Les principales bases de données en bioinformatique

Dimension: px
Commencer à balayer dès la page:

Download "Les principales bases de données en bioinformatique"

Transcription

1 Bases de données en bioinformatique Les principales bases de données en bioinformatique Nombreuses bases de données en bioinformatique Données issues d'expériences, de publications, d'analyses faites à la main par des chercheurs Données issues d'extractions ou de raisonnements automatiques La plupart de ces bases sont accessibles librement sur Internet Banque de données : base de données orientée vers la consultation et le recueil des données Chaque base propose un accès simplifié via un site oueb spécifique qui propose des fonctions de : Recherche Visualisation des données Lien vers d'autres bases 142 Ces techniques fonctionnent dans les moteurs de recherche généraliste sur Internet (Google,...) Recherche sodium transporting ATPase Et aussi sodium/potassium-transporting ATPase Tree of life grand dictionnaire terminologique Pubmed Transcription Gène (ADN) Transcript (ARNm) EMBL (séquences) Ensembl (séquences) EPD (promoteurs) Unigen (lieu d'expression) Agit sur Maladie génétique Recherche sodium transporting ATPase Mais exclut sodium/potassium-transporting ATPase OMIM (génétique) Orphanet (clinique) Le grand dictionnaire terminologique Dictionnaire français-anglais Avec des traductions spécifique à différents domaines (biologie, médecine, aéronautique,...) Attention : dictionnaire français québécois! Traduction Cause 144 Article (bibliographie) Ex : "sodium transporting" Dictionnaires Ex : sodium transporting 143 Espèce Mais aussi dans la plupart des moteurs de recherche de bases de données bioinformatiques Guillemets : pour rechercher des mots à la suite les un des autres => Les différentes bases sont inter-connectées entre elles Beaucoup de redondance d'une base à l'autre Résumé des différentes bases Techniques de recherche 146 Soigne Protéine EMBL (séquences) Uniprot (séquences) PDB (séquences) PDB (repliements) PROSITE (domaines) PFAM (domaines) Médicament DrugBank (cibles) Thériaque (clinique) 145

2 Pubmed / Medline Medline : base de données bibliographiques en médecine / biologie Pubmed : interface permettant de consulter la base Lien vers le texte des articles disponibles en ligne 149 EMBL / Nucleotide / DDB Séquences de nucléotides (ADN) : EMBL (European Molecular Biology Laboratory DNA database) Nucleotide (anciennement appelé GenBank) DNA Database of Japan EMBL Contiennent toutes les séquences de nucléotides librement disponibles et leurs traductions en protéines Les séquences d'adn proviennent de séquençages Les séquences de protéines proviennent de la traduction automatique des séquences d'adn correspondantes Les 3 banques sont synchronisées => même contenu Cependant l'interface et les fonctions proposées par les 3 banques sont un peu différentes Recherche principalement par nom de gène ou de protéine, et ou nom d'espèce 150 Génome entier Gène / ADN Protéine Type de résultats Pour rechercher un gène codant une protéine => coding sequence Release : dernière version publiée Update : ajout depuis la dernière «release»

3 Format des séquences Il existe différent format pour les séquences Le format FASTA est le plus utilisé EPD Séquence d'adn, d'arn, de protéine,... Exemple de séquence protéique au format FASTA : Identifiant de la base de données (sp = SwissProt) Identifiant de la séquence dans la base EPD : Eukaryotic Promoter Database : Nom de la séquence et de l'espèce Base de données sur les séquences promoteurs : séquence d'adn déclenchant la transcription Uniquement pour les eucaryotes Données expérimentales >sp P05231 IL6_HUMAN Interleukin-6 precursor (IL-6) - Homo sapiens (Human). MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM La transcription commence ici Liste des gènes utilisant ce promoteur

4 Ensembl Ensembl : Base de données sur la transcription des gènes Traduit en protéine ARNm (Transcripts) Introns, exons, séquences codantes,... Reste dans le noyau (intron) Annotation manuelle en partant des séquences de gènes dans la base EMBL, notamment chez l'homme Quitte le noyau mais n'est pas traduit 160 Gène Intron Exon Séquence non-codante Séquence codante Intron (épissage alternatif) Pourquoi les 4 derniers transcripts ne sont pas traduits en protéine? Domaines protéiques

5 Unigen Unigen : Base de données sur l'expression des gènes Quels gènes sont exprimés dans quel organe, dans quel maladie, à quel moment? Données issues de la recherche de marqueurs de séquences exprimées (Expressed Sequence Tags, EST) EST = séquence d'adnc (= ARNm rétro-transcrit) courte considérée comme caractéristique d'un ou plusieurs gènes => données expérimentales mais assez peu fiables! 166 Uniprot Uniprot Les données proviennent de deux sources : La base de données SwissProt, remplie manuellement à partir de publications La traduction automatique des séquences d'adn issues de la base EMBL Il est plus facile de séquencer un gène qu'une protéine! Recherche principalement par nom de gène ou de protéine, et ou nom d'espèce 169 Uniprot Uniprot

6 En bleu : source automatique non vérifiée par un expert => méfiance! En jaune : source revu manuellement par un expert PDB PDB (BrookHaven Protein DataBank) Séquences et structures des protéines Visualisation en 3D Les données proviennent de cristallographie, de RMN,... Pour certaines protéines, plusieurs structures sont disponibles Structure de la protéine seule ou avec ligand Structure de la protéine dans différents milieux Structure obtenue avec des méthodes expérimentales différentes 173 PDB : structure secondaires PDB : séquence des protéines PDB : structure tertiaires

7 PDB : structure tertiaires PROSITE PROSITE PROSITE : Base de données sur les domaines des protéines, les familles protéiques et les fonctions biologiques associées Un domaine = une région d'une protéine ayant une fonction biologique propre, que l'on retrouve sur plusieurs protéines Ex : plusieurs enzymes ont un même domaine avec une fonction d'hydrolyse de l'atp Les motifs des domaines ont été déterminés de manière manuelle Recherche par nom de protéine, nom de domaine, fonction biologique,... Identifiants : PDOC... => domaine P... => protéine 180 PROSITE PROSITE

8 PROSITE Permet d'accéder au motif du domaine Motif du domaine Qualité du motif Recherche des «architectures» (= suite de domaines) dans les protéines de la base Swiss Prot Recherche toutes les protéines Ayant ce domaine dans Uniprot Liste des 22 acides aminés Une ligne par résidu dans le motif Résidu n 1 Résidu n 2 Résidu n 3... Acide aminé le plus fréquent en position n 1 Fréquence de l'acide aminé E en position n 3 PROSITE : architecture de protéines Protéine «Légo»! Ici, des transporteurs actifs Afficher les 33 autres protéines Recherche du domaine dans Uniprot Distance en nombre de résidus Attention! Il s'agit de rechercher toutes les protéines dont la séquence contient le motif du domaine! Cela ne garantit pas à 100% que la protéine a la fonction biologique associée au domaine!

9 Recherche par séquence PFAM PFAM (Protein Family) : Base de données sur les familles de protéines et les «clans» (= super familles) Problème : on a séquencé un gène, Est-il est déjà connu? Sous quel nom? Existe-t-il des gènes de séquences proches déjà connu? => recherche par séquence Par rapport à PROSITE : > de séquences connues Construit à partir des séquences de la base Uniprot PFAM-A : annotation manuelle PFAM-B : annotation automatique, à partir de recherche de domaines dans les séquences, de similarités... Site oueb plus joli... Mais moteur de recherche moins bon! Recherche par séquence BLAST Le programme BLAST permet de faire des recherches par séquence Il est disponible sur Internet Plusieurs variantes : Problème du nombre de séquences connues Problème des variations entre séquences Mutations, variations individuelles, erreurs de séquençage => Utilisation de moteurs de recherche spécifiques Blast n : recherche d'une séquence nucléotidique dans une banque d'adn Blast p : recherche d'une séquence protéique dans une banque de protéine BLAST sur Internet Séquence à rechercher Base de données où la recherche est effectuée Rechercher seulement chez certaines espèces Lancer le BLAST!

10 BLAST sur Internet BLAST sur Internet Nombre maximum de séquences affichées Nombre d'erreur que l'on accepte (E-value) E-value = 10 => parmi les résultats, statistiquement en moyenne 10 alignement de séquence seront dus au hasard BLAST sur Internet BLAST sur Internet Séquence requête 14 séquences retrouvées par BLAST La position des barres indique les alignements locaux La couleur indique le score d'alignement Gene Ontology BLAST sur Internet Gene Ontology (GO) : Ontologie : Plus qu'une base de données, une base de connaissance Ensemble structuré des concepts et des relations entre ces concepts dans un domaine de connaissance donné Ensemble => On recherche une certaine exhaustivité pour avoir toutes les connaissances d'un domaine Structuré => des traitements automatiques sont possibles Un cours peut contenir l'ensemble des connaissances d'un domaine mais il n'est pas structuré (d'un point de vue informatique) => pas de traitement automatique possible 201

11 Gene Ontology Ontologie Exemple de raisonnement sur une ontologie sur les écosystèmes et les chaînes alimentaires Animal Gene Ontology (GO) : Attention, ce n'est pas vraiment une ontologie! Polluant est-un est-un est-un Homme mange est-un Brochet mange se concentre dans Gardon Seulement quelques types de relations : PCB habite habite habite présent dans Ville Lac Est-un Partie-de Régule Régule positivement Régule négativement => pour avoir une «vraie» ontologie, il manque des relations : stocke, détruit,... L'homme risque-t-il d'être intoxiqué par les PCB (polychlorobiphényles) rejeté dans les eaux? Gene Ontology Gene Ontology Gene Ontology (GO) : Termes : Gènes : Composants de la cellule Cellule partie-de Membrane Cytoplasme Noyau Nucléole... Vésicule sécrétoire Processus biologiques Processus métaboliques est-un Métabolisme des lipides Mort cellulaire... n tatio anno Insuline (homme) BMP2 (poisson zèbre)... (...) Fonctions moléculaires Activité catabolique Activité anti-oxydante Régulateur de transcription Gene Ontology Gene Ontology

12 Gene Ontology Gene Ontology partie de est-un Régulation Mapping Gene Ontology Liste des domaines protéiques concernant le transport du sodium

13 KEGG KEGG : Kyoto Encyclopedia of Genes and Genomes : Ontologie Portant principalement sur les voies métaboliques Mais aussi sur les gènes, les protéines, les maladies, les médicaments Très complexe! 214 Tree of life Tree of life : Base de données de taxonomie Classification des êtres vivants Avec des photos! 219

14 Tree of life OMIM (MIM) OMIM (Online Mendelian Inheritance in Man) : Base de données sur les maladies génétiques chez l'homme Données issues d'articles, d'expériences,... Recherche par nom de maladie ou nom de gène 221 OMIM : gène OMIM : maladie Lien vers les gènes ou les portions de chromosome responsables de la maladie OMIM : variants allèliques OMIM : SMP dans Ensembl Un T remplace un C SNP = Single Nucleotide Polymorphisme = Mutation concernant un seul nucélotide (les plus fréquentes)

15 OrphaNet OrphaNet : Base de données sur les maladies orphelines Informations sur les gènes concernés (pour les maladies génétiques), similaire à OMIM Mais aussi des informations cliniques Essais cliniques de nouveaux médicaments Base française! 226 DrugBank Base de données sur les médicaments Information sur les cibles des médicaments Attention : base américaine => médicaments américains! 228 DrugBank Thériaque / Thésorimed Base de données sur les médicaments Accessible gratuitement, mais il faut s'inscrire! Informations cliniques : Contre-indications, effets indésirables,... Base française => médicaments français 231

16 Résumé des différentes bases Données expérimentales Données calculées Mélange des deux Espèce Tree of life Transcription Gène (ADN) Transcript (ARNm) EMBL (séquences) Ensembl (séquences) EPD (promoteurs) Unigen (lieu d'expression) Article (bibliographie) Pubmed Traduction Cause Agit sur Soigne Maladie génétique OMIM (génétique) Orphanet (clinique) Il est très important de savoir évaluer la qualité des données Y compris pour les données que l'on récupère sur Internet! Y compris pour les logiciels! Les informations «de base» (auteur, date,...) sont-elles disponibles? Les sources sont-elles disponibles? Auteur : Transparence : Qui est à l'origine des données? Quel est son statut? A-t-il des intérêts particuliers? Les données sont-elles récentes? Sont-elles à jour? Fonction biologique DrugBank (cibles) Thériaque (clinique) Gene Ontology PROSITE (domaines) PFAM (domaines) 233 Parfois des approximations : diminution de la qualité des résultats au profit de la rapidité Recherche d une solution parmi un ensemble infini de possibilités Ce n est pas toujours la solution la meilleure qui est trouvée! Les banques de données : Ne les croyez pas systématiquement!!! Les données se sont pas toujours fiables ou à jour. Différence entre réalité mathématique et réalité biologique Date et péremption : Médicament Les logiciels : Ne les croyez pas systématiquement!!! Quelques critères d'évaluation : 234 => cf TP1 Les ordinateurs ne font pas de biologie, ils calculent vite! Exemple pratique Question : EMBL (séquences) Uniprot (séquences) PDB (séquences) PDB (repliements) PROSITE (domaines) PFAM (domaines) Qualité des données Qualité des données Protéine Quels sont les maladies génétiques pouvant être causées chez l'homme par une déficience des transporteurs potassiques transmembranaires? Comment répondre en combinant les différentes bases de données vues précédemment? 236 Puis ontology 235

17 6046 gènes / protéines...

18 6046 gènes / protéines...

19 .../... MIM = OMIM

20 Exemple pratique Nous avons combiné les informations de 4 bases entre elles Attention aux limites des différentes bases Seules les connaissances connues sont présentes dans les bases! Il reste beaucoup d'inconnu en biologie Lorsqu'il y a beaucoup de gènes à rechercher : Possibilité d'automatiser les recherches à l'aide de scripts (programmation) 259 Pour l'examen Exercice comme ceux vu en cours et en TP Les documents sont autorisés Pensez à les amener! Les calculatrices, les ordinateurs, les téléphones portables et les livres sont interdits 260

Les principales bases de données en bioinformatique

Les principales bases de données en bioinformatique Les principales bases de données en bioinformatique 156 Bases de données en bioinformatique Nombreuses bases de données en bioinformatique Données issues d'expériences, de publications, d'analyses faites

Plus en détail

Introduction à l Analyse des séquences biologiques.

Introduction à l Analyse des séquences biologiques. Introduction à l Analyse des séquences biologiques Christian.Fondrat@dsi.univ-paris5.fr Les outils d analyse de séquences C est QUOI? DES BASES DE DONNEES DES PROGRAMMES Utilitaires (consultation, acquisition

Plus en détail

Banques de Données de séquences

Banques de Données de séquences Banques de Données de séquences D après cours de l équipe Bonsai, CRIStAL UMR 9189 Sylvain.legrand@univ-lille1.fr 7 et 8 Septembre 2016 Sylvain Legrand Introduction Définition bioinformatique Un domaine

Plus en détail

Les bases de données biologiques. Sigrid Le Clerc Conservatoire Nationale des Arts et Métiers Chaire de Bioinformatique

Les bases de données biologiques. Sigrid Le Clerc Conservatoire Nationale des Arts et Métiers Chaire de Bioinformatique Les bases de données biologiques Sigrid Le Clerc Conservatoire Nationale des Arts et Métiers Chaire de Bioinformatique Sommaire 1. Introduction 2. Le système Entrez 2.1. Description du système Entrez 2.2.

Plus en détail

Informatique et biologie moléculaire

Informatique et biologie moléculaire UE09s Méthodes d étude et analyse du génome Techniques d analyse des gènes à grande échelle Bio-informatique PACES 2013-2014 Dr Nicolas SEVENET Informatique et biologie moléculaire Avertissement Utilisation

Plus en détail

Informatique et biologie moléculaire

Informatique et biologie moléculaire UE 1B-biomolécules, génome, bioénergétique, métabolisme, méthodes d étude et analyse du génome II-le génome : sa structure, son expression Organisation, évolution et fonction du génome humain Approches

Plus en détail

AVL Liban La Bioinformatique. Bioinformatique

AVL Liban La Bioinformatique. Bioinformatique AVL Liban 2011 La Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu www.cs.sjsu.edu/faculty/khuri Sami Khuri sami.khuri@sjsu.edu Qu est-ce

Plus en détail

Chapitre 3 : L expression de l information génétique. Activité 1 : Les deux étapes de l expression de l information génétique

Chapitre 3 : L expression de l information génétique. Activité 1 : Les deux étapes de l expression de l information génétique Connaissances L'ADN contient des unités d'information appelées gènes. Le génome est l ensemble du matériel génétique d un organisme. Chez les eucaryotes, la transcription a lieu dans le noyau, la traduction

Plus en détail

Initiation à la Bioinformatique

Initiation à la Bioinformatique Université d Alexandrie Initiation à la Bioinformatique Basic Local Alignment Search Tool BLAST Université d Alexandrie AUF Auteur(s): Mohamed GAD 2009/2010 Auteur(s) : Mohamed GAD Professeur à l institut

Plus en détail

Introduction à la bioinformatique

Introduction à la bioinformatique Faculté des Sciences - Rabat Laboratoire de Microbiologie et Biologie Moléculaire -------------------------------------- Université Mohamed V - Agdal Faculté des Sciences B.P. 1014 - Rabat - MAROC TD Biologie

Plus en détail

BIOINFORMATIQUE APPLIQUÉE - CHMI 3206 F. Professeur : Eric R. Gauthier. Test de mi-session. 31 octobre Votre nom :

BIOINFORMATIQUE APPLIQUÉE - CHMI 3206 F. Professeur : Eric R. Gauthier. Test de mi-session. 31 octobre Votre nom : BIOINFORMATIQUE APPLIQUÉE - CHMI 3206 F Professeur : Eric R. Gauthier Test de mi-session 31 octobre 2006 Votre nom : Consignes : 1) Durée : 85 min 2) 5 questions sur 5 pages, pour 80 points. Compte pour

Plus en détail

Annotation de protéines

Annotation de protéines JS Varré Université Lille 1 jean-stephane.varre@lifl.fr http://www.lifl.fr/~varre jean-stephane.varre@lifl.fr 1 / Pourquoi faire de l annotation automatique de protéines? Il est difficile de trouver expérimentalement

Plus en détail

A BIOINFORMATIQUE FONCTIONNELLE

A BIOINFORMATIQUE FONCTIONNELLE Biologie moléculaire-2017 1 A BIOINFORMATIQUE FONCTIONNELLE PRÉDIRE LA FONCTION D UNE PROTÉINE INCONNUE Supposons que vous avez trouvé la séquence d'acides aminés d'une protéine inconnue et que vous souhaitez

Plus en détail

Les virus et les bactéries

Les virus et les bactéries Les virus et les bactéries Les bactéries sont des procaryotes. Une cellule procaryote est plus petite et plus simple qu une cellule eucaryote. Les virus sont encore plus petits et plus rudimentaires. Les

Plus en détail

Introduction aux bases de données: application en biologie

Introduction aux bases de données: application en biologie Introduction aux bases de données: application en biologie D. Puthier 1 1 ERM206/Technologies Avancées pour le Génome et la Clinique, http://tagc.univ-mrs.fr/staff/puthier, puthier@tagc.univ-mrs.fr ESIL,

Plus en détail

Cours de Biologie moléculaire de Licence professionnelle 2011

Cours de Biologie moléculaire de Licence professionnelle 2011 Cours de Biologie moléculaire de Licence professionnelle 2011 Sommaire 1. Introduction 2.1. La structure de l ADN 2.2. La structure de l ARN 2.3. Du gène à la protéine 2.3.1. La réplication 2.3.2. La transcription

Plus en détail

Introduction. La bioinformatique : Traitement des informations biologiques par des méthodes informatiques et/ou mathématiques.

Introduction. La bioinformatique : Traitement des informations biologiques par des méthodes informatiques et/ou mathématiques. Introduction La bioinformatique : Traitement des informations biologiques par des méthodes informatiques et/ou mathématiques. Interdisciplinaire par nature, la bioinformatique est fondée sur les acquis

Plus en détail

Un gène de la maladie de Crohn identifié

Un gène de la maladie de Crohn identifié Un gène de la maladie de Crohn identifié 07/09/07 Une équipe du centre Giga-Research de l'université de Liège vient d'isoler, sur le chromosome 5, un variant génétique qui prédispose à la maladie de Crohn.

Plus en détail

Vue d'ensemble des interfaces

Vue d'ensemble des interfaces Vue d'ensemble des interfaces Sage 50 Vue d'ensemble des interfaces 28.07.2014 2/9 Contenu 1. Logiciel Sage 50 un système ouvert... 3 Vue d'ensemble des interfaces... 3 2. Connexion On-Line via SOK Automation

Plus en détail

Vivant ou non vivant?

Vivant ou non vivant? Vivant ou non vivant? Vivant ou non vivant? BACTERIE Cellule animale Cellule végétale Problématique: Les êtres vivants sont I. Les éléments chimiques des êtres vivants Le non vivant Le vivant Un méduse

Plus en détail

Dans chaque cellule: -génome nucléaire -génome mitochondrial (-génome chloroplastique)

Dans chaque cellule: -génome nucléaire -génome mitochondrial (-génome chloroplastique) 6- Structure et organisation des génomes 6-1 Génomes eucaryotes Dans chaque cellule: -génome nucléaire -génome mitochondrial (-génome chloroplastique) 6-1-1 Génomes nucléaires 6-1-1-1 Nombre d exemplaires

Plus en détail

Module de Bioinformatique appliquée. GB Karine Robbe-Sermesant Romain Gautier

Module de Bioinformatique appliquée. GB Karine Robbe-Sermesant Romain Gautier Module de Bioinformatique appliquée à l analyse des séquences GB3 2012-2013 Karine Robbe-Sermesant Romain Gautier Objectifs du module Bioinformatique appliquée à l analyse des séquences Comprendre et apprendre

Plus en détail

Consultations Martinique / Guyane. Activité LABORATOIRE. Dr Odile Béra, CHU de Fort-de-France. Unité Oncogénétique

Consultations Martinique / Guyane. Activité LABORATOIRE. Dr Odile Béra, CHU de Fort-de-France. Unité Oncogénétique Dr Odile Béra, CHU de Fort-de-France Unité Oncogénétique Unité Génétique moléculaire des cancers Consultations Martinique / Guyane Prédisposition génétique cancers SEIN/OVAIRES COLON (Sd de Lynch & PAF)

Plus en détail

Cours Biologie cellulaire

Cours Biologie cellulaire Cours Biologie cellulaire GLBE102_ L1-S1 Le Noyau et la Transcription Généralités Un organite interphasique (disparaît en fin de prophase) Contient l ADN de la cellule = génome (sauf ADN mito. et chloroplastique)

Plus en détail

Structures Familles, domaines et sites protéiques Ontologie Cluster de transcrits. O. Lecompte Bioinformatique

Structures Familles, domaines et sites protéiques Ontologie Cluster de transcrits. O. Lecompte Bioinformatique Banques Séquences nucléiques protéiques mixtes Structures Familles, domaines et sites protéiques Ontologie Cluster de transcrits PROSITE banque de motifs et de profils caractéristiques de domaines ou de

Plus en détail

Biologie Moléculaire et Organismes Modèles

Biologie Moléculaire et Organismes Modèles Biologie Moléculaire et Organismes Modèles Sami Khuri Department of Computer Science San José State University khuri@cs.sjsu.edu Plan du Cours Biologie Moléculaire et Organismes Modèles Qu est-ce que la

Plus en détail

La souris verte : transgenèse

La souris verte : transgenèse La souris verte : transgenèse méduse equorea victoria cellule de méduse prélèvement du gène FP equorea victoria (http://mabryonline.org) micro-injection du (transgène) dans la cellule-œuf de souris Lucie,

Plus en détail

Qu est ce qu apporte la connaissance des génomes?

Qu est ce qu apporte la connaissance des génomes? Qu est ce qu apporte la connaissance des génomes? 1. L informa:on géné:que 2. Le génome humain 3. Variabilité individuelle et médecine 4. La place de l homme dans les espèces 1 1. L information génétique

Plus en détail

LES BASES MOLÉCULAIRES DE L HÉRÉDITÉ Archibald Garrod Reginald Punnett and William Bateson 1907

LES BASES MOLÉCULAIRES DE L HÉRÉDITÉ Archibald Garrod Reginald Punnett and William Bateson 1907 ADN : matériel génétique LES BASES MOLÉCULAIRES DE L HÉRÉDITÉ 1909 Archibald Garrod Reginald Punnett and William Bateson 1907 Du gène à la protéine Les protéines représentent le lien entre le génotype

Plus en détail

L Apport de la Bioinformatique et de la Biostatistique dans la compréhension des maladies complexes: Modèles; outils et méthodes

L Apport de la Bioinformatique et de la Biostatistique dans la compréhension des maladies complexes: Modèles; outils et méthodes L Apport de la Bioinformatique et de la Biostatistique dans la compréhension des maladies complexes: Modèles; outils et méthodes Dr. Najla kharrat Groupe de recherche: Microorganisme et Biomolecules Centre

Plus en détail

Chapitre 3 : La cellule bactérienne, génétique et synthèse protéique

Chapitre 3 : La cellule bactérienne, génétique et synthèse protéique Chapitre 3 : La cellule bactérienne, génétique et synthèse protéique Attention, ce cours suppose la connaissance de notions de base en génétique, notamment les notions de transcription, traduction ainsi

Plus en détail

De la biologie molécualire à la génomique

De la biologie molécualire à la génomique De la biologie molécualire à la génomique Pierre Neuvial École Nationale de la Statistique et de l Administration Économique Méthodes statistiques pour la biologie Plan du cours 1 Introduction à la biologie

Plus en détail

CHAPITRE 3 : L'EXPRESSION DU PATRIMOINE GÉNÉTIQUE

CHAPITRE 3 : L'EXPRESSION DU PATRIMOINE GÉNÉTIQUE CHAPITRE 3 : L'EXPRESSION DU PATRIMOINE GÉNÉTIQUE LES PROTÉINES SONT LE RÉSULTAT DE L'EXPRESSION DES GÈNES On observe de nombreuses différences entre ces deux gènes; 1061 nucléotides pour l'allèle du groupe

Plus en détail

BIO6: Bioinformatique appliquée Correction du TD3

BIO6: Bioinformatique appliquée Correction du TD3 BIO6: Bioinformatique appliquée Correction du TD3 Exercice 1 : programmation dynamique voir le site web indiqué dans le TD pour corriger l'exercice Exercice 2 : similarité de séquence et distance évolutive

Plus en détail

Projet MINT Les valises ADN et caeno

Projet MINT Les valises ADN et caeno Projet MINT Les valises ADN et caeno Dr. Marie-Pierre Chevron Faculté des lettres CERF Dr. Chantal Wicky Faculté des sciences Département de biologie Chinese scientists genetically modify human embryos

Plus en détail

STRUCTURE ET FONCTION DES GÈNES ET DES CHROMOSOMES

STRUCTURE ET FONCTION DES GÈNES ET DES CHROMOSOMES Faculté de Médecine de Sousse Tunisie Année Universitaire 209-2010 Deuxième Année Médecine Support pédagogique illustré relatif au cours: STRUCTURE ET FONCTION DES GÈNES ET DES CHROMOSOMES Pr. Ag. ELGHEZAL

Plus en détail

La division cellulaire Chapitre 5 Anatomie

La division cellulaire Chapitre 5 Anatomie La division cellulaire Chapitre 5 Anatomie La division cellulaire est le mode de multiplication de toute cellule. Elle lui permet de se diviser en plusieurs cellules-filles (deux le plus souvent). C'est

Plus en détail

éléments répétés gènes des ARN stables (ARNr, ARNt) gènes protéiques Nb de gènes, taille du génome et complexité pseudogènes régions régulatrices

éléments répétés gènes des ARN stables (ARNr, ARNt) gènes protéiques Nb de gènes, taille du génome et complexité pseudogènes régions régulatrices Plan 3. Annotation des génomes a) Annotation structurale : localisation des éléments génétiques éléments répétés gènes des ARN stables (ARNr, ARNt) gènes protéiques Nb de gènes, taille du génome et complexité

Plus en détail

VI- Les variations de l ADN

VI- Les variations de l ADN VI- Les variations de l ADN ! Concernent aussi bien les cellules somatiques que germinales! Permettent l évolution du contenu des chromosomes VI- Les variations de l ADN A- Les mutations : modifications

Plus en détail

INTRODUCTION A LA BIOINFORMATIQUE. Silvina GONZALEZ- RIZZO sgonzale@univ- ag.fr

INTRODUCTION A LA BIOINFORMATIQUE. Silvina GONZALEZ- RIZZO sgonzale@univ- ag.fr INTRODUCTION A LA BIOINFORMATIQUE Silvina GONZALEZ- RIZZO sgonzale@univ- ag.fr BioinformaEque pour des biologistes Objec&f du cours: Vous montrer les taches courantes de la bioinforma&que qu'un biologiste/biochimiste

Plus en détail

VECTEURS ET BANQUES VECTEURS ET BANQUES. Définitions. DEFINITIONS VECTEURS et CLONAGE BANQUES. Utilité Principe Différents vecteurs / différents usage

VECTEURS ET BANQUES VECTEURS ET BANQUES. Définitions. DEFINITIONS VECTEURS et CLONAGE BANQUES. Utilité Principe Différents vecteurs / différents usage VECTEURS ET BANQUES VECTEURS ET BANQUES Yann audic _2006 1 DEFINITIONS VECTEURS et CLONAGE Utilité Principe Différents vecteurs / différents usage BANQUES Principe Banques génomiques Banques d'adnc Normalisation

Plus en détail

Chap.2 : Les chromosomes et l information génétique

Chap.2 : Les chromosomes et l information génétique Chap.2 : Les chromosomes et l information génétique Les acquis : Chaque individu présente les caractères de l'espèce avec des variations qui lui sont propres. C'est le résultat de l'expression de son programme

Plus en détail

Biologie cellulaire. Cours 8 : Synthèse des protéines

Biologie cellulaire. Cours 8 : Synthèse des protéines Département des Troncs Communs Sciences de la Nature Faculté des Sciences de la Nature et de la Vie Université Abderrahmane Mira de Bejaia Biologie cellulaire Cours 8 : Synthèse des protéines Année universitaire

Plus en détail

MÉCANISMES MOLÉCULAIRES DE L EXPRESSION DES GÉNES : LA TRADUCTION OU BIOSYNTHÈSE DES PROTÉINES

MÉCANISMES MOLÉCULAIRES DE L EXPRESSION DES GÉNES : LA TRADUCTION OU BIOSYNTHÈSE DES PROTÉINES MÉCANISMES MOLÉCULAIRES DE L EXPRESSION DES GÉNES : LA TRADUCTION OU BIOSYNTHÈSE DES PROTÉINES Le sens de lecture L ARN polymérase lit le brin matrice dans la direction 3 vers 5 de façon à synthétiser

Plus en détail

Organisation physique et génétique des génomes

Organisation physique et génétique des génomes Organisation physique et génétique des génomes Table des matières Organisation physique de l ADN Nucléosomes Chromatine Principes d organisation des génomes Exemple d un génome bactérien Exemple du génome

Plus en détail

Bio-informatique et bio-analyse :

Bio-informatique et bio-analyse : Fiche 1 Bio-informatique et bio-analyse : Jean-Loup Risler La «bio-informatique». J entends ce mot depuis bien longtemps, mais je ne sais toujours pas ce qu il veut dire Je me souviens d une rencontre

Plus en détail

De l'alignement des séquences à la phylogénie

De l'alignement des séquences à la phylogénie Bio-informatique De l'alignement des séquences à la phylogénie Jean-Baptiste Lamy Maître de conférence bureau 149, LIM&BIO jibalamy@free.fr Introduction Au premier semestre : 3 x 2h de cours 1 x 2h de

Plus en détail

De la 1 e S à la T le S : l essentiel à retenir

De la 1 e S à la T le S : l essentiel à retenir De la 1 e S à la T le S : l essentiel à retenir Fiche 2/3 : Génétique Cycle de vie et divisions cellulaires Cycle de vie de l humain Chaque humain est issu de la fusion de 2.. : c est la.. Nos chromosomes

Plus en détail

Expression, stabilité et variation du patrimoine génétique Expression du patrimoine génétique

Expression, stabilité et variation du patrimoine génétique Expression du patrimoine génétique Thème I A Chapitre 3 Expression, stabilité et variation du patrimoine génétique Expression du patrimoine génétique Introduction : - gène = portion d ADN = information détermination des caractères [phénotype]

Plus en détail

Notions de bioinformatique

Notions de bioinformatique Notions de bioinformatique Souvent les avancées des biotechnologies ont été possibles du fait d avancées technologiques relevant d autres domaines que la biologie. - En juillet 1995 le séquençage d Haemophilus

Plus en détail

AVL Liban 2011 Biologie Moléculaire et Organismes Modèles

AVL Liban 2011 Biologie Moléculaire et Organismes Modèles AVL Liban 2011 Biologie Moléculaire et Organismes Modèles Sami Khuri Department of omputer Science San José State University San José, alifornia, USA sami.khuri@sjsu.edu www.cs.sjsu.edu/faculty/khuri Plan

Plus en détail

Chapitre 3 : L expression du patrimoine génétique

Chapitre 3 : L expression du patrimoine génétique Chapitre 3 : L expression du patrimoine génétique Les allèles des gènes présents dans les populations humaines sont apparus suite à des mutations d allèles préexistant. Ces mutations, transmises, sont

Plus en détail

ORGANISATION DU GÉNOME 4ème séance 2016

ORGANISATION DU GÉNOME 4ème séance 2016 ORGANISATION DU GÉNOME 4ème séance 2016 Un Génome est l ensemble de l information héréditaire d un organisme, présente en totalité dans chaque cellule. Caractéristiques des génomes procaryotes: Chromosome

Plus en détail

Corrigé série N 2. Exercice 1 QCS (V/F)

Corrigé série N 2. Exercice 1 QCS (V/F) Exercice 1 Corrigé série N 2 QCS (V/F) V1-Les acides nucléiques sont des polymères de nucléotides F2-Un nucléotide est un enchaînement base glucide F3-Les bases azotées sont toutes complémentaires F4-Les

Plus en détail

Séance 5. Les Acides Nucléiques. 3. Conservation de l information génétique: Réplication semi-conservative de l ADN

Séance 5. Les Acides Nucléiques. 3. Conservation de l information génétique: Réplication semi-conservative de l ADN UNIVERSITE MOHAMMED V-AGDAL FACULTE DES SCIENCES Les Acides Nucléiques DEPARTEMENT DE BIOLOGIE Filière Sciences de la Vie (SVI) Module de Biochimie (M 11) Élément : Biochimie structurale - Semestre 3-2005-2006

Plus en détail

Cours Biologie cellulaire ULBI 101 _ L1-S1

Cours Biologie cellulaire ULBI 101 _ L1-S1 Cours Biologie cellulaire ULBI 101 _ L1-S1 RMI_Partie 2-2 Le Noyau et la Transcription 5- Définition des organites et des fonctions associées 5.1 Noyau : ADN et information génétique - Généralités - Structure

Plus en détail

LA TERRE DANS L UNIVERS, la vie et l évolution du vivant

LA TERRE DANS L UNIVERS, la vie et l évolution du vivant Thème 1 A Chapitre LA TERRE DANS L UNIVERS, la vie et l évolution du vivant (5 semaines) EXPRESSION, STABILITE ET VARIATION DU PATRIMOINE GENETIQUE Introduction : Les cellules de l'organisme, à l'exception

Plus en détail

Bibliographie. Introduction à la bioinformatique. Objectifs. Préambule: Les cellules. Alberts et al, The molecular biology of the cell

Bibliographie. Introduction à la bioinformatique. Objectifs. Préambule: Les cellules. Alberts et al, The molecular biology of the cell Introduction à la bioinformatique 2. Fondations moléculaire en 66 slides et 2 video Bibliographie Alberts et al, The molecular biology of the cell Zvelebil et Baum, Understanding bioinformatics 1 2 Objectifs

Plus en détail

L'ADN peut être copié au travers des générations cellulaires successives de manière fidèle, c'est la réplication de l'adn.

L'ADN peut être copié au travers des générations cellulaires successives de manière fidèle, c'est la réplication de l'adn. 24/09/2014 REBOUL Nicolas L2 CR : Hamza BERGUIGUA Génétique Médicale Dr Martin KRAHN 8 pages Introduction à la Génétique Médicale : Les champs de la Génétique Médicale, La place de la Génétique Médicale

Plus en détail

ALIGNEMENT PLUS RAPIDE

ALIGNEMENT PLUS RAPIDE ALIGNEMENT PLUS RAPIDE 1. méthodes heuristiques : hachage, arbres de suffixe, PD limitée (taille totale de trous bornée) 2. PD éparse (pour sous-séquence commune ou chaînage en alignement global heuristique)

Plus en détail

INTRODUCTION À LA BIO-INFORMATIQUE

INTRODUCTION À LA BIO-INFORMATIQUE Biologie moléculaire-2016 1 INTRODUCTION À LA BIO-INFORMATIQUE Dans cette section, on désire vous donner une introduction sur l utilisation du site web du National Center for Biotechnology Information

Plus en détail

Vivant ou non vivant?

Vivant ou non vivant? Vivant ou non vivant? Vivant ou non vivant? BACTERIE Cellule animale Cellule végétale Les êtres vivants sont constitués de cellules. Problématique: Quels sont les constituants de la matière du vivant?

Plus en détail

Cours 3 : Bases de la génétique, transcription, synthèse des protéines, structures des protéines, enzymes

Cours 3 : Bases de la génétique, transcription, synthèse des protéines, structures des protéines, enzymes Cours 3 : Bases de la génétique, transcription, synthèse des protéines, structures des protéines, enzymes Partie 1 : Bases de la génétique, transcription, synthèse des protéines I) Les gènes contrôlent

Plus en détail

Master 1 IUP Génomique et Protéomique Examen de GP4 - Bioinformatique

Master 1 IUP Génomique et Protéomique Examen de GP4 - Bioinformatique Master 1 IUP Génomique et Protéomique Examen de GP4 - Bioinformatique Exercice 1 : banques de données. Durée de l épreuve : 2h Documents autorisés Q1) Le schéma ci-dessous représente le nombre d articles

Plus en détail

Prépara2on à l Agréga2on interne de SV STU Universités Paris Diderot et Paris Est Créteil. Eléments de génie génétique

Prépara2on à l Agréga2on interne de SV STU Universités Paris Diderot et Paris Est Créteil. Eléments de génie génétique Prépara2on à l Agréga2on interne de SV STU Universités Paris Diderot et Paris Est Créteil Eléments de génie génétique 2 octobre 2010 Hervé TOSTIVINT Muséum Na2onal d Histoire Naturelle htos2vi@mnhn.fr

Plus en détail

EXPRESSION, STABILITÉ ET VARIATION DU PATRIMOINE GÉNÉTIQUE

EXPRESSION, STABILITÉ ET VARIATION DU PATRIMOINE GÉNÉTIQUE Première S - Cours 1 suite EXPRESSION, STABILITÉ ET VARIATION DU PATRIMOINE GÉNÉTIQUE III. Relations complexes entre génotype et phénotype : 1 ) Les différentes échelles d un phénotype : Rappel : Le génotype

Plus en détail

Examen de bioinformatique Février 2009

Examen de bioinformatique Février 2009 Examen de bioinformatique Février 2009 Durée : 2h (ou 2h30) - Documents interdits Première partie (4 points) 1) La séquence ci-dessous est-elle au format fasta (justifiez votre réponse)? 1 pt Is the sequence

Plus en détail

CHAPITRE III : LE NOYAU INTERPHASIQUE ET LE CYCLE CELLULAIRE

CHAPITRE III : LE NOYAU INTERPHASIQUE ET LE CYCLE CELLULAIRE CHAPITRE III : LE NOYAU INTERPHASIQUE ET LE CYCLE CELLULAIRE III.1 LE NOYAU INTERPHASIQUE III.1. 1 STRUCTURE L organite le plus proéminent de la cellule est le noyau. Il est le centre vital de la cellule.

Plus en détail

CHAPITRE 2 : LES MUTATIONS : ORIGINE DE LA VARIABILITÉ GÉNÉTIQUE

CHAPITRE 2 : LES MUTATIONS : ORIGINE DE LA VARIABILITÉ GÉNÉTIQUE CHAPITRE 2 : LES MUTATIONS : ORIGINE DE LA VARIABILITÉ GÉNÉTIQUE LES DIFFÉRENTS TYPES DE MUTATION Lors de la réplication de l ADN en phase S, les ADN polymérases ajoutent 6,4 milliards de nucléotides (ensemble

Plus en détail

Licence L3 mention Biologie (parcours BCGMP & BBM) UE-Contrôle de l'expression génétique chez les eucaryotes

Licence L3 mention Biologie (parcours BCGMP & BBM) UE-Contrôle de l'expression génétique chez les eucaryotes Licence L3 mention Biologie (parcours BCGMP & BBM) UE-Contrôle de l'expression génétique chez les eucaryotes Année universitaire 2006/2007 1 ère session 9 mai 2007 = = = = = = = = = = = = = = = = = = =

Plus en détail

Tp6 Du gène à la protéine (partie 2) 1 TP 6 Du gène à la protéine (partie 2). I - Niveau : première S La synthèse des protéines

Tp6 Du gène à la protéine (partie 2) 1 TP 6 Du gène à la protéine (partie 2). I - Niveau : première S La synthèse des protéines Tp6 Du gène à la protéine (partie 2) I - Niveau : première S La synthèse des protéines II- Extrait de programme : La traduction permet la synthèse cytoplasmique de chaînes polypeptidiques. La séquence

Plus en détail

L EPISSAGE. I- Introduction

L EPISSAGE. I- Introduction L EPISSAGE I- Introduction Lors de la transcription des gènes codant les protéines par l ARN polymérase II, il y a synthèse d un ARN prémessager qui contient l ensemble nucléotidique du gène comprise entre

Plus en détail

La cartographiedu génome humain : Localisationdes gènes, médecineprédictive et thérapiegénique

La cartographiedu génome humain : Localisationdes gènes, médecineprédictive et thérapiegénique La cartographiedu génome humain : Localisationdes gènes, médecineprédictive et thérapiegénique Gil BELLIS Institut National d'études Démographiques, Paris, France La possibilité que l'on a aujourd'hui

Plus en détail

Bioinformatique dans l IUP

Bioinformatique dans l IUP Bioinformatique dans l IUP Intervenants Equipe Bioinfo (Laboratoire d Informatique Fondamentale de Lille) Cours : Jean-Stéphane Varré (jean-stephane.varre@lifl.fr) TD sur machine : Jean-Stéphane Varré,

Plus en détail

Le monde des bio-puces

Le monde des bio-puces Le monde des bio-puces D1 Le «dogme central» de la biologie moléculaire Transcription Epissage Traduction ADN ARNpm ARNm Protéines Génome Transcriptome Protéome D2 Puces à ADN Techniques de génomique fonctionnelle

Plus en détail

Structure du gène Eucaryote, du gène Procaryote la Transcription, le Code génétique et la Traduction

Structure du gène Eucaryote, du gène Procaryote la Transcription, le Code génétique et la Traduction UNIVERSITE D ALGER Faculté de Médecine et de Médecine Dentaire ZIANIA (Château Neuf) Structure du gène Eucaryote, du gène Procaryote la Transcription, le Code génétique et la Traduction COURS DE GENETIQUE

Plus en détail

l ADN, une molécule codée et variable

l ADN, une molécule codée et variable TP5 l ADN, une molécule codée et variable Rappel :Chez toutes les espèces, chaque chaîne de la molécule d ADN est constituée d un enchaînement de nucléotides. (A,T,G et C) Tous les êtres vivants possèdent

Plus en détail

Qu'est-ce que l'adn?

Qu'est-ce que l'adn? Structure Physico-chimique de l'adn Qu'est-ce que l'adn? L'ADN (acide désoxyribonucléique) est une macromolécule biologique formée par deux chaînes complémentaires qui s'emboîtent tout en s'enroulant l'une

Plus en détail

Génie génétique et biotechnologie

Génie génétique et biotechnologie Génie génétique et biotechnologie Acides nucléiques (rappel) Transcription ADN ARNm Traduction protéines Nucléotides Acides aminés Acides nucléiques Nucléotides : Gr. Phosphate Campbell 2 e edition, fig.

Plus en détail

QCM. Niveau Première S. Thème 1A : Reproduction conforme de l ADN

QCM. Niveau Première S. Thème 1A : Reproduction conforme de l ADN QCM Niveau Première S Thème 1A : Reproduction conforme de l ADN Pour chaque question, il vous est donné quatre propositions A, B, C et D. Une, deux ou trois propositions peuvent être exactes. Répondez

Plus en détail

Cours Biologie cellulaire ULBI 101 _ L1-S1

Cours Biologie cellulaire ULBI 101 _ L1-S1 Cours Biologie cellulaire ULBI 101 _ L1-S1 RMI_Partie 2-1 Le Noyau et la Transcription 5- Définition des organites et des fonctions associées 5.1 Noyau : ADN et information génétique - Généralités - Structure

Plus en détail

Devoir à la maison n 8 Classe de Terminale S

Devoir à la maison n 8 Classe de Terminale S Devoir à la maison n 8 Classe de Terminale S Stabilité et variabilité des génomes et évolution Partie I : Les individus atteints de trisomie 21 présentent dans leur caryotype trois chromosomes 21 au lieu

Plus en détail

REGULATION DE L EXPRESSION DES GENES

REGULATION DE L EXPRESSION DES GENES REGULATION DE L EXPRESSION DES GENES 1. Circuits fondamentaux de contrôle Ce sont des circuits de contrôle permettant d ajuster les synthèses protéiques en fonction des besoins. Pour cela, les cellules

Plus en détail

Comment créer un OGM? :

Comment créer un OGM? : Comment créer un OGM? : Dans cette partie, nous allons voir différents procédés qui permettent aujourd hui aux scientifiques d obtenir des organismes génétiquement modifiés. Cependant, la compréhension

Plus en détail

GMIN206 TD Banques de données biologiques Interrogation des banques via GQuerry et Formats de fichiers de séquences

GMIN206 TD Banques de données biologiques Interrogation des banques via GQuerry et Formats de fichiers de séquences GMIN206 TD Banques de données biologiques Interrogation des banques via GQuerry et Formats de fichiers de séquences 1. Interrogation des banques via GQuerry 1.1 Rappel De manière concrère, l interrogation

Plus en détail

La cellule : notions de base de la biologie

La cellule : notions de base de la biologie La cellule : notions de base de la biologie Sommaire : 1. Qu est-ce qu une cellule? 2. Du gène à l organisme 3. Animal ou végétal, réponse au niveau cellulaire? 4. Vie et mort de la cellule 5. Communication

Plus en détail

Questions de EVAL-02 - Test AP Jour 2 A

Questions de EVAL-02 - Test AP Jour 2 A Q.C.M. n 1 QCM-001000001 Une cellule : 1. Est la plus petite structure biologique constituée de protéines, de lipides et d acides nucléiques. 2. Est l unité fondamentale de la vie. 3. Est toujours constituée

Plus en détail

Chapitre 5 : La sexualité des bactéries, transferts horizontaux de gènes

Chapitre 5 : La sexualité des bactéries, transferts horizontaux de gènes Microbiologie Chapitre 5 : La sexualité des bactéries, transferts horizontaux de gènes Partie 2 : La transduction I. Les vecteurs de la transduction : les bactériophages La transduction est un phénomène

Plus en détail

CONDITIONS GENERALES D UTILISATION DU SITE

CONDITIONS GENERALES D UTILISATION DU SITE CONDITIONS GENERALES D UTILISATION DU SITE Préambule : Mentions légales Le Site www.24-7services.eu a été déclaré à la Commission Nationale de l Informatique et des Libertés (ci-après «la CNIL») par la

Plus en détail

Le support de l information génétique est constitué par une ou plusieurs molécules d ADN

Le support de l information génétique est constitué par une ou plusieurs molécules d ADN Le support de l information génétique est constitué par une ou plusieurs molécules d ADN Dr. R. Raynal, 2003 Les êtres vivants possèdent au sein de leurs cellules un "programme génétique" (donnant les

Plus en détail

Principe des études moléculaires en génétique médicale Méthodes d analyse des microlésions du génome

Principe des études moléculaires en génétique médicale Méthodes d analyse des microlésions du génome Mercredi 23 Octobre LECLERCQ Barbara L2 GM Pr Krahn 10 pages Principe des études moléculaires en génétique médicale Méthodes d analyse des microlésions du génome Plan A. Introduction B. Techniques courantes

Plus en détail

Introduction à la bioinformatique

Introduction à la bioinformatique Introduction à la bioinformatique Céline Brochier-Armanet Université Claude Bernard, Lyon 1 Laboratoire de Biométrie et Biologie Evolutive (UMR 5558) celine.brochier-armanet@univ-lyon1.fr Lectures recommandées

Plus en détail

Biologie Moléculaire et Organismes Modèles

Biologie Moléculaire et Organismes Modèles Biologie Moléculaire et Organismes Modèles Sami Khuri Department of Computer Science San José State University khuri@cs.sjsu.edu Usine de Protéines Les protéines sont responsables de la plupart des fonctions

Plus en détail

Thème 1 : La Terre dans l Univers, la Vie et l évolution du vivant. Partie 1 : Expression, stabilité et variation du patrimoine génétique

Thème 1 : La Terre dans l Univers, la Vie et l évolution du vivant. Partie 1 : Expression, stabilité et variation du patrimoine génétique TP 6 : Du gène à la protéine (2) Thème 1 : La Terre dans l Univers, la Vie et l évolution du vivant Partie 1 : Expression, stabilité et variation du patrimoine génétique Chapitre 3 : L expression du patrimoine

Plus en détail

Stage de Pré-Rentrée de Biochimie. Chapitre 3 : Biologie Moléculaire. Correction des exercices

Stage de Pré-Rentrée de Biochimie. Chapitre 3 : Biologie Moléculaire. Correction des exercices Stage de Pré-Rentrée de Biochimie Chapitre 3 : Biologie Moléculaire Correction des exercices 3 septembre 2013 1 Question 1 Parmi les séquences suivantes, laquelle s hybride parfaitement avec ce fragment?

Plus en détail

Branches complémentaires en biochimie

Branches complémentaires en biochimie UNIVERSITÉ DE FRIBOURG FACULTÉ DES SCIENCES Extrait du plan d'études pour les branches propédeutiques et les branches complémentaires offertes par la Faculté des sciences dans le cadre des certificats

Plus en détail

TP 4: de l ADN à l ARNm les étapes de la transcription

TP 4: de l ADN à l ARNm les étapes de la transcription TP 4: de l ADN à l ARNm les étapes de la transcription Lycée E. Delacroix 1 ère S Programme 2011 Activité 1: la localisation de la synthèse des protéines Objectif de l autoradiographie Marquer l emplacement

Plus en détail

Préparation spécifique aux études de Médecine - Testez votre niveau 10 juillet 平成 24

Préparation spécifique aux études de Médecine - Testez votre niveau 10 juillet 平成 24 Préparation spécifique aux études de Médecine - Testez votre niveau en Médecine Biologie 10 juillet 平成 24 Consignes : Cette évaluation comporte uniquement des questions de type QCM (Questions à Choix Multiples).

Plus en détail

TD5 : Prédiction de la structure tridimensionnelle d une protéine Modélisation moléculaire

TD5 : Prédiction de la structure tridimensionnelle d une protéine Modélisation moléculaire TD5 : Prédiction de la structure tridimensionnelle d une protéine Modélisation moléculaire Avant de commencer le TD, installer (ou vérifier qu ils le sont) sur la partition K: du poste de travail, les

Plus en détail

Rendre le travail sous forme d un document word ou autre traitement de texte avec saisies écrans justificatives.

Rendre le travail sous forme d un document word ou autre traitement de texte avec saisies écrans justificatives. Corrigé des activités «Alignement de séquences» ACTIVITE 1 : BLAST et la Bête du Gévaudan... : Rendre le travail sous forme d un document word ou autre traitement de texte avec saisies écrans justificatives.

Plus en détail