REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

Dimension: px
Commencer à balayer dès la page:

Download "REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY"

Transcription

1 REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA mamaritra ny fepetra ampiharana ny Lalàna laharana faha tamin ny 19 Aogositra 1999 mitondra ny Fehezandalàna mifehy ny harena ankibon ny tany novain ny Lalàna laharana faha tamin ny 17 Oktobra 2005 NY PRAIMINISITRA, LEHIBEN NY GOVERNEMANTA, Araka ny Lalàm-panorenana ; Araka ny Lalàna lf tamin ny 15 Febroary 1960 mikasika ny fanananpanjakana azo amidy miaraka amin ireo rijan-teny manova izany ; Araka ny Lalàna lf tamin ny 15 Jolay 1970 mitondra fanomezandàlana hankatoavana ny Fifanarahana iraisam-pirenena mikasika ny Tsy Fanapariahana ireo fitaovam-piadiana nokleary ; Araka ny Lalàna lf tamin ny 21 Desambra 1990 anaovana ny Dinan ny Tontolo iainana malagasy miaraka amin ireo rijan-teny manova izany ; Araka ny Lalàna lf tamin ny 26 avril 1995 mikasika ireo fahefana sy tandrifimpahefana ary loharanom-bolan ny Vondrom-bahoakam-paritra itsinjaram-pahefana ; Araka ny Lalàna lf tamin ny 26 Avrily 1995 anaovana ny fitsipika mikasika ny fandaminana sy ny fomba fiasa ary ny anjara raharahan ny Vondrom-bahoakamparitra itsinjaram-pahefana ; Araka ny Lalàna lf tamin ny 26 Avrily 1995 anaovana sata manokana mikasika ny Kaominina ambonivohitra ao Nosy-Be sy Sainte-Marie ; Araka ny Lalàna lf tamin ny 26 Avrily 1995 anaovana sata manokana mifehy ny tanànan Antananarivo, Renivohitr i Madagasikara ;

2 - 1 - Araka ny Lalàna lf tamin ny 30 Septambra 1996 mikasika ny fitantanana eny an-toerana ny loharanon-karena voajanahary mety havaozina ; Araka ny Lalàna lf tamin ny 08 Aogositra 1997 anavaozana ny lalàna mifehy ny ala ; Araka ny Lalàna lf tamin ny 02 Janoary 1998 mikasika ny fiarovana amin ny loza ateraky ny taratra mamorona iona sy ny fitantanana ny fako voavaikantaratra eto Madagasikara ; Araka ny Lalàna lf tamin ny 19 Aogositra 1999 mikasika ny politikampitantanana sy fanaraha-maso ny fandotoana ateraky ny indostria ; Araka ny Lalàna lf tamin ny 19 Aogositra 1999 mitondra ny Fehezandalàna mifehy ny harena ankibon ny tany, novain ny Lalàna lf tamin ny 17 Oktobra 2005 ; Araka ny Lalàna fehizoro lf tamin ny 29 Aogositra 2000 anoritana ny faritry ny fitantanana ny raharaha tokantranon ny Faritany mizaka tena ; Araka ny Lalàna lf tamin ny 11 Febroary 2003 mikasika ny Fehezandalàna mifehy ny fitantanana ny valan-javaboahary voaaro ; Araka ny Lalàna lf tamin ny 27 Aogositra 2003 anomezan-dàlana ny fidiran i Madagasikara amin ny Fifanarahana tamin ny 1979 momba ny fiarovana arabatana ny akora nokleary ; Araka ny Lalàna lf tamin ny 03 Septambra 2004 mikasika ny antoka ; Araka ny Lalàna lf tamin ny 28 Jolay 2004 mitondra ny Fehezandalàna momba ny asa ; Araka ny Lalàna lf tamin ny 17 Jona 2004 mikasika ny Faritra ; Araka ny Lalàna lf tamin ny 26 Jolay 2004 anaovana ny Fehezandalàna momba ny fifampiraharaham-barotra amin ny Fanjakana ; Araka ny Lalàna lf tamin ny 17 Oktobra 2005 mametra ireo feni-kevitra ankapobe mifehy ny satan ny tany ; Araka ny Lalàna lf tamin ny 17 Oktobra 2005 mikasika ny Fifaninanana ; Araka ny Hitsivolana lf tamin ny 03 Oktobra 1960 mikasika ny fitondrana ny fanoratana ny tany miaraka amin ireo nanovàna azy ; Araka ny Hitsivolana lf tamin ny 27 Septamba 1962 momba ny fampanofàna maharitra ela, novain ny Lalàna lf tamin ny 13 Aogositra 1996 ; Araka ny Hitsivolana lf tamin ny 19 Septambra 1962 mikasika ny fanesorampananana noho ny antony fanasoavam-bahoaka, ny fividianana am-pihavanana

3 - 2 - ataon ny Fanjakana na ny vondrombahoaka ambaratonga faharoa ary mikasika ny ambony ampanga amin ny fananan-tany ; Araka ny Didim-panjakana lf tamin ny 28 Desambra 1960 amerana ny fepetra ankapobe fampiharana ny Hitsivolana lf tamin ny 03 Oktobra 1960 sy ireo rijan-teny manova azy ; Araka ny Didim-panjakana lf tamin ny 26 May 1995 anasokajiana ny Kaominina ho Kaominina Ambonivohitra na ho Kaominina Ambanivohitra ; Araka ny Didim-panjakana lf tamin ny Septambra 1996 amaritana ireo anjara raharahan ny Ben ny tanàna ; Araka ny Didim-panjakana lf tamin ny 02 Oktobra 1997 ankatoavana ny politika momba ny ala malagasy ; Araka ny Didim-panjakana lf tamin ny 28 May 1998 mamaritra ny politika mikasika ny harena ankibon ny tany ; Araka ny Didim-panjakana lf tamin ny 15 Desambra 1999 mikasika ny fampifaneranana ny fampiasam-bola hamokarana amin ny tontolo iainana ; Araka ny Didim-panjakana lf tamin ny 14 Febroary 2001 amerana ny fepetra ampiharana ny fitantanam-pifanarahana ifanaovana mikasika ny alan ny Fanjakana ; Araka ny Didim-panjakana lf tamin ny 3 Marsa 2004 mametra ny fandaminana, ny fitondrana ary ny andraikitry ny Fokontany ; Araka ny Didim-panjakana lf tamin ny 17 Septambra 2004 amaritana ny fitsipika momba ny fandaminana, ny fampandehanana ny anjara raharahan ny Faritra, ho fampiharana ireo fepetra tetezamita sy farany amin ny Lalàna lf tamin ny 17 Jona 2004 mikasika ny Faritra ; Araka ny Didim-panjakana lf tamin ny 11 Janoary 2005 ananganana ireo Distrika sy ireo Boriborintany ara-panjakana ; Araka ny Didim-panjakana lf tamin ny 13 Desambra 2005 ampiharana ny andininy faha-2 andalana faha-2, 4, 17, 20 ary 28 amin ny Lalàna lf tamin ny 11 Febroary 2003 mikasika ny Fehezandalàna mifehy ny fitantanana ny valan-javaboahary voaaro ; Araka ny Didim-panjakana lf tamin ny 13 Desambra 2005 anavaozana ny Didim-panjakana lf mikasika ny fepetra ankapobeny ampiharana ny Lalàna lf tamin ny 08 Aogositra 1997 anavaozana ny lalàna mifehy ny ala ; Araka ny Didim-panjakana lf tamin ny 11 Septambra 2002 amaritana ny andraikitra sy ny fandaminana ary ny fomba fiasan ny Komitim-paritany (CPM) sy ny Komitim-pirenena momba ny harena ankibon ny tany ;

4 - 3 - Araka ny Didim-panjakana lf tamin ny 12 Janoary 2003 manendry ny Praiminisitra sady Lehiben ny Governemanta ; Araka ny Didim-panjakana lf tamin ny 16 Janoary 2003, novain ny Didimpanjakana lf tamin ny 05 Janoary 2004, lf tamin ny 05 Jolay 2004, lf tamin ny 07 Desambra 2004, lf tamin ny 17 Marsa 2005, lf tamin ny 19 Oktobra 2005, lf tamin ny 28 Novambra 2005 ary lf tamin ny 04 Oktobra 2006 anendrena ny mambra ao amin ny Governemanta ; Araka ny Didim-panjakana lf tamin ny 31 May 2005 mametra ny andraikitry ny Ministry ny Angovo sy ny Harena ankibon ny tany ary ny fandaminana ankapobeny ny ministerany ; Rehefa nahazo ny fanehoan-kevitry ny Komity Nasionalin ny Harena ankibon ny tany Araka ny tolokevitry ny Ministry ny Angovo sy ny Harena ankibon ny tany, Teo amin ny Filankevitry ny Governemanta, DIA MAMOAKA IZAO DIDIM-PANJAKANA IZAO : Andininy voalohany.- Ity Didim-panjakana ity dia mametra ireo fomba sy fepetra ampiharana ny Lalàna laharana faha tamin ny 19 Aogositra 1999 mitondra ny Fehezandalàna mifehy ny harena ankibon ny tany, novain ny Lalàna laharana faha tamin ny 17 Oktobra 2005, izay tondroina manaraka eto amin ny hoe «Fehezandalàna mifehy ny Harena ankibon ny tany». LOHATENY VOALOHANY FEPETRA ANKAPOBENY TOKO VOALOHANY NY AMIN NY ANKAPOBEN-JAVATRA Andininy 2.- Ho famenon ireo teny voafaritra ao amin ny Fehezandalàna mifehy ny Harena ankibon ny tany, araka ny heviny raketin izao didim-panjakana izao, dia lazaina hoe : «Manampahefana ao amin ny Faritany mizakatena na ao amin ireo Vondrombahoakam-paritra itsinjaram-pahefana» : ny lehiben ny mpananantanteraka ao amin ny Faritany mizakatena, ny Faritra na ny Kaominina, na raha tsy eo izy, dia ny mpanampy azy na izay misolotena azy ; «Fanomezandàlana momba ny harena ankibon ny tany» : ny fanomezan-dalàna ny fihadiana aragonite na célestite, ny fanomezandàlana hanangona na hihady sisankaringana ary koa fanomezandàlana hanao fanadihadiana siantifika miaraka na tsy miaraka amin ny fakàna santionany, ny fanomezandàlana manokana hamandrika vakimparitra ;

5 - 4 - «Efamira mifanika sy mifampitohy» : ny efamira roa mifanolotra manana lafy iray itambarany ; «Sarintany kadastraly momba ny harena ankibon ny tany» : ny sarintany arajeografika atao araka ireo maridrefy voafaritra, sy voazarazara ho efamira mitovy habe araka izay fomba fanoritana lafitsary nosafidiana. Ny fitambaran ireo sarintany kadastraly momba ny harena ankibon ny tany natao araka ny maridrefy mitovy, ary ahitana ny fanoritana lafitsary natao araka izay fomba nekena, dia mampiseho ny tanim-pirenena. Ireo sarintany kadastraly momba ny harena ankibon ny tany ireo dia amboarina sy atontan ny Biraon ny Kadasitra momba ny harena ankibon ny tany ; «Fanitarana ny akora ao amin ny Fahazoandàlana» : Ny fanampiana akora mineraly iray na maromaro hafa amin ny lisitr ireo izay nanomezana alalana tao amin ny Fahazoandàlana voalohany ; «Fanarenana ny tontolo iainana» : ny fitambaran ny lahasa mikendry ny famerenana amin ny laoniny ny toerana toy ny teo aloha araka izay azo atao na amin ny alalan ny fanonerana, ny fitambaran ireo lahasa mikendry ny hahatonga ny toerana ho azo karakaraina, sy ho mari-toerana tsara mba hiantohana izay mety ho karazana aina na asa aman-draharaha hatao any aoriana, sy mba hanarenana ny fahafahan ilay toerana anaovana asa momba ny harena ankibon ny tany mba mampandroso asa hafa mety hifanentana amin izay mety ho karazana aina na asa any amin ny faritra misy izany toerana izany, aorian ny asa momba ny harena ankibon ny tany. Andininy 3.- Amin ny fampiharana ny voalazan ny andininy faha-4 vaovao amin ny Fehezandalàna mifehy ny harena ankibon ny tany, ny fanoritana lafitsary amin ny fitambaran ny velaram-paritanim-pirenena misy harena ankibon ny tany dia atao amin ny saritany manana mari-drefy araka ny famaritana etsy ambony. Ny efamira arak io famariparitana io dia fantatra, ho fampiasana izao didimpanjakana izao, amin ny alalan ny fangitra Laborde misy ny ivony na amin ny alalan ny fangitra araka izay fomba fanoritana ampiharina asolo toerana ny fanoritana Laborde, na ihany koa amin ny alalan ny famantarana izay omen ny Biraon ny Kadasitra momba ny harena ankibon ny tany azy ireo, raha ilaina izany. Faritan ny Biraon ny Kadasitra momba ny harena ankibon ny tany ireo fenitra arateknika arahina eo amin ny kadasitra momba ny harena ankibon ny tany. Amin ny alalan ny didim-panjakana no andraisana ny fomba fanoritana amin ny lafitsary. Ireo mari-drefy ampiasaina dia faritana amin ny alalan ny didim-pitondrana. Ireo tso-tsarintany nalaina tamin ny sarintany kadastraly natontan ny Biraon ny Kadasitra momba ny harena ankibon ny tany no azo ekena amin ny asa atao eny antoerana na raha misy fifanoherana mikasika ny famaritana ny vakimparitra itrandrahana harena ankibon ny tany. Andininy 4.- Amin ny hevitr izao didim-panjakana izao, ny singan-taratasy ary koa ny filazalazana takiana mba hamantarana ny olona izay mangataka Fahazoandàlana na Fanomezandàlana araka ny hevitry ny andininy 2 ery ambony, dia tsy maintsy misy indrindra :

6 - 5 - a) Ho an ny olontsotra : - ny anarana, fanampin anarana, asa (miaraka amin ny filazalazana misy fanamarinana rehetra) ary ny fonenan ilay mpangataka ; - ny kopia voamarina fa mitovy amin ny karampanondrom-pirenena ; - tso-tsoratry ny taratasy fitanisan-tsazy, biletà faha-3 ; - ireo fitsiahy momba ny fisoratana amin ny famantarana ara-antontanisa sy ny laharam-pamantarana ara-ketra (NIF) ; - ny kopia voamarina fa mitovy amin ny karatra maha-mpandraharaha an ilay mpangataka ka manankery amin ny taona diavina, ny filazalazana ny momba ny fandoavan-ketra na ny taratasy fanamarinana ny tsy fandoavan-ketra nomen ny sampandraharaham-panjakana momba ny hetra manam-pahefana hanao izany ; b) ho an ny fikambanana : - ny kopia voamarina fa mitovy amin ny sata mifehy (amin ny teny malagasy na frantsay) ; - ny tso-tsoratry ny Registry ny varotra sy ny sosaity, ireo fitsiahy ny laharampamantarana ara-antontanisa sy ny laharam-pamantarana ara-ketra (NIF) ; - ny kopia voamarina fa mitovy amin ny karatra maha-mpandraharaha an ilay mpangataka ka manankery amin ny taona diavina, ny filazalazana ny momba ny fandoavan-ketra na ny taratasy fanamarinana ny tsy fandoavan-ketra nomen ny sampandraharaham-panjakana momba ny hetra mahefa eo an-toerana ; c) Ho an izay nomem-pahefana tompon andraikitra misolotena ny fikambanana ho fampiharana ny voalazan ny andininy 11 amin ny Fehezandalàna mifehy ny harena ankibon ny tany : - ny anarana, fanampin anarana, asa (miaraka amin ny filazalazana misy fanamarinana rehetra) ary ny fonenany ; - ny fanamarinam-ponenana eto Madagasikara ; - ny kopia voamarina fa mitovy amin ny karapanondrom-pirenena (ho an ny teratany malagasy) na ny kara-pivahinianana (ho an ny vahiny) ; - ny tso-tsoratry ny taratasy fitanisan-tsazy, biletà faha-3 ; ary - ny kopia voamarina fa mitovy amin ny fanomezam-pahefana ankapobeny nifanaovany tamin ilay fikambanana, misy hajian-ketra, misy daty, misy sonia ary nandoavana volam-panjakana teny amin ny Foibe ara-ketra mahefa eo an-toerana. d) Ho an ireo olona tsotra hafa misolotena ny mpangataka : - ny anarana, fanampin anarana, asa (miaraka amin ny filazalazana misy fanamarinana rehetra) ary ny fonenany ; - ny kopia voamarina fa mitovy amin ny karapanondrom-pirenena ; - raha ilaina, ny kopia voamarina fa mitovy amin ny karatra maha-mpandraharaha an ilay mpangataka ka manankery amin ny taona diavina, ny filazalazana ny momba ny fandoavan-ketra na ny taratasy fanamarinana ny tsy fandoavan-ketra nomen ny sampandraharaham-panjakana momba ny hetra manam-pahefana hanao izany ; - ary ny kopia voamarina fa mitovy amin ny fanomezam-pahefana manokana nifanaovany tamin ny mpangataka isaky ny zavatra manokana atao faritan io fanomezam-pahefana io, misy hajian-ketra, misy daty, misy sonia ary nandoavana volam-panjakana teny amin ny Foibe ara-ketra mahefa eo an-toerana.

7 - 6 - Andininy 5.- Voakasika manokana amin ny fandraràna voalazan ny andininy 10 vaovao, andalana voalohany amin ny Fehezandalàna mifehy ny harena ankibon ny tany, izay olona rehetra tondroin ny andininy 2-5 sy 2-6 amin ny Fehezandalàna momba ny varotra nahitsin ny Lalàna lf tamin ny 2 Aogositra 1999 mikasika ny satan ny mpivarotra. Ny fandraràna ambara eo andalana faha-2 amin io Andaniny 10 vaovao amin ny Fehezandalàna mifehy ny harena ankibon ny tany dia mikendry indrindra ny fisorohana ny fifangaroana tombotsoa. Andininy 6.- Miorina ho Fikambanan ny Mpitrandraka madinika sy Fikambanan ny Mpisivam-bolamena araka ny hevitra voalazan ny andininy faha-11-1 amin ny Fehezandalàna mifehy ny harena ankibon ny tany, ireo fikambanana atsangana mifanaraka amin izay ambaran ity andininy ity. Ireo mpikambana ao anatin ny fikambanana dia ireo izay manao ny asa fitrandrahana harena ankibon ny tany madinika na asa fisivanam-bolamena ao anatin ny faritry ny Kaominina iray. Manana zo aman andraikitra eken ny lalàna ho azy manokana ny Fikambanana voaorina aradalàna, ary atao hamondronana ny tombontsoa arak asa ho an ireo mpikambana ao aminy tsirairay avy, hampidirana ao amin ny ara-dalàna ary fiantsorohana ny asa ataon izy ireo. Ny Fikambanana dia anaovan ny mpanorina azy fanambarana eo anivon ny Kaominina izay iasany. Ampiarahina amin ny taratasy fanambarana fisiana ny Fitanana an-tsoratra ny fananganana ny Fikambanana sy ny sata mifehy azy. Aorian ny fanamarinana ny fanajana izay voalazan ny didy aman-dalàna ny fananganana ny Fikambanana, dia omen ny Ben ny tanàna tapakila izy. Amin ny fandinihina ny antontan-taratasy dia angatahina ny hevitry ny distrika voakasik izany. Ampahafantarin ny Kaominina ny Fitondrandraharahan ny Tale Iraisam-paritra misahana ny harena ankibon ny tany voakasik izany, ny fitsanganan ny Fikambanana izay nandraisany fanambarana ao anatin ny 10 andro manaraka ny nanomezana tapakila mifanaraka amin izany. Ny Fikambanana dia manana rafitra mpanapa-kevitra sy rafitra mpanantanteraka ary fitsipika fampandehanan-draharaha sy fitantanam-bola. Didim-pitondrana raisin ny Minisitra misahana ny harena ankibon ny tany no hamaritra ny sata lasitry ny Fikambanana. Andininy 7.- Mikasika ny fampiasana mpiasa avy any ivelany, ankoatra ireo adidy aman andraikitra voafaritry ny didy aman-dalàna amin izany, raha mitovy ny fahafaha-manao sy ny fahaizana, dia ireo mpiasa malagasy no tokony hampiasain ny tompon ny fahazoandàlana voalohany indrindra. Ankoatr izany, ny tompon ny fahazoandàlana izay misitraka ny sata mikasika ny fahamarinantoerana iantohana dia tsy maintsy mametraka fandaharan asa momba ny fanofanana am-boky sy iatrehan asa ireo teratany Malagasy miasa ho azy. Tsy maintsy omeny vahana ihany koa ny fidiran ireo mpiasa teratany Malagasy amin ny asa rehetra tafiditra ao anatin ny tetikasany na inona na inona lentany, ary izany dia arakaraka ny fahafahana manaon ny tsirairay avy.

8 - 7 - Ny fanantontosana izao andininy izao dia azo faritana amin ny alalan ny didy amampitsipika. Andininy 8.- Ireo fampahafantarana mila atao ho fampiharana izay voalazan ny Fehezandalàna mifehy ny harena ankibon ny tany dia, tanterahina, arakaraka ny tranga, amin ny iray amin ireto endrika manaraka ireto : A) Ho an ireo fampahafantarana ara-pitondran-draharaha : 1 - Fampahafantarana amin ny alalan ny taratasy alefan ny Fitondrandraharahampanjakana ; 2 - Fampahafantarana amin ny alalan ny taratasy tsotra alefa paositra; 3 - Fampahafantarana amin ny alalan ny taratasy alefa paositra, alefa tsiverimandeha misy fangatahana fanamarinana fandraisana na tsia; 4 - Fampahafantarana amin ny alalan ny vadintany; 5 - Fampahafantarana amin ny alalan ny fax na telex; ireo fampahafantarana ireo dia tsy maintsy hamafisina amin ny fandefasana ireo dika notoavina na ireo taratasy tena izy. B) Fampahafantarana sy tatitra alefa amin ny Fitondrandraharaham-panjakana : 1 - Fametrahana ny antontan-taratasy ao amin ny biraom-panjakana voakasik izany; 2 - Fandefasana amin ny alalan ny taratasy alefa paositra; 3 - Fandefasana amin ny alalan ny taratasy alefa paositra tsiverimandeha misy fangatahana fanamarinana fandraisana na tsia; 4 - Fampahafantarana amin ny alalan ny vadintany. Andininy 9.- Ireo karazana fomba fampahafantarana dia : 1 - Ny fampahafantarana atao amin ny tenany ; 2 - Ny fampahafantarana atao ao amin ny trano fonenany; 3 - Ny fampahafantarana atao any amin ny Kaominina ; 4 - Ny fampahafantarana atao any amin ny Fokontany. Ny fonenana nambara tamin ny Fitondrandraharaham-panjakana tao anaty fangatahana no raisina ho marina amin ny fampahafantarana rehetra atao amin ny mpangataka na amin ny tompon ny fahazoandàlana, AERP na fanomezandàlana hikaroka na hitrandraka harena ankibon ny tany, raha tsy noho izay mety ho fanovàna taty aoriana, ka efa nampahafantarin ilay voakasik izany ny Biraon ny Kadasitra momba ny harena ankibon ny tany. TOKO II NY AMIN NY TAHIRY TSY MAHARITRA Andininy 10.- Azo atao ny manambara ny fanasokajiana faritra ho tahiry voatokana tsy maharitra amin ny alalan ny didim-pitondrana, ho fampiharana ny voalazan ireo andininy faha-15 vaovao hatramin ny 19 amin ny Fehezandalàna mifehy ny harena ankibon ny tany. Ny Komitim-pirenena momba harena ankibon ny tany dia tsy maintsy anontaniana miaraka amin ny fe-potoana 5 andro fiasana mba hanehoany

9 - 8 - ny heviny omban antonantony mialoha izay rehetra Didim-pitondrana manambara ny fanasokajiana ho tahiry tsy maharitra. Ny tsy fisiana valinteny ao anatin io fepotoana io dia midika fa mitovy ny hevitra. Ireo Didim-pitondrana manafaka ny faritra nosokajiana ho tahiry toy izany dia tsy maintsy milaza ireo antony anesorana ny fanasokajiana sy ny datin ny fanafahana ireo faritra ireo, ka ampahafahantarina ny besinimaro amin ny alalan ny petadrindrina sy/na fomba hafa mety araka izay safidin ny Fitondrandraharahampanjakana izany. Ny ampitson ny ifaranan ny fe-potoana ara-dalàna mahavoasokajy ho faritra voatahiry manokana na izay faritan ny Didim-pitondrana manambara fanasokajiana na Didim-pitondrana manalava ny fotoana, ny faritra dia afahana avy hatrany. Andininy 11.- Ho fampiharana ny andininy faha-16 amin ny Fehezandalàna mifehy ny harena ankibon ny tany, ny Minisitra misahana ny Asa Vaventy dia omen-dàlana, rehefa nahazo ny fankatoavan ny Minisitra misahana ny harena ankibon ny tany sy ny Minisitra misahana ny Fanajariana ny tany isanisany avy, hanambara amin ny alalan ny didim-pitondrana sy araka ny fepetra voalazan io andininy io, fa ny fanasokajiana ho tahiry voatokana tsy maharitra ny faritra sasantsasany ka tsy azo anomezana fanomezandàlana na zo hikaroka na hitrandraka harena ankibon ny tany. Na izany aza anefa, ny fanapahana momba ny fanomezandàlana ny asa dia tsy maintsy hamarinina manokana indrindra amin ny alalan ny : a) ny toetra maha-asa fanasoavam-bahoaka ny asa tanterahina ao anatin ilay faritra, na b) ny toetra maha-antok aina ny zava-kinendriny, voamarina ara-dalàna, ho an ilay toerana voakasik izany. Andininy 12.- Ho fampiharana ny fepetra voalazan ny andininy faha-17 vaovao amin ny Fehezandalàna mifehy ny harena ankibon ny tany, ny Minisitra misahana ny harena ankibon ny tany, ary raha ilaina, miaraka amin ny Minisitra misahana ny tontolo iainana aorian ny hevitry ny Komity Iraisan ny ministera Harena ankibon ny tany - Ala - Tontolo iainana dia faritan ny didy aman-pitsipika ny mpikambana ao anatiny sy ny anjara asany, dia omen-dàlana hanambara amin ny alalan ny didimpitondrana sy araka ny fepetra voalazan io andininy io, ny fanasokajiana ny faritra sasantsasany ho tahiry voatokana tsy maharitra sy tsy azo anomezana fanomezandàlana na zo hikaroka na hitrandraka harena ankibon ny tany mba hahazoana manao fanadihadiana ara-haibolan-tany sy/na ara-tontolo iainana ao. Na izany aza anefa, ny fanapahana momba ny fanomezandàlana io fanadihadiana io dia tsy maintsy hamarinina indrindra indrindra amin ny alalan ireto ihany : a) ny fanoritana mazava ny toerana hanaovana ny asa ao amin ilay faritra ; b) ny fandalinana ny zava-pantatra fototra ara-haibolan-tany mikasika tobinà akora mineraly na sisan-karingana izay na maromaro, na c) ny fandalinana ireo zava-pantatra fototra ara-tontolo iainana ao anatin ilay faritra; na d) ny fampiroboroboana ny famokarana ao amin ilay faritra voakasik izany, amin ny alalan ny fitrandrahana ny vokatry ny fanadihadiana.

10 - 9 - Andininy 13.- Ho fampiharana ny andininy faha-18 amin ny Fehezandalàna mifehy ny harena ankibon ny tany, ny Minisitra misahana ny harena ankibon ny tany dia omendàlana hanambara amin ny alalan ny didim-pitondrana sy araka ny fepetra voalazan io andininy io, ny fanasokajiana ny faritra sasantsasany ho tahiry voatokana tsy maharitra sy tsy azo anomezana fanomezandàlana na zo amin ny harena ankibon ny tany mba hahazoana manao asa fiantsorohana ireo mpitrandraka madinika na ny mpisivam-bolamena. Na izany aza anefa, ny fanapahana momba ny fanomezandàlana io asa fiantsorohana io dia tsy maintsy hamarinina indrindra indrindra amin ny alalan ireto ihany : a) ny fanatanterahana fanadihadiana fototra momba ny tontolo iainana na fanadihadiana momba ny fiantraikany eo amin ny tontolo iainana mba hanaovana izay mety ho fahazoandàlana ho an ireo mpitrandraka madinika na mpisivambolamena miasa ao amin ny faritra ; b) ny fanatanterahana asa fanarenana toe-javatra izay mety hiteraka fahavoazana lehibe amin ny tontolo iainana noho ireo asa momba ny harena ankibon ny tany atao ao amin ilay faritra ; c) ny fanofanana sy ny fiantsorohana ny mpitrandraka volamena na ny mpitrandraka madinika ivelan ny ara-dalàna mitoetra ao amin ilay faritra momba ny paika arahina mba hahazoana sy hitànana zo amin ny harena ankibon ny tany ; d) ny fanofanana ny mpitrandraka madinika mitoetra isam-banim-potoana ao amin ny faritra; na e) izay antony hafa rehetra mifandray amin ny fandaminana sy ny fanofanana ireo mpitrandraka madinika ivelan ny ara-dalàna sy ireo mpisivam-bolamena, na ny lahasa mikendry ny hanamarin-toeran ny tontolo iainana ao amin ny faritra. Andininy 14.- Ny didim-pitondrana mitondra fanasokajiana ho tahiry voatokana tsy maharitra rehetra izay voasonia, voasoratra am-boky ary nampahafantarina ny Biraon ny Kadasitra momba ny harena ankibon ny tany dia azo atohitra avy hatrany manomboka amin ny fotoana andraisany azy. Ireo fangatahana Fahazoandàlana momba ny harena ankibon ny tany, Fanomezandàlana manokana hamandrika vakimparitra (AERP) na fanomezandàlana momba ny harena ankibon ny tany amin ireo efamira ao tafiditra manontolo na ampahany ihany ao anatin ny faritra nosokajiana tsy maharitra ho tahiry voatokana, dia tsy azo raisina mandritra ny fotoana aharetan ny fanasokajiana ho faritra voatokana, raha tsy noho ny fepetra manokana ambaran ilay didim-pitondrana mitondra ny fanasokajiana ny faritra. Ny fangatahana Fahazoandàlana momba ny harena ankibon ny tany izay mikasika efamira iray na maromaro tafiditra tanteraka na ampahany ihany ao anatin ny faritra voatokana tsy maharitra, ka napetraka talohan ny nanaovana ny tahiry voatokana tsy maharitra ary tsy mbola navoaka ny Fahazoandàlana mifanaraka amin izany, dia mitazona ny laharam-pahamehany kanefa dia mihantona kosa ny fandinihana sy ny famoahana ny Fahazoandàlana mikasika izany mandritra ny fotoana aharetan ny fanakilasiana ho faritra voatokana. Manana andraikitra ny Fitondrandraharahampanjakana hampahafantatra avy hatrany ny tompon ny fahazoandàlana raha vao tapitra ny fe-potoan ny nanakilasiana ny faritra voatokana.

11 Andininy 15.- Tapitra avy hatrany amin ny andro mialoha ny daty mampanankery ny Didim-pitondrana manao ny fanakilasiana ny faharetan ny fanomezandàlana rehetra momba ny harena ankibon ny tany ao anatin ilay faritra voatokana. Ny fanajanonana ny asa sy ny fandraisana mialoha ireo sara amin ny harena ankibon ny tany sy tamberimbidy nefain ny tompon ny fanomezandàlana izay tapitra araka izany ny faharetany dia oneran ny Fitondrandraharahan ny Harena ankibon ny tany miaraka amin ireo ministera hafa mifandrimbona amin ny fanambaràna ho tahiry voatokana tsy maharitra. Ny fanombanana ny onitra dia ataon ny teknisian ireo ministera voakasik izany ireo miaraka amin ny tompon ny fanomezandàlana momba ny harena ankibon ny tany. Raha toa ka tsy misy fifanarahana hita, dia ferana amin ny alalan ny fanelanelanana ny onitra. Ny AERP rehetra eo amin ny efamira iray na maro tafiditra ao anatin ilay faritra nosokajiana tsy maharitra ho tahiry voatokana ary tsy navadika ho fangatahana Fahazoandàlana alohan ny daty mampanankery an ilay Didim-pitondrana manao fanakilasiana, dia heverina ho toy ny tsy nisy. Mijanona ho an ny Biraon ny Kadasitra momba ny harena ankibon ny tany ny saram-pamoahana naloa ary tsy averina. Andininy 16.- Ny fanambarana ny fanosokajiana ho tahiry voatokana tsy maharitra mba hahafahana manatanteraka asa vaventy na fanadihadiana momba ny haibolantany na ara-tontolo iainana, na ny fiantsorohana ny mpitrandraka madinika na ny mpisivam-bolamena dia mampihantona ny fari-potoana mampanan-kery ny Fahazoan-dalana momba harena ankibon ny tany voakasik izany eo amin ireo efamira izay nanomezan ny tompon ny fahazoandàlana alalana hanaovana ny tahiry voatokana, ka Fahazoandàlana nomena talohan ny vaninandro nanaovana ny fanambarana. Aorian ny fanafahana ny tahiry voatokana tsy maharitra dia mitohy indray ny faripotoana mampanan-kery io Fahazoandàlana momba ny harena ankibon ny tany io afa-tsy noho ny fampiharana ny voalazan ny andininy faha-17-1 amin ny Fehezandalàna mifehy ny harena ankibon ny tany ; rehefa mitohy indray izany, dia halavaina mandritra ny fotoana mitovy amin ny fari-potoana nanaovana ny fanokanana tsy maharitra izy io. Ny Biraon ny Kadasitra momba ny harena ankibon ny tany dia manana andraikitra hampahafantatra avy hatrany ny tompon ny Fahazoandàlana momba ny harena ankibon ny tany izay nihantona sy ireo mpangataka Fahazoandàlana izay nahantona ny fandinihana na ny fanomezana ny Fahazoandàlana azy, ny fanafahana ny tahiry voatokana tsy maharitra sy izay fombafomba atao mikasika izany fanafahana izany. Andininy 17.- Mandritra ny faharetan ny fotoana anaovana ny fanakilasiana ho faritra voatokana dia ahantona ny fanerena tsy maintsy handoa ny saram-pandraharahana momba ny harena ankibon ny tany mikasika ireo efamira izay anisan ny vakimparitra iray ary izay neken ny tompon ny fahazoandàlana hanaovana fanokanana. Raha toa ka efa nandoavam-bola izy ireo, dia atokana ho vola voaray mialoha amin ny saram-pandraharahana fandoa isan-taona momba ny harena ankibon ny tany ho an ny tompon ny fahazoandàlana, ka hafindra ho amin ny taona hanaovana ny fanafahana ireo efamira voakasik izany.

12 Ny vola dia hosoratana ao amin ny rejisitry ny vola miditra amin ireo sara ireo izay tànan ny biraon ny kadasitra momba ny harena ankibon ny tany ; anomezana tapakila ho an ny tompon ny fahazoandàlana izany. Raha ilaina, ny fampiharana ny voalazan ny andininy faha-17-1 amin ny Fehezandalàna mifehy ny harena ankibon ny tany amin ny Fahazoandàlana momba ny harena ankibon ny tany iray dia mitarika ny fampidirana ao anatin ny fikajiana ny onitra aloa ho fampiharana ny voalazan ny andalana farany amin io andininy io, ny saram-pandraharahana fandoa isan-taona momba ny harena ankibon ny tany efa naloan ny tompon ny Fahazoandàlana ary izay mifanaraka amin ny fari-potoanan ny fanokanana ny faritra voatokana izay misy ny vakimparitra voakasik izany. Andininy 18.- Na eo aza ireo fepetra voalazan ny andininy faha-16 eo ambony, sy ho fampiharana ny voalazan ny andininy faha-17-1 amin ny Fehezandalàna mifehy ny harena ankibon ny tany, amin ny fanafahana ny faritra voatokana hanaovana fanadihadiana ara-haibolantany na ara-tontolo iainana, ny Didim-pitondrana manala ny fanakilasiana dia afaka, araka ny tranga : 1 - Mametra ny fangatahana Fahazoandàlana momba ny harena ankibon ny tany azo raisina ho an ireo momba ny Fahazoandàlana «R» na Fahazoandàlana «E» ihany ; na 2 - Manapaka fa hampifaninanana ireo mpandraharaha maniry an ireo vakimparitra ao anatin ny faritra raha toa ka natokana tsy maharitra ho tahiry hanaovana fanadihadiana mialoha ny fahazoa-mantontosa mikasika ara-haibolantany no natao ka mikasika iray na maromaro amin ireo akoran-karena ankibon ny tany voatondro mazava tsara izay ho faritana amin ny alalan ny Didim-pitondrana ny lisitr izy ireo ary tsy maintsy ho akoram-by fototra izany na ho akoram-batoafo (uranifères). Andininy 19.- Ny fombafomba arahina amin ny fifaninanana ambaran ny andininy 18 eo aloha ho fanomezana ny vaki-paritra momba ny harena ankibon ny tany, dia tsy maintsy manaja ireo fepetra momba ny fangaraharaha lazain ny didy aman-dalàna manankery, indrindra izay voalazan ny Fehezandalàna mifehy ny Tsenampanjakana sy ny Lalàna mikasika ny fifaninanana. Ankoatra izany, ny fanomezana vakimparitra iray momba ny harena ankibon ny tany izay hifaninanana dia tsy maintsy ampiarahina amin ny fanekena ny bokin andraikitra manokana sy ireo adidy ara-tontolo iainana ary ireo hafa hoferana tahaka ny : - Ho an ny Fahazoandàlana «R», tsy maintsy hanantanterahana ireo asa fikarohana araka ny drafi-pikarohana napetraka ; - Ho an ny Fahazoandàlana «E», tsy maintsy hanantontosana ny drafitra momba ny petrakare-mamokatra napetraka miaraka amin ny fangatahana Fahazoandàlana momba ny harena ankibon ny tany sy ny hanantanterahana ireo asa voavinavina ao amin ny fandaharan asa fitrandrahana ; - Ho an ny Fahazoandàlana rehetra, tsy maintsy hanaovana tatitra isam-banimpotoana ka ho faritana ny isany sy ny vontoatiny. Aorian ny fizahana ifotony, ny tsy fanajana ireo teny famarafarana amin ny bokin andraikitra sy ireo adidy ara-tontolo iainana dia mitarika sazy ara-pitondran-

13 draharaha sy ara-bola raha misy indrindra izay voalaza ao amin ny Toko voalohany amin ny Lohateny XIV amin ity didim-panjakana ity sy/na ireo voalaza ao amin ny bokin andraikitra mifandraika amin izany. Ny fanoherana rehetra sy fangatahana onitra mikasika ny fampiharana izay voalazan ny andininy faha-18 sy 19 amin ity Didim-panjakana ity dia anaovana fampihavanana mialoha eo anatrehan ny Komitim-pirenena momba ny harena ankibon ny tany. Raha tsy misy fifanarahana hita, dia fanelanelanana no amahana ny olana araka ny fepetra voalazan ny Fehezandalàna mifehy ny harena ankibon ny tany sy ny Fehezandalàna momba ny paikady madio Malagasy. Andininy 20.- Ny fikarakarana ny fifaninanana dia ankinina amin ny Biraon ny Kadasitra momba ny harena ankibon ny tany. Ny Biraon ny Kadasitra momba ny harena ankibon ny tany dia hamoaka amin ny fotoana mahamety izany ireo fombafomba ilaina arahina amin ny fikarakarana izany fifaninanana izany. Misy sarany izay feran ny Biraon ny Kadasitra momba ny harena ankibon ny tany isaky ny fifaninanana, halaina ho azy isaky ny antontan-taratasy omena momba ny fifaninanana, ho sara amin ny fikarakarana. Andininy 21.- Ho fampiharana ny voalazan ny andininy faha-18-1 amin ny Fehezandalàna mifehy ny harena ankibon ny tany, ny Biraon ny Kadasitra momba ny harena ankibon ny tany dia omen-dàlana amin ny alalan ny didim-pitondrana mitondra ny fanalavana ny tahiry voatokana tsy maharitra na amin ny alalan ny didim-pitondrana mitondra ny fanafahana ilay faritra, hanome AERP ho an ireo Fikambanana niorina ara-dàlana ka miasa ao anatin ilay faritra voatokana. Na ahoana na toy inona, io didim-pitondrana io dia tsy maintsy avoaka roa (2) volana raha tara indrindra mialoha ny vaninandro tena hanafahana sy hanokafana ny fangatahana Fahazoandàlana momba ny harena ankibon ny tany. Aorian io famoahana io, ireo Fikambanana izay miorina mifanaraka amin ny voalazan ny andininy faha-11-1 amin ny Fehezan-dàlana mifehy ny harena ankibon ny tany ka miasa ao anatin ny faritra voatokana, dia afaka mametraka any amin ny Biraon ny Kadasitra momba ny harena ankibon ny tany ny fangatahany AERP ahitana isanisany tambatra efamira efatra (4) raha be indrindra izay itoerany tamin ny fiantsorohana ka tsy mbola misy Fahazoandàlana momba ny harena ankibon ny tany manankery na fangatahana Fahazoandàlana momba ny harena ankibon ny tany voapetraka talohan ny fanambarana ho faritra tsy maharitra. Ny porofon izany fipetrahana izany dia tsy maintsy hamarin ny antokondraharaha nanankinana ny fiantsorohana sy ny Ben ny tanànan ny Kaominina voakasik izany na raha tsy izany dia ny Lehiben ny distrika voakasik izany. LOHATENY II - NY AMIN NY FITANTANANA NY SEHATRY NY HARENA ANKIBON NY TANY

14 TOKO VOALOHANY - FEPETRA ANKAPOBENY Andininy 22.- Ireo antokondraharaha tompon andraikitra amin ny fampiharana ny fepetra voalazan ny Fehezandalàna mifehy ny harena ankibon ny tany, mbamin ireo andraikiny avy amin ny fampandehanana izany lalàna izany dia faritan ity Lohateny ity. Ireo sarany aterak ireo asa fanaraha-maso sy fisafoana dia zakain ny tetibolan ny fahefana anankinana izany fanaraha-maso na fisafoana izany. Tsy azo atao ny manankina ireo amin ilay olona anaovana fanaraha-maso na fisafoana. TOKO II - NY AMIN NY FITANTANANA NY TONTOLO IAINANA MANODIDINA NY HARENA ANKIBON NY TANY Andininy 23.- Amin ny hevitr ity Didim-panjakana ity, ny Fitondrandraharaha misahana ny Tontolo iainana manodidina ny harena ankibon ny tany dia misy ireo rantsa-mangaika na vondrona tondroina manaraka ireto, ka ny anjara asany avy, amin ny fampandehanana ny Fehezandalàna mifehy ny harena ankibon ny tany, dia velabelarina ao amin ity Toko ity : a) ny sampan-draharaha miandraikitra ny tontolo iainana manodidina ny harena ankibon ny tany eo anivon ny Ministera misahana ny harena ankibon ny tany b) ireo sampan-draharahan ny Ministera misahana ny Tontolo iainana sy ny antokondraharaha mifandrohy aminy mbamin ny Manampahefana mahefa eo amin ny lafiny fiarovana ny tontolo iainana ampiharina amin ny sehatry ny harena ankibon ny tany ; ary c) ireo solontenam-panjakana eo anivon ny Distrika; d) ny Faritany mizaka tena, ny Faritra ary koa ny Kaominina; ary e) ireo Prezidan ny Fokontany eo anivon ny Kaominina. Andininy 24.- Amin ny fampiasana ny fepetra voalazan ny Fehezandalàna mifehy ny harena ankibon ny tany, ny sampan-draharaha miandraikitra ny Tontolo iainana manodidina ny harena ankibon ny tany eo anivon ny Ministera misahana ny Harena ankibon ny tany no manatanteraka miaraka amin ny antokondraharaha hafa miandraikitra ny fitantanana ny Tontolo iainana manodidina ny harena ankibon ny tany, ny asa izay nomena azy amin ny alalan ny Fehezandalàna mifehy ny harena ankibon ny tany na amin ny alalan ny didy aman-dalàna momba ny harena ankibon ny tany na amin ny alalan ny didy aman-dalàna momba ny tontolo iainana ampiharina amin ny sehatra misy harena ankibon ny tany. Andininy 25.- Amin ny fampiharana ny fepetra voalazan ny andininy faha-85 amin ny Fehezandalàna mifehy ny harena ankibon ny tany, ny Kaominina dia manatanteraka miaraka amin ny antokondraharaha hafa miandraikitra ny fitantanana ny Tontolo iainana manodidina ny harena ankibon ny tany, ny fizohiana ny fanajan ny mpisivambolamena miasa any amin ny fari-piadidiany avy, ny fepetra ampiharina amin ny fiarovana ny tontolo iainana izay voasoritra amin ny alalan ny didy amam-pitsipika.

15 Andininy 26.- Didim-pitondrana iraisan ny Minisitra misahana avy ny harena ankibon ny tany sy ny tontolo iainana no hamaritra ny didy aman-dalàna momba ny tontolo iainana ampiharina amin ny sehatra momba ny harena ankibon ny tany. Io didim-pitondrana iraisan ny Ministera io dia raisina ho fampiharana ny fepe-dalàna sy fitsipika manankery mikasika ny tontolo iainana sy ny asa mikasika ny harena ankibon ny tany. Ny didy amam-pitsipika momba ny tontolo iainana ampiharina amin ny sehatry ny harena ankibon ny tany dia manondro raha ilaina, ny Manampahefana mahefa avy, amin ny fampandehanana ireo fepetra voalazan ny Fehezandalàna mifehy ny harena ankibon ny tany, amin izay mikasika indrindra : a) ny fankatoavana ny drafitra misy fepetra fiarovana ny tontolo iainana izay ataon ny mpangataka fanomezandàlana hanokatra fihadiam-bato ary koa fanomezana ny fanomezandàlana momba ny tontolo iainana mifanandrify amin izany ; b) ny fombafomba sy ny fankatoavana ny soritrasa iantohana ny fanarenanana ny tontolo iainana mifandraika amin ny Fahazoandàlana R na amin ny Fahazoandàlana PRE ary koa ny fanomezana ny fanomezandàlana momba ny tontolo iainana mifanandrify amin izany ; c) ny fombafomba sy ny fankatoavana ny fanadihadiana ny fiantraikany eo amin ny tontolo iainana mifandraika amin ny Fahazoandàlana E na, raha ilaina izany, amin ny Fahazoandàlana R na Fahazoandàlana PRE ary koa ny fanomezana ny fanomezandàlana momba ny tontolo iainana mifanandrify amin izany; d) raha misy ilàna izany, ny fombafomba sy ny fankatoavana ny soritrasa iantohana ny fanarenana ny tontolo iainana ambonin izay ampidirin ny mpanao fanambarana noho ny fanitarany Fahazoandàlana hitrandraka akora mineraly vaovao ary koa ny fanomezana ny fanomezandàlana momba ny tontolo iainana mifanandrify amin izany ; e) ireo fombafomba fisafoana ny asa fanivanam-bolamena amin ny lafiny tontolo iainana ; f) raha misy ilàna izany, ny fombafomba sy ny fankatoavana ny soritrasa iantohana ny fanarenana ny tontolo iainana na ny fanadihadiana momba ny fiantraikany eo amin ny tontolo iainana izay atolotry ny mpangataka fanomezandàlana momba ny harena ankibon ny tany (ho an ny fanadihadiana siantifika miaraka na tsia amin ny fakàna santionany, ny fihadiana sisankaringana na ny fitrandrahana céléstite na aragonite) ; g) ny fanomezana fanalàna arakaraka mikasika ny tontolo iainana ho an ny tompon ny Fahazoandàlana momba ny harena ankibon ny tany na fanomezandàlana momba ny harena ankibon ny tany, rehefa hita fototra teny antoerana fa tanteraka ireo asa fanarenana. TOKO III - NY AMIN NY MINISTERA MISAHANA NY HARENA ANKIBON NY TANY Andininy 27.- Ny Ministera misahana ny harena ankibon ny tany dia mitandro ny fametrahana amin ny toerany sy ny fanaraha-maso ireo sampan-draharaha foibe sy ireo sampan-draharaha nanapariaham-pahefana ao amin ny Ministerany, izay ilaina mba hiantoka ny fampiharana ny Fehezan-dàlana mifehy ny harena ankibon ny tany.

16 Ankoatr izany dia izy no miahy ny Biraon ny Kadasitra momba ny harena ankibon ny tany sy ny Antokondraharaha misahana ny Volamena sy izay antokondraharaha hafa rehetra ara-panjakana na tsia efa misy na vao hajoro, ka atao amin ny alalan ny didim-panjakana manokana izany, ary manao ho vaindohan-draharaha samy araka izay tandrify azy avy, ny tena fampiharana ny fepetra voalazan ny Fehezan-dàlana mifehy ny Harena ankibon ny tany. Andininy 28.- Araka ny fepetra soritan ny Fehezan-dàlana mifehy ny harena ankibon ny tany, ny Ministera misahana ny Harena ankibon ny tany dia tomponandraikitra indrindra indrindra mikasika : a) Ny fanantanterahana ny politikan ny fanjakana amin ny lafiny didy aman-dalàna, fampiroboroboana, fitantanana, fanaraha-maso, famatsiam-bola, fanapariahana ny asa momba ny harena ankibon ny tany ary amin ny fampahalalam-baovao / fanabeazana / fifandraisana sy fiantsorohana ireo mpandraharaha amin ny harena ankibon ny tany b) araka izay ilàna izany, ny famolavolana sy ny famerana amin ny alalan ny didimpitondrana ny lisitry ny akora mineraly ka raisina ho anisan ny harena ankibon ny tany ny tobin akora-mineraliny ; c) ny famolavolana sy ny famerana amin ny alalan ny didim-pitondrana ny fanakilasina toby misy sisan-karingarina, miainga amin ny vokatry ny fanadihadiana natao niaraka tamin ny sampan-draharaha voakasik izany ao amin ny Ministera sy tamin ny sampan-draharaha mahefa eo anivon ny Ministera misahana ny Fampianarana ambaratonga ambony sy ny Ministera misahana ny fikarohana siantifika ; d) ny famerana amin ny alalan ny didim-pitondrana ny lisitry ny sisan-karingarina voarara tsy hotrandrahana sy hovarotana ; e) ny fanomezana ny Fahazoandàlana hikaroka (Fahazoandàlana «R») sy ny Fahazoandàlana hitrandraka (Fahazoandàlana «E») ; f) ny fanomezana ny Fanomezandàlana mikasika ny asa fanadihadiana siantifika hatao amin ireo tobinà sisan-karingana kilasiana faharoa ; g) ny fanomezana ny Fanomezandàlana hanangona sy hihady sisan-karingana any amin ny tobinà sisan-karingana kilasiana fahatelo ; h) ny fanomezana ny Fanomezandàlana mikasika ny fihadiana céléstite na aragonite ; i) ny famolavolana sy ny famerana amin ny alalan ny didim-pitondrana ny fepetra teknika tokony hotandremana eo amin ny fitondrana ny asa any amin ny toerampitrandrahana harena ankibon ny tany na any amin ny fihadiam-bato ; j) ny fanomezandàlana hampiasa ny orinasa na sampan orinasa fanodinana akorankarena ankibon ny tany ; io fanomezandàlana io dia mety ho azo omena arak izay

17 fisehoan-javatra, miaraka amin ny Ministera misahana ny tontolo iainana, ny Ministera misahana ny Indostria, ny Ministera misahana ny Asa na ny Ministera misahana ny Fahasalamam-bahoaka; k) ny fanomezandàlana miaraka amin ny Ministera misahana ny Indostria hampiasa orinasa na sampan orinasa fanodinana vokatry ny harena ankibon ny tany, ao anatin ny sehatry ny asa mifampitohy tanteraka atao amin ny harena ankibon ny tany; l) ny famaritana sy ny famerana amin ny alalan ny didim-pitondrana ny fombafomba fanaraha-maso ny kalitao sy ny fifanarahana raha oharina amin ny fanambarana natao, an ireo vato sy metaly sarobidy mbamin ny santionan ny vokatry ny harena ankibon ny tany natokana ho an ny indostria na naodin ny indostria eo an-toerana, alohan ny hanondranana azy, ary izany dia miaraka amin ny Ministera hafa voakasik izany, raha ilaina ; m) ny fankatoavana ny drafi-pampiasambola naseho tamin ny fotoana nanaovana fanambarana ny safidy iantohana ny fahamarinantoerana ; n) raha ilaina, ny fanolorana ny fanomezandàlana momba ny tontolo iainana sy ny fanalàna arakaraka momba izany ; o) ny fanaraha-maso ny tsy maintsy andoavana ny sara amin ny harena ankibon ny tany ; raha ilaina, ny fikajiana, ny fitakiana ary mety ho fitsinjarana ny vola azo avy amin ny sara sy ny tamberimbidy ; p) ny fandinihana ny tatitra nomen ny tompon ny fahazoandàlana araka ny fitsipika mifehy ny harena ankibon ny tany, mbamin ny famadibadihana ireo tatitra ireo sy ny fanaovana antontanisa mikasika ny fahombiazan ny sehatry ny harena ankibon ny tany ary raha ilaina, ny fanomezana ireo sazy noho ny tsy fanantontosana ny adidy aman andraikitra ; q) ny fisafoan-draharaha sy ny polisin ny harena ankibon ny tany, ka ao anatin izany ny fitsidihana eny an-toerana ny foibe fanaovana fikarohana sy/na fitrandrahana sy manerana ny lafin-tanin ny firenena, ao anatin ireo faritra voatokana sy voaaro isankarazany izay azo eritreretina fa mety ahitana fanaovana asa momba ny harena ankibon ny tany, ny fikarohana fandikan-dalàna, ny famotorana, fisavàna sy fitazonana, raha misy, ary ny fanaovana fitànana an-tsoratra fizaham-pototra ny fandikàna ny Fehezandalàna mifehy ny harena ankibon ny tany, araka ny fepetra voalazan ny Toko III amin ny Lohateny IX amin ny Fehezandalàna mifehy ny Harena ankibon ny tany ; r) ny fivarotana na famindràna any amin ireo antokondraharaha na fikambanana izay manana firehana siantifika na koltoraly an ireo vokatra nogiazana ; s) raha misy tsy fanarahan-dalàna ara-keloka, ny fanekena na ny fandavàna hanao raharaham-pihavanana, ny famerana ny tetin ny fifampiraharahana tokony aloa sy izay mety ho fitakiana izany ;

18 t) ny fananganana Komity ara-teknika amin ny famahana ny olana rehetra tsy voavahy amim-pihavanana mifamatotra amin ny fifanitsahan ny vakimparitra momba ny harena ankibon ny tany sy ny tamba-paritra momba ny solika ; u) na dia eo aza ny fepetra voalazan ny andininy faha-24 etsy ambony, ny fanazavana amin ny alalan ny didim-pitondrana, raha ilaina izany, ny fepetra hafa rehetra voalazan ny Fehezandalàna mifehy ny Harena ankibon ny tany na izao didimpanjakana izao. TOKO IV - NY AMIN NY BIRAON NY KADASITRA MOMBA NY HARENA ANKIBON NY TANY Andininy 29.- Ny Biraon ny kadasitra momba ny harena ankibon ny tany dia antokondraharaham-panjakana iray ka ny sata mifehy azy dia apetraka amin ny alalan ny didim-panjakana raisina eo am-pivorian ny Governemanta. Andininy 30.- Ny kadasitra momba ny harena ankibon ny tany dia misy birao foibe sy farafaharatsiny, birao iray apetraka eo akaikin ny tsirairay avy amin ireo Faritany mizaka tena enina. Andininy 31.- Amin ny fampiharana ny fepetra voalazan ny andininy faha-24 sy 29, 91 vaovao sy 93 amin ny Fehezandalàna mifehy ny harena ankibon ny tany, ny Biraon ny Kadasitra momba ny harena ankibon ny tany dia mametraka sy mitàna ny rejisitra tendren ny andininy faha-69 ery ambany ary koa ny saritanin ny retombes minières. Andininy 32.- Amin ny fampiharana ny fepetra voalazan ny andininy faha-21 sy 22 amin ny Fehezandalàna mifehy ny harena ankibon ny tany sy mba iantohana ny maha-voatokana ny zo nomena, ny Biraon ny Kadasitra momba ny harena ankibon ny tany dia mandinika ny fangatahana Fanomezandàlana momba ny harena ankibon ny tany. Ankoatra izany, izy no manoratra am-boky, manome ary mitantana ny fanomezandàlana manokana hamandrika vakimparitra, ary manara-maso ny zo sy adidy mifandrohy amin izany. Andininy 33.- Amin ny fampiharana ny fepetra voalazan ny andininy faha-43 ka hatramin ny 47 amin ny Fehezandalàna mifehy ny Harena ankibon ny tany, ny Biraon ny Kadasitra momba ny harena ankibon ny tany dia manoratra am-boky sy mandinika ny fangatahana Fahazoandàlana R, E ary PRE. Andininy 34.- Amin ny fampiharana ny voalazan ny andininy faha-42 vaovao sy 48 amin ny Fehezandalàna mifehy ny harena ankibon ny tany, ny Biraon ny Kadasitra momba ny harena ankibon ny tany dia manoratra am-boky sy manome Fahazoandàlana R sy E nomen ny Minisitra misahana ny harena ankibon ny tany, ary koa ny Fahazoandàlana PRE omen ny Manampahefana ara-teknika misahana ny harena ankibon ny tany ao amin ny Faritra voakasik izany. Amboariny ny titra avy eo izay hosoniavin ny Talen ny Biraon ny Kadasitra momba ny harena ankibon ny tany sy mamoaka izany ho an ny tompon ny fahazoandàlana. Andininy 35.- Ho fampiharana ny fepetra voalazan ny andininy faha-53 vaovao sy 57 vaovao amin ny Fehezandalàna mifehy ny harena ankibon ny tany, ny Biraon ny

19 Kadasitra momba ny Harena ankibon ny tany dia miandraikitra, mifanaraka amin ny voalazan ity Didim-panjakana ity, ny fitakiana ny saram-pandraharahana momba ny harena ankibon ny tany sy ny famindrana ny anjarany avy any amin ny mpisitraka tsirairay ambaran ny andininy faha-90 ery ambany, araka ny taha fitsinjarana noferana. Andininy 36.- Ny Biraon ny Kadasitra momba ny harena ankibon ny tany dia manoratra am-boky ny loa-bola natao, sy manamarina ny tsy fandoavana ny sarampandraharahana momba ny harena ankibon ny tany ataon ny tomponà Fahazoandàlana momba ny harena ankibon ny tany. Andininy 37.- Izy no hanamarina isan-taona ny tsy fandoavana ny sarampandraharahana momba ny harena ankibon ny tany fandoa isan-taona, ary alefany any amin ny Minisitra misahana ny harena ankibon ny tany sy ny Manampahefana ara-teknika misahana ny harena ankibon ny tany ao amin ny Faritra voakasik izany, arakaraka ny tranga, ny tolokevitra momba ny hanafoanana ny Fahazoandàlana momba ny harena ankibon ny tany izay tsy nandoavana ireo sara ireo, aorian ny mety ho fanehoan ny tompona Fahazoandàlana momba ny harena ankibon ny tany ny antontan-taratasy fiarovan-tenany araka ny paika voalaza ao amin ny andininy faha-200 amin ny Fehezandalàna mifehy ny harena ankibon ny tany. TOKO V - NY AMIN NY ANTOKONDRAHARAHA MISAHANA NY VOLAMENA Andininy 38.- Ny sata mifehy ny Antokondraharaha misahana ny Volamena dia atao amin ny alalan ny didim-panjakana manokana. Andininy 39.- Ny Antokondraharaha misahana ny Volamena dia hanana birao foibe sy birao any amin ireo toerana izay hita fa ilàna izany. Andininy 40.- Ny Antokondraharaha misahana ny Volamena dia mitana tsy maty paik andro ny lisitry ny mpisivam-bolamena miasa any amin ny isaky ny Kaominina. Tsy maintsy mandefa tso-tsoratra amin io lisitra io any amin ny Fitondrandraharahan ny Tale iraisam-paritry ny Minisitera misahana ny harena ankibon ny tany mahefa izy. Andininy 41.- Ny Antokondraharaha misahana ny Volamena dia mitana tsy maty paik andro ny lisitr ireo mpanangona volamena miasa isaky ny Kaominina, ary mandefa tso-tsoratra amin io lisitra io any amin ny Fitondrandraharahan ny Tale iraisam-paritry ny Minisitera misahana ny harena ankibon ny tany mahefa ; ankoatr izany, dia izy no mandray ny tatitra isan enim-bolana apetrak ireo mpanangona volamena mikasika ny asany. Ny Antokondraharaha misahana ny Volamena no miandraikitra ny fizohiana arapitondran-draharaha ireo asan ny mpandraharaha amin ny sehatry ny volamena tahaka ny mpisivam-bolamena, ny mpanangona volamena, ny mpanao firavaka, ny tranombarotra momba ny volamena, laboratoara nankatoavina hametraka fitomboka. Ny fombafomba amin io fizohiana io dia hofaritana amin ny didy amampitsipika.

20 Andininy 42.- Ny Antokondraharaha misahana ny Volamena dia mandray sy mandinika ny fangatahana fankatoavana ataon ny tranombarotra momba ny volamena ary manome izany fankatoavana izany. Andininy 43.- Ny Antokondraharaha misahana ny Volamena dia manampy arateknika sy manofana ny mpisivam-bolamena mbamin ny Vondrom-bahoakam-paritra itsinjaram-pahefana, ahitana ny fandraisan anjaran ny Fitondrandraharahan ny Tale iraisam-paritry ny Minisitera misahana ny harena ankibon ny tany sy ireo Sampandraharaha anariahampahefana raha ilaina, amin ireto lafin-javatra ireto : a) ny fikarohana sy fitrandrahana ny volamena miaraka amin ny tain atsanga na tsia ; b) ireo fepetra momba ny aro voina sy ara -pahasalamana eo amin ny asa ; c) ny fiarovana ny tontolo iainana ; d) ny fanampiana ny Vondrom-bahoakam-paritra itsinjaram-pahefana amin ny famaritana ny làlam-pisivanam-bolamena ; ary e) ny paika arahina mba hahazoana ny Fahazoandàlana sy ny Fanomezandàlana momba ny harena ankibon ny tany. TOKO VI - NY AMIN NY FARITANY MIZAKA TENA Andininy 44.- Ho fampiharana ny voalazan ny andininy faha-3 vaovao amin ny Fehezandalàna mifehy ny harena ankibon ny tany, ny Faritany mizaka tena dia miandraikitra ireo anjara asa izay omen ny didy aman-dalàna manankery azy indrindra fa mikasika ny fitantanana sy ny fanaraha-maso araka ny fepetra ambaran ny Fehezandalàna mifehy ny harena ankibon ny tany azy. Hotendreny araka izany, ireo manampahefana eo amin ny faritany mahefa isanisany. Andininy 45.- Ny Faritany Mizaka tena dia miantoka, miaraka amin ny fiarahamiasan ireo Sampan-draharaha miankina amin ny departemanta misahana ny Filaminam-bahoaka, ny fanaraha-maso ny zava-mipoaka sy mitefoka tazonin ny olontsotra avy amin ny fari-piadidiany avy. Andininy 46.- Araka ny voalazan ny andininy faha-124 vaovao amin ny Fehezandalàna mifehy ny harena ankibon ny tany, ireo Manampahefana eo amin ny Faritany mizaka tena dia mirotsaka ho amin ny famahana olana am-pihavanana rehefa misy fangatahana tonga ao aminy, amin ny fitadiavana vahaolana amin ireo fifanolanana eo amin ny fifandraisana amin ny manodidina eo amin ny tompon ny Fahazoandàlana momba ny harena ankibon ny tany sy ny tompon ny tany na ny mponina eny an-toerana. Rehefa nangatahin izay mailaka amin ny mpiady izy ireo, dia manana, ho fampiharana ny voalazan ny andininy faha amin izany Fehezandalàna mifehy ny harena ankibon ny tany, folo (10) andro fiasana izy aorian ny nandraisany ny fangatahana an-tsoratra avy amin ny izay amin ny mpiady ka napetraka tao amin ny biraon ny Faritany mizaka tena voakasik izany, mba handraisany fanapahan-kevitra. Izay fifanarahana hita dia mihatra amin ny mpiady.

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA TATITRA ANIVON NY ANTENIMIERAM- PIRENENA Praiminisitra Jean RAVELONARIVO 1 TATITRA MANOLOANA NY ANTENIMIERA I 21 MAY 2015 21 MAY 2015 Andininy 54.- Ny Filohan ny Repoblika no manendry ny Praiminisitra

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar HUMBOLDT-UNIVERSITÄT ZU BERLIN Landwirtschaftlich-Gärtnerische Fakultät Schriftenreihe des Seminars für Ländliche Entwicklung VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

Plus en détail

Évaluation de l impact environnemental et social

Évaluation de l impact environnemental et social RÉPUBLIQUE DE MADAGASCAR Tanindrazana - Fahafahana - Fandrosoana PRÉSIDENCE PROJET PÔLE INTÉGRÉS DE CROISSANCE Secrétariat National Évaluation de l impact environnemental et social Cadre de politique de

Plus en détail

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY MINISTERAN NY FAMBOLENA NY FIOMPIANA ARY NY JONO ----------------------------------- REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana ---------------------------------- MINISTERAN NY TOEKARENA

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

DISPOSITIONS COMMUNES

DISPOSITIONS COMMUNES ORDONNANCE N 62-074 du 29 SEPTEMBRE 19 62 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics. ( J.O. n 248 du 12.10.62 p. 2248 ) modifiée et complétée

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

46 Ordonnance n 62-074 du 29 septembre 1962

46 Ordonnance n 62-074 du 29 septembre 1962 Ordonnance n 62-074 du 29 septembre 1962 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics (J.O. n 248 du 12.10.62, p. 2248), modifiée et complétée par

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Ventin-kevitra Matoan-dahatsoratra Fampahafantarana an i Madagasikara 4 Ny Nosy Telma, mpandraharaha nasionaly manara-penitra iraisam-pirenena

Plus en détail

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA Public Disclosure Authorized a REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana JIRAMA JIRO SY RANO MALAGASY E1 403 VOL. 1 Public Disclosure Authorized Public Disclosure Authorized ÉVALUATION

Plus en détail

PROJET DE LOI N 027/2007

PROJET DE LOI N 027/2007 REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PROJET DE LOI N 027/2007 DU 25 OCTOBRE 2007 PORTANT LOI DE FINANCES POUR 2008 IMPRIMERIE NATIONALE 2007 - 2 - PROJET DE LOI N 027/2007 PORTANT

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville

SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville TOERANA ALEHA FIAINGANA ZOTRA RAISINA DESTINATION DEPART TANA LIGNE A PRENDRE A Ambohitrapeto Isotry D Itaosy Itaosy

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

d une solution malgachomalgache

d une solution malgachomalgache cyan magenta jaune noir PROGRAMME P.7 ECONOMIE TRANSITOIRE FANANAN-TANY DECHETS URBAINS Interventionnisme critiqué BIRAO FOTOTRA A VALORISER L inaccessibilité aux intrants notamment aux engrais induit

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent cyan magenta jaune noir PROGRAMME P.7 RENCONTRE DE VONTOVORONA POSSIBLE ECHEC Les partis et associations de GRATUIT QUOTIDIEN D INFORMATION N 0137 DU Mercredi 25 Août 2010 FIARAHAMONINA HADIHADIANA NY

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

LALANA LAHARANA FAHA2005-029

LALANA LAHARANA FAHA2005-029 REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA LALANA LAHARANA FAHA2005-029 TAMIN NY 29 DESAMBRE 2005 MOMBA NY LALANA MIFEHY NY FITANTANAM-BOLAM-PANJAKANA AMIN NY

Plus en détail

FANILO MIAMPITA. TÉLÉPHONIE FIXE La honte. Encore sous le monopole Après le drame libanais, voilà que resurgit

FANILO MIAMPITA. TÉLÉPHONIE FIXE La honte. Encore sous le monopole Après le drame libanais, voilà que resurgit cyan magenta jaune noir PROGRAMME P.7 L accès sans peine à l information QUOTIDIEN D INFORMATION GRATUIT N 080 DU Vendredi 18 Juin 2010 AFFAIRE LILA FANILO MIAMPITA TÉLÉPHONIE FIXE La honte TONGA NY ORA

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

MpANAMORY RAdO RABARILALA

MpANAMORY RAdO RABARILALA ENIM-BOLANA TSY TAFATSANGANA FANJAITRA MIISA 21 NO NESORINA TAO AN-KIBON i LALAINA P.06 N 3190 L u n d i 2 9 j u i n 2 0 1 5 PRIX : Ar 400 zatovolahy NANGALATRA volamena P.06 TENY AM-pASANA : NANONOFY

Plus en détail

LANY TAMINGANA ETO AMINTSIKA

LANY TAMINGANA ETO AMINTSIKA cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN

Plus en détail

Noely 2009 Taom-baovao 2010

Noely 2009 Taom-baovao 2010 FMM Fiombonana Miara-mivavaka eto Münich. Noely 2009 Taom-baovao 2010 Fa Zaza no teraka ho antsika, Zazalahy no omena antsika, ary ny anarany atao hoe Mahagaga, Mpanolon-tsaina, Andriamanitra Mahery, Rain

Plus en détail

AMBATONAKANGA SY NY MISIONERA ;

AMBATONAKANGA SY NY MISIONERA ; AMBATONAKANGA SY NY MISIONERA ; Raha miteny hoe Ambatonakanga isika protestanta amin izao andro ankehitriny izao dia ny trano fiangonana vita amin ny vato no tonga ao an-tsaintsika voalohany ary vitsy

Plus en détail