FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra Tolak andro. Pejy - Fitohizan ny fivoriana Fiantsoana anarana...

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana..."

Transcription

1

2 FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana Fiantsoana anarana Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana manatrika fivoriana Fanehoan-kevitra nataon ny Solombavambahoaka Fandraisana fanapahan-kevitra amin ny hanovana ny fandaharam-potoana Fiatoan ny fivoriana... 12

3 1 FIVORIAMBE FILOHA : Andriamatoa RAKOTOMAMONJY Jean Max MPITANTSORATRA : - Andriamatoa MAHAZOASY Mananjara Freddie Richard - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina FOTOANA : Alarobia 2 Desambra 2015, tamin ny 4 ora sy 10 minitra, tolak andro. FANDAHARAM-POTOANA : Fihaonan ny Solombavambahoaka tamin ny Minisitry ny Atitany sy ny Fitsinjaram-pahefana ary ireo mpikambana ao amin ny Vaomieram-pirenena Mahaleotena misahana ny Fifidianana (CENI) Fitohizan ny fivoriana - - Lakolosy - Andriamatoa sy Ramatoa isany namana mpiara-mikambana ao amin ny Birao Maharitry ny Antenimierampirenena ; Andriamatoa sy Ramatoa isany Solombavambahoaka hajaina; Tompokolahy sy Tompokovavy, Mitohy ny fivoriantsika. Manolotra ny arahaba ho antsika Solombavambahoaka tonga manatrika izao fivoriambe izao. Saika hanolotra fiarahabana ho an ny CENI sy ny Minisitry ny Atitany kanefa tsy eo ry zareo. Tompokolahy sy Tompokovavy, alohan ny hirosoana amin ny votoatin-draharaha, iangaviana ianao, Andriamatoa Filoha Lefitra, hanao ny fiantsoana anarana.

4 Fiantsoana anarana - Andriamatoa MAHAZOASY Mananjara Freddie Richard Miarahaba antsika namana Solombavambahoaka. Solombavambahoaka isany: ABDILAH TSIVOULANGNE Maximin Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana manatrika fivoriana - Misaotra anao, Andriamatoa Filoha Lefitra, nanatanteraka ny fiantsoana anarana teo. Araka ny voasoratra ao amin ny fandaharam-potoanantsika, androany Alarobia 2 Desambra 2015 dia fivoriambe azon ny besinimaro atrehina izay hihaonana amin Andriamatoa isany mpikambana ao amin ny Vaomieram-pirenena Mahaleotena misahana ny Fifidianana na ny CENI sy amin Andriamatoa Minisitry ny Atitany sy ny Fitsinjaram-pahefana. Nahatonga taratasy taty amin ny Birao Maharitry ny Antenimierampirenena anefa ny Filohan ny Vaomieram-pirenena Mahaleotena misahana ny Fifidianana, mitondra ny laharana faha-065-ceni/15 tamin ny 1 Desambra 2015, izay mampahafantatra ny tsy fahafahany manatrika izao fivoriambe izao. Mivaky toy izao izany taratasy izany:

5 3 Antananarivo, le 01 décembre Le Président de la Commission Electorale Nationale Indépendante. à Monsieur Le Président de l Assemblée Nationale - ANTANANARIVO - N 065-CENI/15 Objet : Rencontre des membres de la Commission Electorale Nationale Indépendante avec l Assemblée Nationale. Référence : votre correspondance n 144-AN/P en date du 30 novembre Article n 6 de la loi n du 19 octobre 2015 relative à la structure nationale indépendante chargée de l organisation et de la gestion des opérations électorales dénommée Commission Electorale Nationale Indépendante. Monsieur Le Président, Suite à votre correspondance citée en référence, J ai le regret de porter à votre connaissance que conformément à la disposition de l article 6 de la loi sus-citée: mettant en exergue l indépendance de la Commission Electorale Nationale Indépendante, dans l exercice de ces attributions, elle se trouve navrée de ne pas pouvoir accéder à votre demande. Veuillez agréer, Monsieur Le Président, l expression de ma haute considération. Izay izany ny taratasy avy any amin ny CENI. Nivo Herinirina RAKOTOMANANA Raha jerena izany ny «article 6 de la loi » io izay isika ihany no nandany azy, mitondra ny lohateny hoe : «Relative à la structure nationale indépendante chargée de l organisation et de la gestion des opérations électorales dénommée Commission Electorale Nationale Indépendante», izay mivaky toy izao ihany koa : «Article 6: La Commission Electorale Nationale Indépendante n entretient aucun lien hiérarchique avec les autres Institutions de l Etat.

6 4 Elle est autonome, dans la prise de décisions qui rentrent dans le cadre de l exercice des attributions qui lui sont conférées par la présente loi. Les membres de la Commission Electorale Nationale Indépendante ne reçoivent aucune instruction dans l exercice de leurs fonctions, ni ne sollicite d instruction, d ordre ou d injonction d aucune autorité publique, privée ou politique». Izay no taratasy izay voaraintsika, Andriamtoa sy Ramatoa isany Solombavambahoaka hajaina. Izay ihany koa no manamarina ny tsy fisian ny olona miatrika antsika eto androany. Izay angamba, Tompokolahy sy Tompokovavy hajaina isany. Ny Minisitry ny Atitany moa tsy eo koa izy fa niala tsiny am-bava tamiko amin ny tsy fahafahany ho tonga eto. Misaotra antsika namaly ny antso satria ny fandaharam-potoanantsika dia misy an izao fivoriambe azon ny besinimaro atrehina izao. Raha ohatra sitrakareo dia hirava isika, hofaranana ny fivoriana. Olona roa na telo ihany angamba no omena fitenenana dia hirava isika raha sitrakareo, Tompoko. Ny Solombavambahoaka Mara NIARISY, nangataka fitenenana voalohany; manaraka ny Solombavambahoaka REMI dit DJAO JEAN, voafidy tany Sofia, ny Solombavambahoaka MAHARAMBY Ndalana Espérant dia tapitra ny fivoriantsika. Andriamatoa Solombavambahoaka Mara NIARISY Fanehoan-kevitra nataon ny Solombavambahoaka - Andriamatoa Mara NIARISY Misaotra, Andriamatoa Filoha, nanome ny fitenenana. Tsy misy adihevitra, Andriamatoa Filoha, ny fitenenana teo. Lalàna iny ary mazava ny namakianao azy, fa ny somary manahirana fotsiny: raha zavatra mazava sahala amin izay kanefa dia nekena, nampidirina ao anatin ny ordre du jour. Ohatran ny isika ihany no mamasoka ny tenantsika; zavatra efa fantatra fa tsy ara-dalàna no nampidirina tao anaty ordre du jour ; nandany an io isika. Androany vao fantatra fa hoe tsy manara-dalàna izy ity, fa tamin ny nampidirana azy izahay mbola tsy nahafantatra izany. Izay no fanamarihana, Andriamatoa Filoha, satria ianareo manana staff maro mety afaka mamaky texte sy ny karazany; manala baraka antsika ny zavatra tahak izao. Isika ihany no nanao ny lalàna, hoy ianao teo Andriamatoa Filoha, hay izao no atao. Izay ihany ny ahy, Andriamatoa Filoha, mirava isika izany, fa inona moa no azo atao.

7 5 Misaotra anao, Andriamatoa Solombavambahoaka Mara NIARISY. Ny Solombavambahoaka REMI dit DJAO JEAN. Andriamatoa REMI dit DJAO JEAN Ny ahy indray tsy mitovy amin ny an Andriamatoa Solombavambahoaka Mara NIARISY teo. Ity Antenimierampirenena ity raha ny fiheverako azy, mahazo manatona ato daholo na iza na iza. Ny Minisitry ny Atitany niala tsiny izany, tsy voafaritry ny lalàna ve ny fiantsoana azy. Anaty lalàna anie izany, tsy tonga izy fa fanambaniana antsika Solombavambahoaka izany. Manana zo feno afaka miantso ny mambran ny Governemanta isika ; afaka miantso ny Governemanta amin ny fotoana rehetra isika kanefa tsy tonga ry zareo. Ny CENI lazaina teo izany; vao tsy ela izay, «indépendant» anie ny BIANCO kanefa tonga taty amintsika ry zareo. Naninona izy no nandeha taty? Ny iantsoana ny mambran ny CENI anie momba ny décret ary ny Solombavambahoaka afaka miantso na iza na iza. Décret no iantsoana ny CENI hoe ahoana ity décret ity. Efa nifanaraka taminy isika, Andriamatoa Filoha ary ny Birao Maharitra rehetra no nandeha tany. Miresaka ny Solombavambahoaka sy ny Mpanatanteraka miampy ny CENI. Isika telo ireo no miaraka miresaka, Andriamatoa Filoha. Izany no nifanarahantsika tany. Ny Birao Maharitra rehetra tato amin ny Antenimierampirenena no tany ary naheno izany resaka izany. Azafady, Andriamatoa Mara NIARISY, izahay tany ary mba misaina ihany. Lalàna ihany koa anie izany ary nifanarahana io zavatra nataonay io. Tao izahay, nilaza koa fa mahazo mandeha atỳ ry zareo. Antsoina izy; isika telo tonta miaraka no mandamina ity raharaha ity. Izany no nifanarahanay tany. Tsy hitako ny ilazanao hoe tsy rariny, ianao mba efa Solombavambahoaka tranainy ihany. Manana ny zo miantso ny Governemanta isika. Maninona ny Minisitry ny Atitany no tsy tonga eto, tsy mety izany. Angamba tsy asiantsika commentaire lava, fa misaotra anao Andriamatoa Solombavambahoaka. Andriamatoa Solombavahoaka MAHARAMBY Ndalana Espérant no mamarana ny fitenenana. Andriamatoa MAHARAMBY Ndalana Espérant Andriamatoa Filoha, iverenako kely ny adoption de l ordre du jour -ntsika omaly iny. Raha ny fahalalako, Andriamatoa Filoha, mandritra ny session ordinaire, misy fihaonana indroa ataon ny Parlemanta sy ny Governemanta. Raha nijery aho, ohatran ny ny hitako kanefa ny datin ny famaranana ny fivoriana efa akaiky. Ohatran ny tsy voavakiko angamba fa tsy hita hoe tokony hisy ihany fihaonana amin ny Governemanta fanindroany mialohan ny hiravantsika.

8 6 Marina izay teninao izay. Nieritreritra mihitsy aho hoe tokony mbola hisy rencontre amin ny Governemanta amin ny volana Desambra. Ramatoa RAZANAMAHASOA Christine Harijaona angamba dia faranantsika ny fivoriana raha ankasitrahantsika, Tompoko. Omena anao, am-panajana ny fitenenana. Ramatoa RAZANAMAHASOA Christine Harijaona Miarahaba anao, Andriamatoa Filoha. Miarahaba ny mpikambana ao amin ny Birao Maharitra. Miarahaba ny Solombavambahoaka rehetra. Marina fa tsy mandray ordre avy amin iza na iza ny CENI kanefa ny fanatrehana eto tsy midika hoe hanome «ordre» azy isika. Iray izay. Ny fifandraisana amin ny Andrimpanjakana sahala amin ireny dia fandraisana am-panajana, «courtoisie» izany. Nangataka isika ; tsy fantatro aloha ny fangatahantsika fa tsy «interpellation» kosa; fangatahana am-panajana par correspondance de courtoisie hoe mba maniry ny hifanatri-tava aminy ny Solombavambahoaka kanefa ny «article 6» no narangarangany. Manaraka izany, ny «décision» avoakany anie tsy hoe tsy azo ivalozana fa misy «voie de recours» azo atao momba azy ireny, toy ny fangatahana eo anatrehan ny «juridiction compétente» na ny «Haute Cour Constitutionnelle» izay voalazan ny ao anatin io «texte» io, raha tsy diso aho. Anjarantsika moa izany satria izao foana ve no hisy amin ity Firenena ity. Tsy mba misy fifanakalozan-kevitra matotra sy mba hijerena ireo Andrimpanjakana izay mitondra ny feon ny vahoaka. Izay no didiko, izay no didiko fehy lehibe; sao misy interprétation erronée de l article 6 kosa ataon ny CENI. Raha ny fijerinay azy, ny fifanatonana sahala amin ireny tsy midika mihitsy fa manohitohina ny indépendance -ny na hoe hanome ordre azy isika. Anjarantsika ato no mandray fanapahan-kevitra na hanao communication mikasika an izay hoe tonga dia tsy mamaly ny article 6 ; na ny commission juridique sy ny équipe technique koa afaka mijery izay «palliatif de l article 6»-n ny CENI izay. Misaotra Tompoko. Misaotra anao, Ramatoa Solombavambahoaka. Manao satroka ny Solombavambahoaka REMI dit DJAO JEAN.

9 7 Andriamatoa REMI dit DJAO JEAN Milaza ny CENI fa tsy mandray baiko. Tamin ny faha-27 anie ny «décret du Gouvernement» no nivoaka, ny faha-28 isika no nifidy tato. Naninona no nanaraka ny décret momba ny bureau de vote io izy. Tsy manaraka ny tenin olona ve izy amin izany. Nandeha tany isika; ny décret talohan ny vote, talohan ny nivoahan ny serment. Narahiny ny décret, Andriamatoa Filoha, ka tsy manaraka tenin olona ve izy amin izany. Mahagaga ny zavatra tahaka izany. Manambany antsika Solombavambahoaka izany, manao antsika ho tsy misy dikany. Tokony tsy hirava maina isika fa inona no hataontsika Solombavambahoaka amin izao zavatra atao antsika izao. Ny Minisitry ny Atitany koa tokony hanontaniantsika izao kanefa tsy tonga izy fa ianao no nantsoiny, Andriamatoa Filoha. Tsy tokony hatao ambanin-javatra anie ny Solombavambahoaka rehefa miantso olona. Amin ny maha Filohan ny Antenimierampirenena anao no niantsoany anao ary lanintsika tato fa tsy amin ny maha RAKOTOMAMONJY Jean Max anao, Tompoko. Voahosihosy ny Assemblée Nationale amin izany, Andriamatoa Filoha. Tena manao tsinotsinona ity Andrimpanjakanantsika ity izany. Nilaza ho avy eto izy kanefa rehefa avy eo niala tsiny, mandetika antsika izany. Ny maro an isa anie no nanangan-tànana tamin izy ity tato ary ny CENI lazaintsika izany, naninona izy no nanaraka décret ; azon ny CENI atao ny miatrika ny olona eto rehefa antsoina izy. Tsy interpellation anie no ataontsika aminy fa fiangaviana. Tsy mety anie izany, Andriamatoa Filoha. Inona no hataontsika manoloana izany zavatra izany. Tsy tokony hanaiky an ity fanambaniana antsika ity isika ka avy hatrany dia hanao hoe: aleo ravana ny fivoriana. Aleo mba misy fanapahan-kevitra raisina, Tompoko. Manao satroka ny Solombavambahoaka ZAFIMAHATRATRA Abel. Andriamatoa ZAFIMAHATRATRA Abel Misaotra, Andriamatoa Filoha, nanome ny fitenenana. Ombako manana ny tenin Andriamatoa Solombavambahoaka REMI dit DJAO JEAN, Filoha Lefitra avy any Mahajanga. Tsy mendrika antsika ato amin ity institution ity, Andriamatoa Filoha, ny zavatra tahaka izao. Koa mangataka huis clos izahay alohan ny zavatra rehetra. Anjaranareo ao anatin ny Birao Maharitra izany, Andriamatoa Filoha; ahoana no mahamety izany. Ianareo moa manana dia haleha, efa henohenonay izany fa tsara tso-drano raha lasa; apetraho eto izahay handinika azy dia hohenonareo ny zavatra amboarinay eto raha vita satria tsy mendrika an ity Institution ity izany. Raha tonga eo ve ry zareo ka mivoaka isika, angamba tsy mety aminy izay.

10 8 Tokony hanomboka ny fifanajana satria tsy amin ny maha ZAFIMAHATRATRA Abel ahy fa amin ny maha Solombavambahoakan i Madagasikara avy any Manakara ahy; manana ny vahoakako ao an-damosiko ao aho. Izay no tokony hajaina entina manitsy azy. Tsy misy zavatra tsy azo iadian-kevitra eto raha ohatra misy ny tokony hahasoa ny Firenena. Tsy mendrika ny zavatra toy izao, Andriamatoa Filoha, fa mila dinihana ambony, mila dinihana ifotony. Misaotra Tompoko. Misaotra anao, Andriamatoa Solombavambahoaka. Misy satroka; mbola hiteny ve ny Solombavambahoaka RAKOTOMALALA Lucien? Omena anao ny fitenenana. Andriamatoa RAKOTOMALALA Lucien Firenena iaraha-manana izy ity, Andriamatoa Filoha. Marina na nolazainao teo aza ny lalàna hoe tokony hisy fihaonana amin ny institution samihafa na indépendant aza ny CENI. Matoa isika nampiantso azy, misy zavatra tsikaritra mety hitera-doza eto amin ny Firenena ao. Izay no olana, satria ny fisian ny crise cyclique eto amin ny Firenena dia noho ny fikarakarana fifidianana tsy manara-dalàna ary tsy mametraka ny tena principe amin ny tokony ho izy. Raha tsy mandray andraikitra isika manatanteraka ny asantsika hoe: io misy résolution raisintsika, mba ho afa-po isika, afamiala isika eo anatrehan ny Firenena sy ny vahoaka Malagasy fa nandray andraikitra mba tsy hisian izay, mba hisorohana izay zavatra mety hateraky ny post électoral izay. Ohatran izay, Andriamatoa Filoha, izy ity saingy toa afenimpenintsika, fa ny olana anie dia ny resaka urne par commune io. Izay no tsy maha- crédible ny fifidianana. Aleo tonga dia ambara ny hevintsika. Tsy mandidy isika mba tokony hisy résolution tenenintsika hoe: jereonareo fa mety hitera-doza ho an ny Firenena izany. Izay no tiako ambara, Andriamatoa Filoha. Na tsy eo aza ry zareo, afaka manome soso-kevitra isika fa tsy hoe intervention indépendant sy ny karazany. Zavatra efa hita hoe tsy ara-dalàna io ve dia havelantsika amin izao foana. Alaintsika ny antsika, afa-tsiny amin ny vahoaka Malagasy amin izay. Misaotra Tompoko.

11 9 Misaotra anao, Andriamatoa Solombavambahoaka. Misaotra anareo amin ny fanehoan-kevitra samihafa izay samy manan-danja daholo. Araka ny voalaza teo, sahala amin ny BIANCO izao, structure indépendante ihany koa, fa rehefa nasaintsika izy dia tonga teto ary ny fanasana araka ny voalazan-dramatoa Solombavambahoaka voafidy tany Ambatofinandrahana, RAZANAMAHASOA Christine Harijaona teo, izany fifandraisan ny samy Andrimpanjakana izany tokony hisy ara-pomba fifanajana. Tsy voatery hoe mandray baiko na ahoana fa Andrimpanjakana samy manana ny maha izy azy. Eo ihany koa, araka ny voalaza teo, raha ohatra ny Solombavambahoaka mahatsapa fa mety hiteraka tsy fetezana eto amin ity Tanindrazana iombonana ity ny zavatra atao, tokony hisy ny fifanakalozan-kevitra sy fifandresen-dahatra mba tsy hisian ny nenina any aoriana any na fifanomezan-tsiny. Heveriko fa samy mafonja ny hevitra nipoitra teo ka anjarantsika no mandinika sy mamakafaka hoe: ahoana no tokony hatao eo anatrehan izany zavatra izany? Izaho tsy hiteny satria samy miaraka manara-baovao daholo isika amin ny zava-mitranga any amin ny firenena hafa any amin ny vokatry ny tsy fetezan ny fifidianana ary izany indrindra no mahatonga antsika miezaka misoroka satria efa niaina tao anatin ny krizy lalina loatra ny Firenena, ka tokony mba hiroso amin izay am-pilaminana, am-pitoniana ao anaty firaisankina amin ny fandresena ny ady amin ny fahantrana sy ny hisian ny fampandrosoana. Raha ity kosa, isika Solombavambahoaka ihany no tompon ny fanapahan-kevitra, fa samy manala ny adidy aman andraikitra tandrify azy ny tsirairay; torak izany koa ny Andrimpanjakana tsirairay. Tsy izay? Amin ny zavatra toy intony koa, misy resaka lalàna ary misy voie de recours. VoalazandRamatoa Solombavambahoaka RAZANAMAHASOA Christine Harijaona teo, fa ny voie de recours ho an izay mahatsapa fa concerné amin ilay zavatra, afaka manao an izany izy. Amin ny maha Solombavambahoaka antsika, karazany hoe milaza izay heverina fa ahiahy tsy ihavanana mba isorohana izay zavatra mety hisy. Andraso fa misy fitenenana horaisin ny Solombavambahoaka. Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina Raha isika nandeha tany amin ny CENI, Andriamatoa Filoha, ny vahaolana iray ahafahana mamaha, ahafahana misoroka izany dia ny fihaonan ny Governemanta sy ny Antenimierampirenena ary ny CENI; ireo no miaraka miresaka mikasika io zavatra io. Izay no zavatra tsara ary samy olon-dehibe isika no nifampiresaka tao. Faharoa, heveriko fa any amin ny «conseil d Etat» no voie de recours. Ireny angamba mety efa dernier recours. Tsy misy tsy vitan ny fifampiresahana fa raha samy hanao mafy loha be tsy hifampihaino, izay no mahatonga ny zavatra tsy mety eto amintsika.

12 10 Raha eritreretin ny CENI hoe indépendante izy, tsy ho avy atỳ amintsika mihitsy izy fa andao hitady toerana neutre ahafahana mifampiresaka an izay zavatra izay ; tsy any amin ny haino aman-jery isika no mifampiteny sy mampita izay zavatra tiana hotenenina ; tsy mahavaha olana anefa izay zavatra izay. Izay no eritreretiko hoe andao isika hijery ny fomba hanaovana ny rencontre de tripartite satria ao anaty lalàna, ao anaty décret, mazava tsara fa afaka ovaina ny liste électorale sy ny emplacement des bureaux farafahatarany roa andro alohan ny fifidianana. Izany hoe, ny faha-27 Desambra 2015, mbola azo ovaina izany. Ny dikan izay, tsy hoe décision efa noraisina io ka tsy azo iverenana intsony. Azo iverenana izany satria misy ny cas de force majeure, misy ny zavatra azo ifampiresahana, eritreretiko fa izay hahavita tsara ity fifidianana ity no hataontsika, tsy tokony hiverina amin ny zavatra tsy mety sy hiteraka «trouble» indray, sanatrian ny vava, aorian ny fifidianana. Misaotra Tompoko. Misaotra anao, Ramatoa Filoha Lefitra. Izay tokoa ny resaka nifanaovana tany. Manao satroka, izay nivadika fananganan-tànana, Andriamatoa REMI dit DJAO JEAN anefa talohanao ny Solombavambahoaka RASOLONOMENJANAHARY Fidélis Justin. Andriamatoa RASOLONOMENJANAHARY Fidélis Justin Misaotra, Andriamatoa Filoha, nanome ny fitenenana. Ho ahy, ny angatahako kely satria tokony hisy fihaonana raha araka ny voalazan-dramatoa Filoha Lefitr Antananarivo teo. Mety hanampy ao koa ny HCC fa ny angatahako: aleo mifampidinika à huis clos aloha isika hijery izay fanapahan-kevitra tokony horaisina fa lasa polémique ity zavatra ity, raha eto ireto mpanao gazety ireto. Misaotra indrindra, Tompoko. Ny Solombavambahoaka REMI dit DJAO JEAN, manaraka ny Solombavambahoaka RAKOTOMALALA Lucien. Andriamatoa REMI dit DJAO JEAN

13 Fandraisana fanapahan-kevitra amin ny hanovana ny fandaharam-potoana - Andraso aloha atsangano ny tànan izay milaza fa avaditsika «huis clos» ity fivoriana ity. Averiko indray mandeha, atsangano ny tànan izay mankasitraka ny hanaovana huis clos? - Solombavambahoaka miisa 17 no nanangan-tànana - Atsangano ny tànan izay mankasitraka ny fivoriana amin izao endriny izao? - Solombavambahoaka miisa 3 no nanangan-tànana - Tsy androany no anaovana ny huis clos. Atsangano ny tànan izay milaza fa atao androany ny huis clos. - Solombavambahoaka miisa 13 no nanangan-tànana - Atsangano ny tànan izay milaza fa tsy androany ny huis clos. - Solombavambahoaka miisa 13 no nanangan-tànana - «Ex-aequo», rehefa izay no mitranga, ny be taona no atao satria mitovy ny isa, mba tsy anaovantsika ny totalin ny taonan ny pour sy ny contre. Aleo averintsika atsangana indray ny tànana. Atsangano ny tànan izay milaza hoe atao huis clos izao androany izao ihany. - Solombavambahoaka miisa 14 no nanangan-tànana - Izay milaza fa huis clos, tsy atao androany? Asiana tehaka ihany na dia resy aza. - Solombavambahoaka miisa 13 no nanangan-tànana - - Tehaka -

14

15 FIZAHAN-TAKELAKA Pejy - Fitohizan ny fivoriana Teny nataon Fiantsoana anarana Teny nataon Andriamatoa MAHAZOASY Mananjara Freddie Richard Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana manatrika fivoriana Teny nataon Fanehoan-kevitra nataon ny Solombavambahoaka Teny nataon Andriamatoa Mara NIARISY Teny nataon Teny nataon Andriamatoa REMI dit DJAO JEAN Teny nataon Andriamatoa MAHARAMBY Ndalana Espérant Teny nataon Teny nataon-dramatoa RAZANAMAHASOA Christine Harijaona Teny nataon Andriamatoa REMI dit DJAO JEAN Teny nataon Teny nataon Andriamatoa ZAFIMAHATRATRA Abel Teny nataon Teny nataon Andriamatoa RAKOTOMALALA Lucien Teny nataon Teny nataon-dramatoa RAZAFIMANANTSOA Lobo Hanitriniaina Teny nataon Teny nataon Andriamatoa RASOLONOMENJANAHARY Fidélis Justin Teny nataon Andriamatoa REMI dit DJAO JEAN Fandraisana fanapahan-kevitra amin ny hanovana ny fandaharam-potoana Teny nataon Teny nataon Fiatoan ny fivoriana... 12

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg 0 UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

Conversations en ligne : descriptions, perspectives. Louise Ouvrard

Conversations en ligne : descriptions, perspectives. Louise Ouvrard Conversations en ligne : descriptions, perspectives Eléments théoriques La variation Quelques caractéristiques du discours électronique La langue malgache Le corpus Présentation Analyse Quels apports à

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

Noely 2009 Taom-baovao 2010

Noely 2009 Taom-baovao 2010 FMM Fiombonana Miara-mivavaka eto Münich. Noely 2009 Taom-baovao 2010 Fa Zaza no teraka ho antsika, Zazalahy no omena antsika, ary ny anarany atao hoe Mahagaga, Mpanolon-tsaina, Andriamanitra Mahery, Rain

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

JEAN-MARC CHÂTAIGNIER Défenseur de Joaquim Chissano

JEAN-MARC CHÂTAIGNIER Défenseur de Joaquim Chissano cyan magenta jaune noir PROGRAMME P.7 QUOTIDIEN GRATUIT D INFORMATION N 0103 DU Vendredi 16 Juillet 2010 L accès sans peine à l information OIF SOATOAVINA TRAFIC Soutien de la médiation internationale

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

Ny Vaovao Mahafaly. La Bonne Nouvelle

Ny Vaovao Mahafaly. La Bonne Nouvelle Ny Vaovao Mahafaly La Bonne Nouvelle Ary tamin ny fahenim-bolana dia nirahin Andriamanitra ny anjely Gabriela ho any an-tanàna anankiray any Galilia atao hoe Nazareta, ho any amin ny virijina anankiray,

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES DEPARTEMENT INTERDISCIPLINAIRE DE FORMATION PROFESSIONNELLE COMMUNICATION ET DYNAMIQUE LOCALE RAPPORT

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

LANY TAMINGANA ETO AMINTSIKA

LANY TAMINGANA ETO AMINTSIKA cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

MpANAMORY RAdO RABARILALA

MpANAMORY RAdO RABARILALA ENIM-BOLANA TSY TAFATSANGANA FANJAITRA MIISA 21 NO NESORINA TAO AN-KIBON i LALAINA P.06 N 3190 L u n d i 2 9 j u i n 2 0 1 5 PRIX : Ar 400 zatovolahy NANGALATRA volamena P.06 TENY AM-pASANA : NANONOFY

Plus en détail

ATRIKA Le journal de l ASMF

ATRIKA Le journal de l ASMF Association des Anciens du Collège St-Michel en France ATRIKA Le journal de l ASMF OCTOBRE 2010 ÉDITION : Octobre 2010, NUMÉRO 12 Éditorial 2010 ASMF bureau 2009/2010 Joël Rambatomanga(1990) Président

Plus en détail

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. "Dieu qualifie ceux qui sont appelés", hoy Rakotolehibe Mamy, Talen ny FMMB

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. Dieu qualifie ceux qui sont appelés, hoy Rakotolehibe Mamy, Talen ny FMMB Taniketsa - Laharana faha 58 - Septambra 2014 1 Gazetin ny Sampana Sekoly Alahady FJKM Andrainarivo Taniketsa Miseho isan-telo volana. Laharana faha 58. Septambra 2014. Vidiny: 400 Ariary. Tranokala: www.sa-andrainarivo.mg

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

AMBATONAKANGA SY NY MISIONERA ;

AMBATONAKANGA SY NY MISIONERA ; AMBATONAKANGA SY NY MISIONERA ; Raha miteny hoe Ambatonakanga isika protestanta amin izao andro ankehitriny izao dia ny trano fiangonana vita amin ny vato no tonga ao an-tsaintsika voalohany ary vitsy

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

GLOTTOPOL Revue de sociolinguistique en ligne

GLOTTOPOL Revue de sociolinguistique en ligne GLOTTOPOL Revue de sociolinguistique en ligne N 2 Juillet 2003 Anciens et nouveaux plurilinguismes SOMMAIRE Introduction Premier chapitre : Les situations de plurilinguisme : aménagement et représentations

Plus en détail

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar HUMBOLDT-UNIVERSITÄT ZU BERLIN Landwirtschaftlich-Gärtnerische Fakultät Schriftenreihe des Seminars für Ländliche Entwicklung VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

Plus en détail

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE -----------------------

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- MINISTERE DES TRANSPORTS ET DE LA METEOROLOGIE -------------- RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- I. CONTEXTE Malgré

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

FINOANA SY FAHAZAVANA FOI ET LUMIERE

FINOANA SY FAHAZAVANA FOI ET LUMIERE FINOANA SY FAHAZAVANA FOI ET LUMIERE BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 Gazety avoakan ny Mpiaramivavaka Kristianina Malagasy eto Bénélux (M.K.M.B.) Bulletin de liaison et d information de la

Plus en détail

Février - mars 2016 n 47 TRAIT D UNION

Février - mars 2016 n 47 TRAIT D UNION Février - mars 2016 n 47 TRAIT D UNION Le journal en ligne de la RNS Train Manakara-Fianarantsoa Éditorial 2 Lyon et ses incontournables 3 La tribune du coordinateur 4 Itinéraire d un sportif gâté 5 Lalaina

Plus en détail

SOMMAIRE. Comptes rendus

SOMMAIRE. Comptes rendus Revue de sociolinguistique en ligne n 22 juillet 2013 Les langues des apprenants dans les systèmes éducatifs post-coloniaux Numéro dirigé par Bruno Maurer GLOTTOPOL SOMMAIRE Bruno Maurer : Présentation.

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

EDITORIAL. Un bon projet ALAHADY 26 SEPTAMBRA 2010. Fanompoampivavahana voalohany amin ny taona 2010-2011.

EDITORIAL. Un bon projet ALAHADY 26 SEPTAMBRA 2010. Fanompoampivavahana voalohany amin ny taona 2010-2011. BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 1 - Septembre 2010 EDITORIAL Un bon projet Mensuel - Editeur Responsable:

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

d une solution malgachomalgache

d une solution malgachomalgache cyan magenta jaune noir PROGRAMME P.7 ECONOMIE TRANSITOIRE FANANAN-TANY DECHETS URBAINS Interventionnisme critiqué BIRAO FOTOTRA A VALORISER L inaccessibilité aux intrants notamment aux engrais induit

Plus en détail