Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P Antady, Fianarantsoa (301) Tél

Dimension: px
Commencer à balayer dès la page:

Download "Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere."

Transcription

1 Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P Antady, Fianarantsoa (301) Tél TAOM- PIANARANA 2015/ FANGATAHANA HISORATRA ANARANA / DEMANDE D INSCRIPTION Filière tiana atao/ Filière demandée : Commis de cuisine Serveur- barman Femme de chambre- lingère Anarana/Nom : (Manaraka ny/dans l ordre de l «Etat Civil») Fanampin Anarana/Prénoms : Teraka tamin ny/né(e) le : Tao/à : Adiresin ny ray aman- dreny na mpiantoka /Adresse exacte des parents- ou du tuteur: Laharantaroby/N téléphone : Sekoly nianarana/etablissements scolaires fréquentés : Taona/Années Sekoly/Etablissements 2 PHOTOS (4 x 4) LAHY - VAVY GARCON - FILLE N Matricule SFX N à l Examen FEPETRA SAMIHAFA / PROCESSUS DE RECRUTEMENT 1. Ny famerenana ireto dossiers ireto : manomboka ny 05 may 2015 ao amin ny secrétariat La Rizière Remise du dossier complet avec les pièces suivantes à partir du 5 mai 2015 au secrétariat de La Rizière «Acte de naissance» na/ ou «Bulletin de Naissance» latsaky ny 6 volana / moins de 6 mois Valopy tsotra iray (1) misy hajia sy ny Adiresin ny Ray aman- dreny na mpiantoka Une (1) enveloppe timbrée mentionnant l adresse des parents ou du tuteur légal Sara- pisoratana Ariary, aloa ao amin ny secretariat La Rizière Reçu du règlement du Droit de candidature de MGA 7.500, à payer au secrétariat de La Rizière «Questionnaire de Motivation» manazava ny antony manokana nisafidianana ny Ecole Hôtelière Questionnaire de Motivation évoquant le choix personnel d intégrer l Ecole Hôtelière du CSFX «certificat de scolarité» na «certificat de travail» / Certificat de scolarité ou de travail «relevé de note» farany tany an- tsekoly na ny «fiche de renseignements scolaires»nohamarin'ny sekoly Dernier relevé de note OU fiche de renseignements scolaires remplie et certifiée «Fiche»mombamomba ny fianakaviana sy ilay mpianatra / Fiche de renseignements personnels et familiaux 2. Fandinihana dossiers no hatao, hisy entretien miaraka amin ny kandida sy ny ray aman- dreny na ny mpiantoka Après étude du dossier, entretien avec le candidat et ses parents ou son tuteur légal 3. Aorian'ny entretien dia hisy test de positionnement en français atao Après entretien, test de positionnement en français 4. Ny fidirana dia ny 1er Septembre 2015 / Rentrée scolaire le 1 er septembre 2015

2 AKANA HEVITRA, FEHEZINA NY CLE 1, 2 sy 4 Dix clés de l éducation Saint François- Xavier 1. Liberté dans la foi afin de vivre la spiritualité ignacienne du Collège : participation active à la Messe et aux prières, aux récollections assiduité pour l instruction religieuse. 2. Courage et volonté d atteindre l excellence dans les études, effort quotidien afin d accomplir les travaux écrits et de revoir les leçons. 3. Rigueur dans la gestion des temps : toujours ponctuel, jamais en retard ; toujours présent, jamais absent 4. Silence actif dans les rangs, en classe, à la chapelle, à la bibliothèque Témoin et artisan de la paix au sein et à l extérieur du Collège en rejetant toutes formes de violences verbale, gestuelle et d action. 6. Respect et promotion de l environnement en appréciant ordre et propreté. Respect, et promotion et création des biens communs. Soin des matériels et moyens de travail. 7. Obéissance respectueuse dans les relations et dans les dialogues avec les éducateurs et éducatrices, les enseignants et enseignantes, le personnel du collège. 8. Promotion de l esprit de collaboration et de solidarité au sein de la classe afin d obtenir de meilleurs résultats. Encouragement et aide des condisciples afin d atteindre l excellence dans les travaux scolaires et dans la vie en général. 9. Dynamisme dans les activités sportives et d éducation physique. Développement du talent et de l esprit de créativité. 10. Fierté et plaisir de faire connaître le Collège et son fanion à l extérieur, de porter la tenue La Rizière, de participer aux activités parascolaires au sein du CSFX. 1. Fahavononana am- pinoana sy fahafahana hiaina ny fiainam- panahin ny Kôlejy amin ny Lamesa, Vavaka, Fandalinam- pinoana, Fihatahana masina na (Récollection). 2. Herim- po hikendry ny tsara indrindra amin ny fiainana. Holofo andavanandro, mianatra lesona sy mamita ny enti- mody. 3. Hifehy ny fotoana tsy ho tara fidirana. Tsy hanarinary fotoana foana. 4. Hifehy ny fahanginana mavitrika raha vantany vao maneno ny lakolosy fidirana, any amin ny Chapelle, trano fianarana, bibliothèque, eny an- daharana. 5. Hitandro ny fandriampahalemana anaty sy ivelan ny sekoly. Mahay mandefitra (tolérant na tolérante). Mankahala herisetra an- teny, am- pihetsika, amin ny atao. 6. Manaja ny tontolo iainana. Mandio ny manodidina. Manaja ny soa iombonana sy ny fitaovana samirery ampiasaina. 7. Manaiky am- pitiavana sy vonona hifanakaly hevitra amim- pahatsorana amin ny Mpanabe, ny Mpampianatra, ny Mpandraharaha sy Mpiasa. 8. Mampiroborobo ny firaisan- kinan ny kilasy amin ny fampiakarana ny salan isa iombonana. Manaja ny namana ary mankahery azy hikatsaka ny soa sy ny tsara mandrakariva. 9. Mavitrika amin ny fanatanjahantena sy amin ny fahaiza- mamorona sy fampiasana ny talenta, kolon- tsaina, kanto. 10. Finaritra sy Saingona na fier(ère) maneho ety ivelany ny CSFX amin ny fitondrana ny fanevany, blouse, insigne, tenue. Mavitrika amin ny lamin asa ivelan ny fianarana aty amin ny CSFX. 5. Fangatahana sy fanamarinana ataon ny ray aman- dreny / Demande et engagement des parents Izahay A toa / Nous soussignés M. sy R toa / et Mme Ray aman- dreny na mpiantoka an i / légal de dia mangataka ny handraisan ny KOLEJY Md FRANCOIS- XAVIER, ity zanakay ity, ary manome toky izahay fa mankato sy hanampy ny zanakay hanaraka ny fepe- panabeazan ny KOLEJY araka ny fiofanana ato amin ny Ecole Hôtelière La Rizière ; ary manaiky ny hanaovany «stage de formation» ao amin ny Hôtel et Restaurant d Application amin ny fotoana voafaritry ny sekoly; ary manome alalana azy hanao stage de formation (2x3 volana) any amin ny orinasa mandritry ny taona faharoa amin ny fiofanana (ankoatry ny femmes de chambre- lingères) demandons son inscription à l Ecole Hôtelière du CSFX, La Rizière, reconnaissons et nous engageons à lui en faire respecter les disciplines ; l autorisons à suivre un stage de formation à l Hôtel et Restaurant d Application suivant l emploi du temps établi par l Ecole ; l autorisons à suivre un stage de formation (2 x 3 mois) en entreprise extérieure au cours de la 2 ème année de formation (sauf femmes de chambre- lingères). Natao teto/fait à anio, faha- /ce 2015 (Sonian ny ray aman- dreny na ny mpiantoka/ signature des parents ou du tuteur légal) Le RECTEUR du Collège Saint François- Xavier Prospère RATOVOMANANARIVO, sj.- 0..

3 Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P Antady, Fianarantsoa (301) Tél Fampahafantarana samihafa/ Information scolarité Tsara ho fantatra Ny sekoly «La Rizière» dia sekoly mampiofana arak 'asa amin'ny sehatra «Hotellerie - Restauration». Misy telo karazana ny fiofanana atolotry ny «la riziere «6. Femme de chambre- lingère : Miofana 1 taona ary mahazo Certificat de Qualification Professionnelle (CQP) aorian'ny fiofanana 7. Commis de cuisine : miofana 2 taona, Mahazo Certificat d Aptitude Professionnelle (CAP) aorian'ny fiofanana. 8. Serveur- barman : Miofana 2taona, Mahazo Certificat d Aptitude Professionnelle (CAP) aorian'ny fiofanana. 2. Fandaminana samihafa Toy izao ny fandaminana ny ora sy fotoana fiofanana isan- kerinandro : - 24 Ora ny «enseignement géneral sy ny «module» manomboka ny Alatsinainy maraina hatramin'ny Zoma hariva, izay atao eto Antady sy eny amin'ny Kolejy SFX Ambatomena. - In- 2 miantoana isan- kerin'andro no fanaovan'ny mpianatra services na fampiharana ao amin'ny Hotel- restaurant d'application ' izay mitsinjara ho adin'ny 6 isaky ny service(ny hariva ho an'ny commis de cuisine sy ny serveur - barman ; ny maraina ho an'ny femmes de chambre - lingères) Ho an'ny ireo izay manaraka ny fiofanana serveur- barman sy commis de cuisine dia misy ny «stage» izay atao manomboka ny taona faharoa izay mizara tpy izao,7 herinandro mianatra eto antsekoly / 7 herinandro manao stage. Mitontaly 3 ny stage ataon'ny mpianatra mandritry ny taom- pianarana. Ny BOE no miantoka ny fitadiavana ny stage- ny mpianatra tsirairay avy, anjaran'ny RaR kosa no miantoka ny saran- dalana sy ny hofan- trano any amin'ny toerana anaovana stage raha tsy manome trano ny hotel mandray ny stagiaire. 3. Tetiandron'ny fiofanana Ny fidirana : 1er Septembre 2015 Ny fialan- tsasatra isan- taona : manomboka ny 7 Février ka hatramin'ny 20 Mars 2016 Mba entina hanarahana antsakany sy andavany ny drafim- piofanana dia miasa ny mpiofana rehetra mandritra ny andro fety (afa- tsy ny andro alahady irery ihany). 4. Fepetra ara- bola sy ara- pitaovana Ny mpianatra izay manao services (in- 2 isan- kerinandro) dia mijanona matory (ankoatran'ny fialan- tsasatra sy ny alahady) ; izy ireo ihany no mitondra ny kojakoja izay ilainy, toy ny akanjomandry, ny lambam- pandriana, sns. Ireto avy ny sandam- pianarana iantoan'ny Ray amand- Reny : - droits d inscription : Ar / taona - uniforme civil (avec achat d une polaire) : Ar / taona - assurance sy frais généraux : Ar / taona - carnet de correspondance : Ar / taona - écolages : Ar / isam- bolana - sakafo cantine : Ar / enimbolana - fournitures scolaires : Ar (raha be indrindra) 1. Présentation L Ecole Hôtelière La Rizière est un centre de formation professionnelle aux métiers de l hôtellerie et de la restauration, relié à un l hôtel- restaurant d application, «La Rizière». Trois formations qualifiantes sont proposées : - Femme de chambre- lingère : 1 an, Certificat de Qualification Professionnelle (CQP) - Commis de cuisine : 2 ans, Certificat d Aptitude Professionnelle (CAP) - Serveur- barman : 2 ans, Certificat d Aptitude Professionnelle (CAP) 2. Organisation de la formation La formation est organisée chaque semaine comme suit : 24h de cours d enseignement général et modulaire du lundi matin au vendredi soir, sur le site d Antady et au Collège SFX 2 séances de 6h de service à l hôtel- restaurant d application à Antady (le soir pour commis de cuisine et serveurs- barmen ; le matin pour femmes de chambre- lingères) Pour les formations de serveur- barman et de commis de cuisine, la deuxième année de formation alterne des périodes de 7 semaines de stage et 7 semaines de formation. Les élèves réalisent ainsi 3 stages de 7 semaines dans l année. Le placement en stage est assuré par le Bureau d Orientation et d Emploi de La Rizière. 3. Calendrier scolaire Rentrée scolaire : 1 er septembre 2015 Vacances annuelles : du 7 février au 20 mars 2016 inclus Afin de respecter les plannings de formation, tous les jours fériés sont travaillés (sauf lorsqu ils sont un dimanche). 4. Conditions matérielles et financières (MGA) Les élèves sont logés en internat 2 fois par semaine lorsqu ils sont en service (hors vacances et dimanche) ; ils apportent leur linge de nuit et de toilette (drap, serviette). Plusieurs frais sont à la charge des familles (en Ariary) : droits d inscription : / an uniforme civil (avec achat d une polaire): / an assurance et frais généraux : / an carnet de correspondance : / an écolages : / mois repas cantine : / semestre fournitures scolaires : (estimation maximum) Filan- kevitra / Contacts La Rizière Réception de l Ecole : Bureau d Orientation et d Emploi, service recrutement et suivi des élèves :

4 Inscription La Rizière Ecole Hôtelière La Rizière Fianarantsoa Fiche de renseignements personnels et familiaux Questionnaire de motivation Ry Ray- aman- dreny hajaina, Chers parents d élèves Ny «Ecole Hôtelière La Rizière» dia manome fiofanana ara- kasa momba ny fandraisam- bahiny (Hôtellerie- restauration) ho an ny tanora 17 taona ka hatramin ny 21 taona ka manana niveau 3ème. Sampan- draharaha 3 no hanomezana fiofanana: commis de cuisine (2 taona), serveur- barman (2 taona), femme de chambre- lingère (1 taona). Ny «Ecole Hôtelière La Rizière» dia manome fiofanana ho an ny tanora mba ahafahany miditra avy hatrany eo amin ny sehatry ny asa. Manomboka ny 1 septembra 2014 ny taom- piofanana. L Ecole Hôtelière La Rizière propose une formation professionnelle en hôtellerie- restauration pour des élèves e âgés de 17 ans à 21 ans ayant un niveau 3 minimum. La Rizière forme à 3 métiers : commis de cuisine (2 ans), serveur- barman (2 ans) et femme de chambre- lingère (1 an). Elle prépare les étudiants à intégrer facilement le monde du travail. Les formations commencent le 1 septembre Manaiky ny handraisan ny zanakareo anjara amin izany ve ianareo? Nahoana? Êtes- vous d accord pour que votre enfant participe à l une de ces formations? Laquelle? Pourquoi? Inona no ezaka azonareo hanohanana ny zanakareo mandritra ny fianarany eny amin ny ambaratonga? Quels efforts êtes- vous prêts à faire pour soutenir votre enfant durant ses études professionnelles? Ry tanora, Cher élève, Miroborobo ny sehatry ny fizahan- tany eto amin ny faritra Océan Indien ary maro ireo asa miforona ao amin ny sehatra fandraisam- bahiny (hôtellerie- restauration) eto Madagasikara. Ny «Ecole Hôtelière La Rizière» dia manolotra anao fiofanana ara- kasa manara- penitra izay manampy anao hiditra amin ny sehatry ny asa avy hatrany sy handray an- tanana ny ho avinao. Sampan- draharaha 3 no hanomezana fiofanana: commis de cuisine (2 taona), serveur- barman (2 taona), femme de chambre- lingère (1 taona). Ny «Ecole Hôtelière La Rizière» dia manome fiofanana ho an ny tanora mba ahafahany miditra avy hatrany eo amin ny sehatry ny asa. Manomboka ny 1 septembra 2014 ny taom- piofanana eto Fianarantsoa. Le tourisme dans l Océan Indien se développe et les métiers de l hôtellerie- restauration sont en plein essor à Madagascar. L Ecole Hôtelière La Rizière te propose des formations techniques solides à ces métiers pour t aider à préparer ta vie professionnelle. Il y a trois formations : commis de cuisine (2 ans), serveur- barman (2 ans), femme de chambre- lingère (1 an). Les formations commencent le 1 septembre 2014 à Fianarantsoa.

5 Inscription La Rizière Ecole Hôtelière La Rizière Fianarantsoa Fiche de renseignements personnels et familiaux Questionnaire de motivation Inona ny asa tinao atao aoriana? Inona ny antony hisafidiananao an izany? Quel métier aimerais- tu faire plus tard? Pourquoi? Vonona hiditra amin ny sehatry ny asa ve ianao? Inona no anton izany? Es- tu prêt à apprendre un métier? Pourquoi? Araky ny fihevitrao, fa nahoana no manampy anao amin ny safidinao ny Ecole Hôtelière La Rizière? Pourquoi penses- tu que l Ecole Hôtelière La Rizière peut t'aider à t'y préparer? Vonona hanaraka fiofanana ara- kasa eto Fianarantsoa ve ianao mandritry ny 1taona/2 taona? Inona no antony? Es tu prêt à suivre un rythme de travail professionnel pendant un an/deux ans à Fianarantsoa? Pourquoi? Inona ny soatoavina ananao ka ankasitrahan ny fiaraha- monina aminao? Es- tu reconnu pour tes valeurs morales? Quelles sont tes valeurs morales?

6 Inscription La Rizière Ecole Hôtelière La Rizière Fianarantsoa Fiche de renseignements personnels et familiaux Renseignements sur l élève Anarana/ Nom Fanampinanarana/ Prénoms Anarana Fiantsoana/ Prénom usuel Lahy- Vavy/ Sexe Daty nahaterahana/ Date de naissance Laharan- tarobia/ Téléphone Andraikitra farany nosahanina/ Dernière occupation Sekoly/ Dernière école Lakilasy/ Dernière classe Diplaoma/ Diplôme Adiresy/ Adresse Adiresy hafa ankoatran'ny Fianarantsoa/ Adresse à Fianarantsoa (si différente) Iza no miaraka mipetraka amin'ny tanora /Chez qui habite le jeune misy mpiantoka ve?association ve? Si parrainage, par qui? Renseignements sur la famille de l élève Isan- jaza/ Nb d enfants dans la fratrie Zanakao fahafiry ity tanora ity? Place du jeune dans la fratrie (1er, 2ème, 3ème, ) Isan'ny hefitra ao antrano Nb de pièces de la maison (1, 2, 3 ) Manan- jiro? / Electricité (oui/non) Mampiasa lava- piringa? / Latrines (oui/non) Manana tanimbary? Firy ny habeany? Propriétaire rizière- champ? si oui, superficie Vokatra azonao isan- taona? Poids de riz récolté par an (Kg) Firy ny isan'ny biby fiompy? Propriétaire d'animaux (type/nombre) Fidiram- bolanao?/ Autres sources de revenus

7 Inscription La Rizière Ecole Hôtelière La Rizière Fianarantsoa Fiche de renseignements personnels et familiaux Renseignements sur la (les) personne(s) responsable(s) de l élève Ray / Père Reny / Mère Mpiantoka/ Tuteur Anarana/ Nom Fanampinanarana/ Prénoms Asa atao/ Profession Taona/ Age Adiresy/ Adresse Laharan- tarobia Numéro de Téléphone Profession Sora- piankohonana Situation matrimoniale (marié, célibataire...) Ambaratongam- pianarana natao / Niveau d'étude et diplôme (CEPE, BEPC, BACC ) Isan'olona antohana / Nb de personnes à charge (1, 2, 3 ) Tompontrano sa manofa (eny/tsia)? / Propriétaire logement (oui/non) Commentaires

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

Noely 2009 Taom-baovao 2010

Noely 2009 Taom-baovao 2010 FMM Fiombonana Miara-mivavaka eto Münich. Noely 2009 Taom-baovao 2010 Fa Zaza no teraka ho antsika, Zazalahy no omena antsika, ary ny anarany atao hoe Mahagaga, Mpanolon-tsaina, Andriamanitra Mahery, Rain

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

Note pratique. Réseau PRATIQUES

Note pratique. Réseau PRATIQUES Note pratique Ny Herin ny hafatra / Le pouvoir des messages pour la santé préventive Expérience du programme de santé materno-infantile mené par Inter Aide à Farafangana, Madagascar Notice Type de document

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

Le malgache. L exemple d une langue sans test

Le malgache. L exemple d une langue sans test Le malgache L exemple d une langue sans test 1. Pourquoi n existe t il pas de cer:fica:on? Peu d échanges commerciaux avec l extérieur Pas d immigra:on importante de «cols blancs» Peu d étudiants étrangers

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

DOSSIER DE CANDIDATURE 20 / 20 PRéPA MéDECINE

DOSSIER DE CANDIDATURE 20 / 20 PRéPA MéDECINE DOSSIER DE CANDIDATURE 20 / 20 PRéPA MéDECINE PHOTO Votre état civil NOM :... Prénom :... Adresse :... Code postal :... Ville :... Tél : Mobile : Email :...@... Date de naissance : / / Lieu de naissance

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana -------------

REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana ------------- REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana ------------- MINISTERE DE L ECONOMIE, DES FINANCES ET DU BUDGET --------- ARRETE N 12590/06- MEFB/SG/DGT/DOF/ASS portant application du Décret

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

Etablissement d origine : VILLE : Public. Numéro INE (Identifiant National Elève, composé de 10 chiffres et 1 lettre) :

Etablissement d origine : VILLE : Public. Numéro INE (Identifiant National Elève, composé de 10 chiffres et 1 lettre) : DOSSIER D INSCRIPTION - Niveau V PHOTO (récente) LE CANDIDAT NOM : (en lettres capitales) Date de Naissance : / / Sexe : M F PRENOM(S) : Age au 1er Septembre 2015 Lieu de Naissance : Nationalité : Dépt

Plus en détail

RAPPORT DE FORMATION

RAPPORT DE FORMATION RAPPORT DE FORMATION CHANGEMENT DE COMPORTEMENT ET DE CARACTERE Dans la Lutte contre la Corruption Commune ANTSIRABE Région VAKINANKARATRA Organisation de la Société Civile Hotel IMPERIAL Antsirabe 20

Plus en détail

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA TATITRA ANIVON NY ANTENIMIERAM- PIRENENA Praiminisitra Jean RAVELONARIVO 1 TATITRA MANOLOANA NY ANTENIMIERA I 21 MAY 2015 21 MAY 2015 Andininy 54.- Ny Filohan ny Repoblika no manendry ny Praiminisitra

Plus en détail

DOSSIER DE CANDIDATURE

DOSSIER DE CANDIDATURE RECRUTEMENT SANS CONCOURS SESSION 2014 DOSSIER DE CANDIDATURE Recrutement externe d adjoint technique de recherche et formation de 2 ème classe Branche d activité professionnelle : J - Gestion et Pilotage

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

SECTION SPORTIVE SCOLAIRE FOOTBALL

SECTION SPORTIVE SCOLAIRE FOOTBALL SECTION SPORTIVE SCOLAIRE FOOTBALL Filles et Garçons Continuité Collège/Lycée Collège Marie Curie / Lycée Thibaut de Champagne Pratiquer le Football de la Sixième à la Terminale Lycée Thibaut de Champagne

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

M o t d u P rov i n c i a l Temps de grâces

M o t d u P rov i n c i a l Temps de grâces Mot du Provincial Temps de grâces Plusieurs événements de la province et de l Église à Madagascar constituent nos sources d action de grâce à adresser au Seigneur. La visite fraternelle et édifiante du

Plus en détail

B.P.J.E.P.S. DOSSIER DE CANDIDATURE Session 2: 6 octobre 2014-19 décembre 2014

B.P.J.E.P.S. DOSSIER DE CANDIDATURE Session 2: 6 octobre 2014-19 décembre 2014 FORMATION DE PREPARATION A L ENTREE EN B.P.J.E.P.S DOSSIER DE CANDIDATURE Session 2: 6 octobre 2014-19 décembre 2014 Nom Prénom : : DOSSIER A RETOURNER AUX CEMEA Adresse des CEMEA Mayotte : PHOTO Maison

Plus en détail

Évaluation de l impact environnemental et social

Évaluation de l impact environnemental et social RÉPUBLIQUE DE MADAGASCAR Tanindrazana - Fahafahana - Fandrosoana PRÉSIDENCE PROJET PÔLE INTÉGRÉS DE CROISSANCE Secrétariat National Évaluation de l impact environnemental et social Cadre de politique de

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES DEPARTEMENT INTERDISCIPLINAIRE DE FORMATION PROFESSIONNELLE COMMUNICATION ET DYNAMIQUE LOCALE RAPPORT

Plus en détail

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Ventin-kevitra Matoan-dahatsoratra Fampahafantarana an i Madagasikara 4 Ny Nosy Telma, mpandraharaha nasionaly manara-penitra iraisam-pirenena

Plus en détail

LANY TAMINGANA ETO AMINTSIKA

LANY TAMINGANA ETO AMINTSIKA cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY MINISTERAN NY FAMBOLENA NY FIOMPIANA ARY NY JONO ----------------------------------- REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana ---------------------------------- MINISTERAN NY TOEKARENA

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

S.E.G.P.A. CONVENTION DE STAGE D APPLICATION

S.E.G.P.A. CONVENTION DE STAGE D APPLICATION S.E.G.P.A. CONVENTION DE STAGE D APPLICATION PRÉNOM, NOM DE L ÉLÈVE DATE DE NAISSANCE ADRESSE RESPONSABLE LÉGAL Il a été convenu ce qui suit, en application des dispositions du Décret N 2003-812 du 26-8-2003,

Plus en détail