui vivait en Chine. Il n était pas là quand elle est née, car il escaladait une montagne sacrée. Alors, quand il est rentré, il a fallu tout

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

LANY TAMINGANA ETO AMINTSIKA

LANY TAMINGANA ETO AMINTSIKA cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN

Plus en détail

La guerre des trolls

La guerre des trolls La guerre des trolls Il était une fois, un jeune paysan nommé Titou. Il vivait seul, à l orée d une forêt et il cultivait des champs. Un jour, il alla dans la forêt pour chasser. Au détour d un chemin,

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

MpANAMORY RAdO RABARILALA

MpANAMORY RAdO RABARILALA ENIM-BOLANA TSY TAFATSANGANA FANJAITRA MIISA 21 NO NESORINA TAO AN-KIBON i LALAINA P.06 N 3190 L u n d i 2 9 j u i n 2 0 1 5 PRIX : Ar 400 zatovolahy NANGALATRA volamena P.06 TENY AM-pASANA : NANONOFY

Plus en détail

A. PRODUCTION ÉCRITE 30 POINTS

A. PRODUCTION ÉCRITE 30 POINTS ΥΠΟΥΡΓΕΙΟ ΠΑΙΔΕΙΑΣ ΚΑΙ ΠΟΛΙΤΙΣΜΟΥ ΔΙΕΥΘΥΝΣΗ ΜΕΣΗΣ ΕΚΠΑΙΔΕΥΣΗΣ ΚΡΑΤΙΚΑ ΙΝΣΤΙΤΟΥΤΑ ΕΠΙΜΟΡΦΩΣΗΣ ΤΕΛΙΚΕΣ ΕΝΙΑΙΕΣ ΓΡΑΠΤΕΣ ΕΞΕΤΑΣΕΙΣ ΣΧΟΛΙΚΗ ΧΡΟΝΙΑ 2015-2016 Μάθημα : Γαλλικά Επίπεδο : E1 Διάρκεια : 2 ώρες Υπογραφή

Plus en détail

SOMMAIRE. Comptes rendus

SOMMAIRE. Comptes rendus Revue de sociolinguistique en ligne n 22 juillet 2013 Les langues des apprenants dans les systèmes éducatifs post-coloniaux Numéro dirigé par Bruno Maurer GLOTTOPOL SOMMAIRE Bruno Maurer : Présentation.

Plus en détail

MERCI POUR TOUTE CETTE ANNEE

MERCI POUR TOUTE CETTE ANNEE MERCI POUR TOUTE CETTE ANNEE C est bientôt les vacances! Notre année à l école s achève Qu avons-nous vécu cette année?? Que retenons nous des belles choses que nous avons vécues avec notre famille, ou

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

Découvrez l univers des piles avec nous!

Découvrez l univers des piles avec nous! Découvrez l univers des piles avec nous! Bonjour, c est moi Recharge! Aujourd hui, toi et moi allons en apprendre plus sur la vie des piles. Voici mon père! Des usines, des compagnies Voici, le chemin

Plus en détail

Rapport de stage Mer et Monde. Frédérique Morissette

Rapport de stage Mer et Monde. Frédérique Morissette Rapport de stage Mer et Monde Frédérique Morissette Comment décrire en quelques mots cette merveilleuse expérience qu à été mon stage au Sénégal? Impossible selon moi, je devrais écrire des pages et des

Plus en détail

Tous que j avais. Français 9, Andrew Cheung (Chapitre 1 & 2) et Jon Parkinson (Chapitre 3 & 4) Le 21 avril 2015

Tous que j avais. Français 9, Andrew Cheung (Chapitre 1 & 2) et Jon Parkinson (Chapitre 3 & 4) Le 21 avril 2015 Tous que j avais Français 9, Andrew Cheung (Chapitre 1 & 2) et Jon Parkinson (Chapitre 3 & 4) Le 21 avril 2015 Table de matières Chapitre 1(la prise) 1 Chapitre 2(la vente).2 Chapitre 3(la punition)..3

Plus en détail

Texte 1. Texte 2. Texte 3. J ai rejoint ceux que j aimais et j attends ceux que j aime. Texte 4

Texte 1. Texte 2. Texte 3. J ai rejoint ceux que j aimais et j attends ceux que j aime. Texte 4 Texte 1 Quand tu regarderas les étoiles la nuit, puisque j habiterai dans l une d elles, puisque je rirai dans l une d elles, alors ce sera pour toi, comme si riaient toutes les étoiles A. de Saint Exupéry

Plus en détail

Il y a bien longtemps, dans un château recouvert de lierre et de plantes envahissantes,

Il y a bien longtemps, dans un château recouvert de lierre et de plantes envahissantes, Texte B CM2 de M. Pivano Chapitre 1 Il y a bien longtemps, dans un château recouvert de lierre et de plantes envahissantes, demeurait un roi qui avait été, des années auparavant, empoisonné par des huîtres.

Plus en détail

Le pardon en famille

Le pardon en famille Commission diocésaine de l Eveil à la foi Diocèse d Annecy- Val d Arly Janvier 2016 Le pardon en famille Le pape François a ouvert le 08 décembre 2015 «l Année Sainte de la Miséricorde». Ce «Jubilé de

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

«Laisse partir mon peuple» - le rêve de la libération. Appelé pour conduire à la liberté Exode 2 : 11 à 4 : 17, Moïse, sa fuite et sa vocation

«Laisse partir mon peuple» - le rêve de la libération. Appelé pour conduire à la liberté Exode 2 : 11 à 4 : 17, Moïse, sa fuite et sa vocation «Laisse partir mon peuple» - le rêve de la libération Appelé pour conduire à la liberté Exode 2 : 11 à 4 : 17, Moïse, sa fuite et sa vocation Narration en cercle, animée au moyen d objets symboliques Matériel

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

va en salle d opération

va en salle d opération Pe t i t Pierre va en salle d opération Petit Pierre va en salle d opération «Hey docteur Je n ai pas peur Tu peux bien m ausculter Hey docteur Je n ai pas peur Tu peux bien me visiter de la tête au pied».

Plus en détail

Le conte du Petit Chaperon rouge

Le conte du Petit Chaperon rouge Le conte du Petit Chaperon rouge d après les frères Grimm Il était une fois une petite fille que tout le monde aimait et sa grand-mère encore plus. Elle ne savait que faire pour lui faire plaisir. Un jour,

Plus en détail

On a volé La plage de Sainte-Adresse!

On a volé La plage de Sainte-Adresse! On a volé La plage de Sainte-Adresse! par Ana 5e Aza 4e Ahmed 5e Dagman 5e Emilienne 6e Taïmoor 3e Jeudi 5 Mai 2011 08:32 Chapitre 1 Salut! Je m' appelle Séléna, j' ai 16 ans. Les vacances viennent de

Plus en détail

Jubilé de la Miséricorde

Jubilé de la Miséricorde Pardonne Partage Aime Jubilé de la Miséricorde Découvre l année de la miséricorde en t amusant C est quoi un Jubilé? Qu est-ce que la miséricorde? 1 A tes crayons! 2 Qu est-ce qu un jubilé? Un jubilé est

Plus en détail

Service diocésain de la Catéchèse. 149 rue Jodelle 77610 La Houssaye en Brie 01 64 07 46 48 catechese@catho77.fr http:\\enfance.catho77.

Service diocésain de la Catéchèse. 149 rue Jodelle 77610 La Houssaye en Brie 01 64 07 46 48 catechese@catho77.fr http:\\enfance.catho77. Service diocésain de la Catéchèse 149 rue Jodelle 77610 La Houssaye en Brie 01 64 07 46 48 catechese@catho77.fr http:\\enfance.catho77.fr A tes crayons! 7 Allez dans la Mission du Christ Porte la Paix

Plus en détail

A. PRODUCTION ÉCRITE 30 POINTS

A. PRODUCTION ÉCRITE 30 POINTS ΤΠΟΤΡΓΔΙΟ ΠΑΙΓΔΙΑ ΚΑΙ ΠΟΛΙΣΙΜΟΤ ΓΙΔΤΘΤΝΗ ΜΔΗ ΔΚΠΑΙΓΔΤΗ ΚΡΑΣΙΚΑ ΙΝΣΙΣΟΤΣΑ ΔΠΙΜΟΡΦΩΗ ΣΕΛΙΚΕ ΕΝΙΑΙΕ ΓΡΑΠΣΕ ΕΞΕΣΑΕΙ ΥΟΛΙΚΗ ΥΡΟΝΙΑ 2014-2015 Μάθημα : Γαλλικά Δπίπεδο : E1 Γιάρκεια : 2 ώρες Τπογραφή Ημερομηνία

Plus en détail

La naissance. Fleur de Lune. Texte : Cécile Galliot. Créatrice de Fleur de Lune. Illustrations : Aquarelles de Claude Albanèse

La naissance. Fleur de Lune. Texte : Cécile Galliot. Créatrice de Fleur de Lune. Illustrations : Aquarelles de Claude Albanèse La naissance Texte : Cécile Galliot Créatrice de Fleur de Lune de Fleur de Lune Illustrations : Aquarelles de Claude Albanèse http://prenomino.voila.net/ Bonjour! Je m appelle Tortillon. Tortillon, l'escargot.

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

Fifi Humus et Peter Argile - Annexe 1

Fifi Humus et Peter Argile - Annexe 1 Fifi Humus et Peter Argile - Annexe 1 Chapitre 1 : Un rêve étrange Connaissez- vous Fifi et Peter? Il était une fois une petite feuille en forme de cœur, Fifi, et un petit caillou en forme de carré, Peter,

Plus en détail

Noely 2009 Taom-baovao 2010

Noely 2009 Taom-baovao 2010 FMM Fiombonana Miara-mivavaka eto Münich. Noely 2009 Taom-baovao 2010 Fa Zaza no teraka ho antsika, Zazalahy no omena antsika, ary ny anarany atao hoe Mahagaga, Mpanolon-tsaina, Andriamanitra Mahery, Rain

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

Allgemeinsprachen. Cochez la bonne réponse sur la grille. Une seule réponse est correcte.

Allgemeinsprachen. Cochez la bonne réponse sur la grille. Une seule réponse est correcte. Niveau A1 Cochez la bonne réponse sur la grille. Une seule réponse est correcte. 1. Bonjour, je s'appelle Sandra. Bonjour, je m'appele Sandra. Bonjour, je m'appelle Sandra. 2. Qu'est-ce qu'on dit ʺBuchʺ

Plus en détail

Les mots magiques 1/10

Les mots magiques 1/10 Les mots magiques Mini-opéra en 2 actes créé à Metz le 25 juillet 2008 et redonnée le 1e août par la troupe du Caillou Blanc et les enfants du stage de théâtre et musique ( Adénaïs, Axel, Candys, Eve,

Plus en détail

Cauchemar. Première vision

Cauchemar. Première vision Première vision Cauchemar Je prenais mon déjeuner lorsque j entendis ma mère s exclamer : «Dépêche-toi, on va être en retard, chéri! -J arrive, je finis de préparer la valise! cria mon père.» Moi, je me

Plus en détail

GLOTTOPOL Revue de sociolinguistique en ligne

GLOTTOPOL Revue de sociolinguistique en ligne GLOTTOPOL Revue de sociolinguistique en ligne N 2 Juillet 2003 Anciens et nouveaux plurilinguismes SOMMAIRE Introduction Premier chapitre : Les situations de plurilinguisme : aménagement et représentations

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

ΤΠΟΤΡΓΔΙΟ ΠΑΙΓΔΙΑ ΚΑΙ ΠΟΛΙΣΙΜΟΤ ΓΙΔΤΘΤΝΗ ΜΔΗ ΔΚΠΑΙΓΔΤΗ ΚΡΑΣΙΚΑ ΙΝΣΙΣΟΤΣΑ ΔΠΙΜΟΡΦΩΗ ΣΕΛΙΚΕ ΕΝΙΑΙΕ ΓΡΑΠΣΕ ΕΞΕΣΑΕΙ ΥΟΛΙΚΗ ΥΡΟΝΙΑ 2014-2015

ΤΠΟΤΡΓΔΙΟ ΠΑΙΓΔΙΑ ΚΑΙ ΠΟΛΙΣΙΜΟΤ ΓΙΔΤΘΤΝΗ ΜΔΗ ΔΚΠΑΙΓΔΤΗ ΚΡΑΣΙΚΑ ΙΝΣΙΣΟΤΣΑ ΔΠΙΜΟΡΦΩΗ ΣΕΛΙΚΕ ΕΝΙΑΙΕ ΓΡΑΠΣΕ ΕΞΕΣΑΕΙ ΥΟΛΙΚΗ ΥΡΟΝΙΑ 2014-2015 ΤΠΟΤΡΓΔΙΟ ΠΑΙΓΔΙΑ ΚΑΙ ΠΟΛΙΣΙΜΟΤ ΓΙΔΤΘΤΝΗ ΜΔΗ ΔΚΠΑΙΓΔΤΗ ΚΡΑΣΙΚΑ ΙΝΣΙΣΟΤΣΑ ΔΠΙΜΟΡΦΩΗ ΣΕΛΙΚΕ ΕΝΙΑΙΕ ΓΡΑΠΣΕ ΕΞΕΣΑΕΙ ΥΟΛΙΚΗ ΥΡΟΝΙΑ 2014-2015 Μάθημα : Γαλλικά Δπίπεδο : E1 Γιάρκεια : 2 ώρες Τπογραφή Ημερομηνία

Plus en détail

Jésus m appelle à le suivre : avec l aide de l Esprit Saint, j embarque!

Jésus m appelle à le suivre : avec l aide de l Esprit Saint, j embarque! 4 Jésus m appelle à le suivre : avec l aide de l Esprit Saint, j embarque! Objectifs : En cette 4 ème catéchèse, nous voulons faire découvrir que, par le baptême, Jésus nous a rassemblé e s dans la communauté

Plus en détail

son site : http://jancet.canalblog.com Twitter : @JaAncet

son site : http://jancet.canalblog.com Twitter : @JaAncet la tendresse Jacques Ancet est né à Lyon en 1942. Il vit et travaille près d Annecy. Il est l auteur d une imposante œuvre poétique, et un des traducteurs essentiels de la poésie espagnole. son site :

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

GUIDE DU FACILITATEUR

GUIDE DU FACILITATEUR REPOBLIKAN I MADAGASIKARA MINISTERAN NY FAHASALAMANA SY NY FANDRINDRANA NY FIAINAM-PIANAKAVIANA ---------------------&------------------------ PRISE EN CHARGE DE LA FIEVRE PAR L ACT AU NIVEAU COMMUNAUTAIRE

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

TRAIT D UNION. 23 mars 2016 n 48. Le journal en ligne de la RNS. Éditorial 2. Itinéraire Tombola d un sportif gâté 9 5

TRAIT D UNION. 23 mars 2016 n 48. Le journal en ligne de la RNS. Éditorial 2. Itinéraire Tombola d un sportif gâté 9 5 23 mars 2016 n 48 TRAIT D UNION Le journal en ligne de la RNS Commune de Vohiposa, nord-est de Haute-Matsiatra, projet AGIRE, Grand Lyon Métropole de Lyon Les Lyonnais rencontrent les Malgaches 2 Discours

Plus en détail

MADAGASCAR, RECYCLAGE, ETHIQUE ET BUSINESS

MADAGASCAR, RECYCLAGE, ETHIQUE ET BUSINESS Nat Mad est une société fondée en 2005. Cette petite SARL crée, fabrique et distribue des accessoires de mode en matière recyclée. Depuis peu l entreprise lance un nouveau concept pour des agencements

Plus en détail

DELF Prim A2. Livret du candidat. Compréhension de l'oral. Compréhension des écrits. Production écrite

DELF Prim A2. Livret du candidat. Compréhension de l'oral. Compréhension des écrits. Production écrite Niveau A2 du Cadre européen commun de référence pour les langues Livret du candidat Compréhension de l'oral Compréhension des écrits Production écrite 0710-demo 30/07/10 Code du candidat :... Nom : Prénom

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

apprentissage et obtenu mon certificat avec mention. À la remise des diplômes, j ai reçu un bon de deux cents francs, remis en mains propres par un

apprentissage et obtenu mon certificat avec mention. À la remise des diplômes, j ai reçu un bon de deux cents francs, remis en mains propres par un apprentissage et obtenu mon certificat avec mention. À la remise des diplômes, j ai reçu un bon de deux cents francs, remis en mains propres par un politicien, moment immortalisé par les photographes.

Plus en détail

Prière à notre maman du ciel

Prière à notre maman du ciel Prénom et nom: Prière à notre maman du ciel _ Je te salue, Marie, pleine de grâce, le Seigneur est avec toi. Tu es bénie entre toutes les femmes et Jésus ton enfant est béni. Sainte Marie, Mère de Dieu,

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

AMBATONAKANGA SY NY MISIONERA ;

AMBATONAKANGA SY NY MISIONERA ; AMBATONAKANGA SY NY MISIONERA ; Raha miteny hoe Ambatonakanga isika protestanta amin izao andro ankehitriny izao dia ny trano fiangonana vita amin ny vato no tonga ao an-tsaintsika voalohany ary vitsy

Plus en détail

oria vidéo Lorin Petitpierre JOIE Synopsis

oria vidéo Lorin Petitpierre JOIE Synopsis JOIE Synopsis Antoine et Marianne Le Cloître, est un couple de personnes âgées d environ soixante ans. Un matin, ils reçoivent un coup de téléphone. Marianne répond et s agite en apprenant que l interlocuteur

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

RAPPORT DE STAGE MEDICAP. Médicalisation et Aide aux Prisonniers

RAPPORT DE STAGE MEDICAP. Médicalisation et Aide aux Prisonniers UNIVERSITE PAUL CEZANNE AIX-MARSEILLE IIII FACULTE DE DROIT ET DE SCIENCE POLITIQUE INSTITUT D ETUDES HUMANITAIRES INTERNATIONALES RAPPORT DE STAGE MEDICAP Médicalisation et Aide aux Prisonniers Responsable

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

LUCY CALDWELL. FEUILLES (Leaves) Traduit de l anglais (Irlande du Nord) par Séverine Magois

LUCY CALDWELL. FEUILLES (Leaves) Traduit de l anglais (Irlande du Nord) par Séverine Magois LUCY CALDWELL FEUILLES (Leaves) Traduit de l anglais (Irlande du Nord) par Séverine Magois ouvrage publié avec le concours du centre national du livre éditions THEATRALES maison antoine vitez La collection

Plus en détail

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. "Dieu qualifie ceux qui sont appelés", hoy Rakotolehibe Mamy, Talen ny FMMB

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. Dieu qualifie ceux qui sont appelés, hoy Rakotolehibe Mamy, Talen ny FMMB Taniketsa - Laharana faha 58 - Septambra 2014 1 Gazetin ny Sampana Sekoly Alahady FJKM Andrainarivo Taniketsa Miseho isan-telo volana. Laharana faha 58. Septambra 2014. Vidiny: 400 Ariary. Tranokala: www.sa-andrainarivo.mg

Plus en détail

Programme "initiation au cinéma pour le primaire" ACTIVITÉ «L ACTEUR VIRTUEL : SPÉCIAL YVES SANSFAÇONS»

Programme initiation au cinéma pour le primaire ACTIVITÉ «L ACTEUR VIRTUEL : SPÉCIAL YVES SANSFAÇONS» Programme "initiation au cinéma pour le primaire" ACTIVITÉ «L ACTEUR VIRTUEL : SPÉCIAL» Situation #1 : en vacances Ah bien, si c est pas mon élève préféré! C est quoi ton nom déjà? ÉLÈVE (3 secondes) Est-ce

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

ATRIKA Le journal de l ASMF

ATRIKA Le journal de l ASMF Association des Anciens du Collège St-Michel en France ATRIKA Le journal de l ASMF OCTOBRE 2010 ÉDITION : Octobre 2010, NUMÉRO 12 Éditorial 2010 ASMF bureau 2009/2010 Joël Rambatomanga(1990) Président

Plus en détail

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES DEPARTEMENT INTERDISCIPLINAIRE DE FORMATION PROFESSIONNELLE COMMUNICATION ET DYNAMIQUE LOCALE RAPPORT

Plus en détail