MAMPIANARA ANAY HIVAVAKA

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "MAMPIANARA ANAY HIVAVAKA"

Transcription

1 MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo Andrombavaka hatramin ny niantombohan izany tamin ny Ezaka Ranonorana Maneran-tanyc tamin ny taona Ny Fanahy Masina dia nanetsika fifohazana, fiovam-po, fitiavana fatratra indray ny asa fitoriana, ary fahasitranan ny fifandraisana. Marina tokoa fa ny vavaka no toerana ahaterahan ny fifohazana! Mino izahay fa hiova ny fiainanareo sy ny an ireo olona entinareo am-bavaka rehefa mikambana amin ny mambran ny fiangonanareo hianareo hivavaka ho an ny firotsahan ny Fanahy Masina. Toy izao nambaran ny ololna sasantsasany izay nandray anjara tamin ny Folo Androm-bavaka 2013 : - Rehefa nivory isan andro jzahay nandritra ireo folo andro ireo, dia nahatsapa ny famangian ny Fanahy Masina tahaka ny tamin ny andro apostolika. Nisy fiaiken-keloka tamin-kitsim-po tokoa sy fahatorotoroan ny fo ka dia nandao ny alahelony ny mambra ary nifamela heloka. Tena fotoanan ny famelombelomana tokoa tamin izany ho anay eto amin ny Strong Tower ~ (Ikenna Joseph, Nigeria) - Nandritra ireo andro faramparany dia nanohina ahy ny fivavahana ary nanomboka «nahatsapa» hoe inona marina ny zavatra azon Andriamanitra atao ary mihoatra noho ny mahita toerana azon ny fiara ijanonana ao amin i Costco izany! Tena fenon ny fahasoavany aho ~( Avy amin ny mambra iray vao vita batisa, araka ny fitantaran i Loralyn Horning, USA) - Voalohany izao no nanaovanay fandaharana feno momba ny «10 Androm-bavaka». Afaka nahita fahagagana izahay : nisy zazavavikely iray izay nivavaka ho an ny raiamandreniny nilaza fa tsy te-hisarapanambadiana intsony ny rainy. Nisy mambra anankiray hafa, izay nilaza fa tsy dia manana fotana hijoroana ho vavolombelona, nanolotra boky Hery Mifanandrina ho an ny mpividy entana ao aminy. Nisy vehivavy iray izay nivavaka isan andro ho an ny namany no indro fa nanatona azy ny namany silamo iray nanontany momba an i Jesosy. Mahatsapa tena ho akaiky kokoa an Andriamanitra aho. Fihaikana lehibe izany hoe manao ny andraikitry ny mpitarika vondrom-bavaka izany, nefa misaotra an Andriamanitra aho noho ny nanohanany ahy isan andro. ~ (Mylène Peronet, France) - Misaotra betsaka! Hitanay sahady ny vokatra sy ny herin ny vavaka eo anivon ny mambran ny fiangonanay sy ny tanora. Tena tsara Andriamanitra! ~ (William Wolfgramm, Nouvelle-Zélande) NY LOHA-HEVITRY NY VAVAKA HATAONTSIKA : NY VAVAKY NY TOMPO 1

2 Mandritra ny Folo Androm-bavaka 2014 isika dia hivavaka amin ny alalan ny vavaky ny Tompo, izay hita ao amin ny Matio 6:9-13 sy Lioka 11:1-4. Vontom-bavaka ny fiainan ny Mpamonjintsika, satria tamin ny fifandraisana ety tamin ny Rainy no nahitany sy nandraisany ny heriny, ny filaminan ny fiainany, ny fahefany sy ny fifaliany. Nandritra ireo oram-pivavahana vao maraina no nanomezan Andriamanitra Azy toro-hevitra ho an ny tontolo andro. Tohina fatratra tamin ny fahazaran i Jesosy mivavaka ny mpianatra ka dia nagataka Azy izy ireo mba hampianatra azy hivavaka. Ho valin izany dia naveriny ny vavaka izay nomeny tamin ny Toriteny teo antendrombohitra. Mbola misy zavatra maro ao amin ny vavaka tsotra izay tsy takatry ny sain izy ireo, satria izany dia nampiala ny fifantohan izy ireo tamin ny tenany ho amin Andriamanitra, ary nahafaoka ny filàny rehetra. Isika koa dia tokony hianatra hivavaka tahaka izay nataon i Jesosy. Mandritra ireo folo andro manaraka hianareo dia hahita/hahatsapa ny halalin ny dikan ny vavaky ny Tompo izay tsy noheverinareo akory ho azo atao ; ho hitanareo fa ho voasintona ho amin Andriamanitra ny fonareo amin ny fitiavana sy ny firehetana amin ny asany, ary hahita valiny mahagaga amin ny fivavahana hianareo. Antom-bavaka isan andro Ny fizarana momba ny fitalahoana sy fanelanelanana isan andro dia ahitana antom-bavaka eo amin ny lisitra izay maneho ny zavatra ilain ny tena manokana sy ny filàna iombonan ny Fiangonana Advantista Mitandrina ny Andro Fahafito Maneran-tany. Io fizarana io koa dia manizingizina ny amin ny tetik asa sy ny iraka tanterahin ny fiangonantsika maneran-tany amin ny taona Ezaka ho an ny Tanàn-dehibe Ny vavaka manokana ifantohantsika amin ity taona dia ny tetik asa fitoriana amin ny tanàn-dehibe. Io fandaharana io dia fanamafisana ataon ny Fiangonana Advantista Mitandrina ny Andro Fahafito momba ny fizarana ny fitiavan i Jesosy sy ny fanantenana ny amin ny fihaviany tsy ho ela amin ny olona monina antanàn-dehibe. Izany tetik asa izany dia mikendry ezaka hatao amin ny tanàna lehibe indrindra mihoatra ny 630 eto amin izao tontolo izao. Io ezaka io dia nanomboka tao New York tamin ny taona lasa ary hitohy mandritra ny taona 2014, 2015 sy an-koatr izany. Feno dia feno ny hetsika fitoriana (mba hanomezana fahafaha-mpo ny filàna ara-tsaina, ara-batana ary ara-panahy) ary mitohy ka mahatonga ny fisian ny advantista mitandrina ny andro fahafito hitoetra maharitra amin ny tanàn-dehibe. Ny fomba fiasa ho fanentanana dia ahitana foibe manapariaka ny hevitra/fampianarana, vavaka sy sampan asa fanaovana fanavaozana, asa ho an ny fiaraha-monina, seminera momba ny fahasalamana, tarika madinika, sampana miadidy ny vehivavy, sampana ho an ny tanora sy ezaka fijinjana. Isan andro mandritra ireo folo androm-bavaka isika dia hampisongadina ny filàna vavaka ho an ny ezaka ho an ny tanàn-dehibe. Raha te-hahita ny lisitr ireo tanàn-dehibe sy fahafantarana fanampiny dia jereo ny tranon-kala sy Vavaka Iombonana Isika rehetra dia efa samy niaraka nivavaka tamin ny hafa teo aloha, nefa mety tsy mbola nanao fanandramana ny amin ny fitahiana sy ny herin ny vavaka iombonana hianareo. Mandritra ireo folo andro ireo dia ho voatahy be dia be tokoa hianareo rehefa mikambana amin ireo anadahy sy rahavavy amin ny firesahana mivantana amin Andriamanitra. Ireto misy toro-hevitra vitsivitsy mba hahatonga ny vavaka iombonana ho mahafinaritra ho an ny olona rehetra: Ataovy fohy ny vavakareo fehezan-teny iray na roa monja ho an ny antom-bavaka iray. Dia avelao ho an ny hafa indray ny fanohizana azy. Afaka mivavaka imbetsaka araka izay tianao hianao, tahaka ny amin ny resaka ifanaovana. 2

3 Tsara ny fahanginana, satria izany dia manome ho an ny tsirairay fotoana hihainoana ny Fanahy Masina. Ary ny miaraka manandratra hira araka ny fitarihan ny Fanahy masina dia fitahiana ihany koa. Mba tsy handaniana ny ampahan ny fotoana sarobidy amin ny vavaka amin ny firesahana momba ny antom-bavakareo dia manaova fotsiny vavaka momba izany. Rehefa izany dia afaka mivavaka ho an ny antom-bavakao koa ny hafa sy mitaky ny teny fikasana ho an ny zavatra ilainao. Vavaka sy fitakiana ny Soratra Masina Ny famakiana andalan-teny fohy avy amin ny Soratra Masina na mivavaka amin ny alalan izany dia fomba mahafinaritra hahazoana antoka fa mivavaka araka ny sitrapon Andriamanitra hianao. Ny mivavaka amin ny famerenana/fampahatsiahivana amin Andriamanitra ny teny fikasany dia fomba tsy mampino ho fanamafisana orina ny finoana. Tian Andriamanitra isika raha mivavaka Aminy ka mampahatsiaro Azy ny Teniny amin ny fiteny fankasitrahana sy fiderana na fampanantenana. «Aoka ny tenin'i Kristy hitœtra betsaka ao aminareo amin'ny fahendrena rehetra, dia mifampianara ka mifananara amin'ny salamo sy ny fihirana ary ny tonon-kiram-panahy, mihira amin'ny fahasoavana ao am-ponareo ho an'andriamanitra.» (Kolosiana 3:16). Ho gaga hianareo amin ny fahitana ny fomba azonareo ampiasaina hivavahana ary hahita fifaliana amin izany! Ity misy ohatra iray ny amin ny fomba fivavaka mampahatsiaro an Andriamanitra ny teniny: Milaza ny 1 Tesaloniana 3:13 fa, «mba hampiorina ny fonareo tsy hanan-tsiny amin'ny fahamasinana eo anatrehan'andriamanitra Raintsika amin'ny fihavian'i Jesosy Tompontsika mbamin'ny masiny rehetra.». Dia mivavaha toy izao:" Tompo tsara ô! meteza hanamafy ny fahavononana ao am-pon ny zanakolahy hanao izay marina sy mahitsy. Omeo azy ny fahasoavanao handray fanapahan-kevitra izay hitondra ho amin ny fahamasinana. Jesosy ô! ampio izy hiandry sy hiomana ho amin ny fihavianao, sns." Mivavaka ho an ny olona dimy Mandritra ireo folo androm-bavaka dia ampirisihina hianareo hanao vavaka fanelanelanana amin ny fomba manokana ho an ny olona dimy izay mifanerasera aminareo. Mety ho mambran ny fianakaviana izany, namana, mpiara-miasa na mpiara-mianatra, mpifanolo-bodirindrina, na olona hafa manahiran-tsaina anao. Mandritra ny takariva voalohany dia soraty amin ny karatra roa ny anaran izy ireo sy ny anton-javatra hivavahana ho azy. Ny karatra iray dia ho anao mba hampahatsiaro anao mandrakariva ny hanao fanelanelanana ho azy ireo. Ny mpitarika ny fiaraha-mivavakareo kosa handray ny karatra faharoa amin ny fiafaran ny fotoana. Isaky ny andro manaraka dia hisintona karatra anankiray avy ao amin ny boaty hianao ary hivavaka ho an ny olona voatanisa ao. 3

4 ANDRO 1 NY TSIAMBARATELON NY HERINY Soso-kevitra ny amin ny Endriky ny Vavaka Iombonana «Ary Jesosy nivavaka tao amin'ny fitœrana iray, ka rehefa nitsahatra Izy, dia hoy ny mpianany anankiray taminy: Tompoko, mampianara anay hivavaka, tahaka ny nampianaran'i Jaona ny mpianany.» (Lioka 11:1) Fiderana (10 mn) Aoka ny fotoam-bavakareo hatomboka amin ny fiderana an Andriamanitra noho ny ampianarany antsika mba hivavaka amin ny fomba mahomby kokoa. «Ary toy izany koa, ny Fanahy no mamonjy ny fahalementsika: fa tsy fantatsika izay vavaka tokony hataontsika; fa ny Fanahy no mifona amin'ny fitarainana tsy azo tononina.» (Romana 8:26) Manokàna fotoana hiderana an Andriamanitra noho ny maha-izy Azy (ny toetrany) sy ny zavatra ataony. Fiaiken-keloka (5 mn) Miaike heloka noho ny tsy fahampian ny fivavahantsika sy ny fanelanelanana ataontsika amin ny maha-isam-batan olona sy amin ny maha-vahoaka ary managataha an Andriamanitra mba hamela ny helotsika noho ny tsy fahazoantsika mifandray Aminy amin ny alalan ny vavaka sy ny fanelanelanana. «Ary ny amiko, sanatria raha hanota amin'i Jehovah aho ka hitsahatra tsy hangataka ho anareo; fa izaho hanoro anareo izay lalana tsara sy mahitsy.» (1 Samoela 12:23) Mangataha amin Andriamanitra mba hanoro anareo izay ota rehetra tokony hiaikena eo amin ny fiainanareo, ary manokàna fotoana hihainoana amim-pahanginana ny valiny omeny. Mangataha famelana ary ekeo am-pifaliana ny famindrampony. Fitalahoana sy Fanelanelanana (35 mn) Mangataha amin Andriamanitra mba hanomezany antsika ny Fanahy Masina mba hampianatra antsika hivavaka tahaka an i Jesosy sy mba hanelanelana marina tokoa ho an ny hafa. «Ary haidiko amin'ny taranak'i Davida sy amin'ny mponina any Jerosalema ny fanahin'ny fahasoavana sy ny fifonana» (Zakaria 12:10) Mivavaha mba hanana fitiavam-bavaka, sy faharesen-dahatra ny amin ny tena ilàntsika vavaka, ary fahatsapana ny hery ho azontsika amin ny alalan ny vavaka. Mivavaha mba hisian ny tarika mpiara-mivavaka hipoitra ombieny ombieny. Mangataha amin Andriamanitra ny amin ny fomba hisian ny vavaka bebe kokoa ao amin ny fiangonanareo. 4

5 Mivavaha mba hahazoantsika mianatra ny mangataka ny fitarihana/toro-hevitr Andriamanitra alohan ny hanaovantsika drafitra. Tetik asa ho an ny Tanàn-dehibe: mba ho feno fahendrena sy ny Fanahy Masina ireo tompon andraikitry ny fiangonana izay manatontosa ny tetik asa amin ireo tanàn-dehibe miisa 630, mba ho mpitarika manana ny toe-tsain ny mpanompo izay mikatsaka sy manaraka ny plana/sitrapon Andriamanitra ary maneho fahombiazana eo amin ny fahazoana fanahy. Mivavaha ho an ny Advantista, sy ny kristiana rehetra, mba hanao fanandramana hy amin ny fifohazana sy fanavaozana marina amin ny fiarahan izy ireo mandeha amin Andriamanitra. Mivavaha mba ho feno ny Fanahy Masina izy ireo, hanana fahalalana manokana an i Jesosy amin ny alalan ny Baiboly sy ny vavaka, ary hiaina fiainana masina. Mivavaha ho an ny tenanao manokana, ho an ny mambra sy ny pasitoran ny fiangonanareo ary ho an ireo vondron olona manaraka ireto : mpitondra ny fiangonana amin ny ambaratonga rehetra, ny ray aman-dreny, ny ankizy, ny tokantena, ny mpampianatra, ny pasitora, ny mpiasan ny fahasalamana sy ny misionera. Mangataha amin Andriamanitra olona dimy ho entina am-bavaka mandritra ireo folo andrombavaka ary avelao ny Fanahy Masina hitondra olona ao an eritreritrao. Soraty eo amin ny karatra roa. Ento miaraka aminao ny anankiray ary ny iray kosa ataovy ao anaty boatin ny tarika misy anao, mba hahazoana mivavaka momba izany isan-kariva. Mivavaha ho an ny antom-bavaka hafa izay ao am-ponao. Fisaorana (10 mn) Mifalia satria mihaino sy mamaly ny fivavahantsika Andriamanitra. Jereo Jeremia 33:2, 3. Misaotra Azy noho ny namaliany sahady ny fivavahantsika mialoha ny ahitantsika ny vokatra. Hira (atao ireto hira ireto na hafa, mandritra ny fotoam-bavaka, araka izay itarihan Andriamanitra anareo) "Viens, Esprit Saint», «Esprit du Dieu vivant» (SDA Hymnal n 672), «Entends notre prière, Seigneur (SDA Hymnal n 684);«J'ai besoin de prières»(sda Hymnal n 505),«Pour Vous, je prie "(SDA Hymnal n 284). 5

6 Fanambaran i Ellen White momba ny Vavaky ny Tompo «Koa amin izany mivavaha toy izao hianareo...» (Matio 6:9). Indroa no nanomezan ny Mpamonjintsika ny Vavaky ny Tompo, voalohany tamin ny vahoaka tamin ny Toriteny teo an-tendrombohitra, ary koa, volana vitsivitsy taorian izany, tamin ny mpianatra irery ihany. Nihataka kely ny Tompony nandritra ny fotoana fohy ireo mpianatra, ka rehefa niverina izy ireo dia nahita Azy revo tanteraka tamin ny fifandraisana tamin Andriamanitra. Toy ny nahatsapa akory ny fanatrehan izy ireo Izy ka dia nanohy nivavaka tamin ny feo avo. Namirapiratry ny fahazavan ny lanitra ny tavan ny Mpamonjy. Toa nifanatrika tamin ny tsy hita maso Izy, ary nisy hery velona teo amin ny teniny toy ny olona miresaka amin Andriamanitra. Tohina mafy ny fon ny mpianatra teo am-pihainoana. Imbetsaka izy ireo no nahamarika Azy nandany ora maro samirery tamin ny fifandraisana tamin ny Rainy. Ny tontolo androny dia lany tamin ny fanompoana ny vahoaka izay nifanety teo Aminy, ary tamin ny fampibaribariana ny fahateren-tsaina feno hafetsen ireo raby. Ary izany asa tsy mitsahatra izany dia nahatonga ho reraka tanteraka hany ka nanahy mafy ny reniny sy ny rahalahiny ary ireo mpianany fa toy ny atao sorona ny fiainany. Kanefa rehefa niverina avy amin ireny ora maro nivavahana izay namarana ny tontolo andro nanasatra ireny Izy, dia voamarik izy ireo ny rivompiadanana nisoritra teny amin ny endriny, ny famelombelomana izay toa namonto ny fanatrehany. Avy tamin ireo ora nolaniana niaraka tamin Andriamanitra ireo no nivoahany, isa-maraina, mba hitondra ny fahazavan ny lanitra amin ny olombelona. Noho izany ny mpianatra dia tonga tamin ny fehin-kevitra fa nisy fifandraisany ny ora nolanian i Jesosy tamin ny fivavahana sy herin ny teniny ary ny asany. Ankehitriny, raha nihaino ny fitalahoany izy ireo, dia tohina fatratra ny fony ary feno fanetren-tena. Rehefa nitsahatra nivavaka Izy dia tamin ny faharesen-dahatry ny filàn ny tenany manokana lalina no niantsoany hoe: «Tompo, mampianara anay hivavaka» (Lioka 11:01). Tsy hoe nanome azy ireo endrika vaovaon ny vavaka akory Jesosy. Namerina fotsiny izay nampianariny teo aloha Izy, toy ny nilaza hoe: Tokony ho tsapanareo sy takatrareo izay zavatra efa nomeko. Izany dia manana hevitra lalina izay tsy mbola notrandrahanareo. Na izany aza anefa dia tsy mametra antsika amin ny fampiasana ireo teny ireo fotsiny ny Mpamonjy. Fa satria iray tamin ny taranak olombelona Izy, dia naneho ny idealin ny tenany tao amin ny vavaka nataony, teny tena tsotra ka na dia ny zazakely aza dia afaka mandray azy, ary tena feno ihany koa ka na dia ny manam-pahaizana indrindra aza dia tsy hahatakatra na oviana na oviana amin ny fahafenoany ny heviny manontolo. Ampianarina isika hanatona an Andriamanitra amin ny fanehoam-pankasitrahana izay setriny avy amintsika, hampahafantatra Azy ny zavatra ilaintsika, hiaiky ny helotsika, ary hitaky ny famindrampony araka ny teny fikasany. * Thoughts From the Mount of Blessing, pages 102,

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

Noely 2009 Taom-baovao 2010

Noely 2009 Taom-baovao 2010 FMM Fiombonana Miara-mivavaka eto Münich. Noely 2009 Taom-baovao 2010 Fa Zaza no teraka ho antsika, Zazalahy no omena antsika, ary ny anarany atao hoe Mahagaga, Mpanolon-tsaina, Andriamanitra Mahery, Rain

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg 0 UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail

Plus en détail

Ny Vaovao Mahafaly. La Bonne Nouvelle

Ny Vaovao Mahafaly. La Bonne Nouvelle Ny Vaovao Mahafaly La Bonne Nouvelle Ary tamin ny fahenim-bolana dia nirahin Andriamanitra ny anjely Gabriela ho any an-tanàna anankiray any Galilia atao hoe Nazareta, ho any amin ny virijina anankiray,

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. "Dieu qualifie ceux qui sont appelés", hoy Rakotolehibe Mamy, Talen ny FMMB

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. Dieu qualifie ceux qui sont appelés, hoy Rakotolehibe Mamy, Talen ny FMMB Taniketsa - Laharana faha 58 - Septambra 2014 1 Gazetin ny Sampana Sekoly Alahady FJKM Andrainarivo Taniketsa Miseho isan-telo volana. Laharana faha 58. Septambra 2014. Vidiny: 400 Ariary. Tranokala: www.sa-andrainarivo.mg

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

M o t d u P rov i n c i a l Temps de grâces

M o t d u P rov i n c i a l Temps de grâces Mot du Provincial Temps de grâces Plusieurs événements de la province et de l Église à Madagascar constituent nos sources d action de grâce à adresser au Seigneur. La visite fraternelle et édifiante du

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

FINOANA SY FAHAZAVANA FOI ET LUMIERE

FINOANA SY FAHAZAVANA FOI ET LUMIERE FINOANA SY FAHAZAVANA FOI ET LUMIERE BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 Gazety avoakan ny Mpiaramivavaka Kristianina Malagasy eto Bénélux (M.K.M.B.) Bulletin de liaison et d information de la

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

AMBATONAKANGA SY NY MISIONERA ;

AMBATONAKANGA SY NY MISIONERA ; AMBATONAKANGA SY NY MISIONERA ; Raha miteny hoe Ambatonakanga isika protestanta amin izao andro ankehitriny izao dia ny trano fiangonana vita amin ny vato no tonga ao an-tsaintsika voalohany ary vitsy

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

Février - mars 2016 n 47 TRAIT D UNION

Février - mars 2016 n 47 TRAIT D UNION Février - mars 2016 n 47 TRAIT D UNION Le journal en ligne de la RNS Train Manakara-Fianarantsoa Éditorial 2 Lyon et ses incontournables 3 La tribune du coordinateur 4 Itinéraire d un sportif gâté 5 Lalaina

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES DEPARTEMENT INTERDISCIPLINAIRE DE FORMATION PROFESSIONNELLE COMMUNICATION ET DYNAMIQUE LOCALE RAPPORT

Plus en détail

ATRIKA Le journal de l ASMF

ATRIKA Le journal de l ASMF Association des Anciens du Collège St-Michel en France ATRIKA Le journal de l ASMF OCTOBRE 2010 ÉDITION : Octobre 2010, NUMÉRO 12 Éditorial 2010 ASMF bureau 2009/2010 Joël Rambatomanga(1990) Président

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

GLOTTOPOL Revue de sociolinguistique en ligne

GLOTTOPOL Revue de sociolinguistique en ligne GLOTTOPOL Revue de sociolinguistique en ligne N 2 Juillet 2003 Anciens et nouveaux plurilinguismes SOMMAIRE Introduction Premier chapitre : Les situations de plurilinguisme : aménagement et représentations

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

EDITORIAL. Un bon projet ALAHADY 26 SEPTAMBRA 2010. Fanompoampivavahana voalohany amin ny taona 2010-2011.

EDITORIAL. Un bon projet ALAHADY 26 SEPTAMBRA 2010. Fanompoampivavahana voalohany amin ny taona 2010-2011. BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 1 - Septembre 2010 EDITORIAL Un bon projet Mensuel - Editeur Responsable:

Plus en détail

Conversations en ligne : descriptions, perspectives. Louise Ouvrard

Conversations en ligne : descriptions, perspectives. Louise Ouvrard Conversations en ligne : descriptions, perspectives Eléments théoriques La variation Quelques caractéristiques du discours électronique La langue malgache Le corpus Présentation Analyse Quels apports à

Plus en détail

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar HUMBOLDT-UNIVERSITÄT ZU BERLIN Landwirtschaftlich-Gärtnerische Fakultät Schriftenreihe des Seminars für Ländliche Entwicklung VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE -----------------------

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- MINISTERE DES TRANSPORTS ET DE LA METEOROLOGIE -------------- RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- I. CONTEXTE Malgré

Plus en détail

MpANAMORY RAdO RABARILALA

MpANAMORY RAdO RABARILALA ENIM-BOLANA TSY TAFATSANGANA FANJAITRA MIISA 21 NO NESORINA TAO AN-KIBON i LALAINA P.06 N 3190 L u n d i 2 9 j u i n 2 0 1 5 PRIX : Ar 400 zatovolahy NANGALATRA volamena P.06 TENY AM-pASANA : NANONOFY

Plus en détail

LANY TAMINGANA ETO AMINTSIKA

LANY TAMINGANA ETO AMINTSIKA cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN

Plus en détail

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent cyan magenta jaune noir PROGRAMME P.7 RENCONTRE DE VONTOVORONA POSSIBLE ECHEC Les partis et associations de GRATUIT QUOTIDIEN D INFORMATION N 0137 DU Mercredi 25 Août 2010 FIARAHAMONINA HADIHADIANA NY

Plus en détail