FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

Dimension: px
Commencer à balayer dès la page:

Download "FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014"

Transcription

1 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TAHARANA FAHA.8 Fivoriana faha-8 Natao ny Talata 25 FebroarV Tolak'andro -

2 FOTOPOTOTRY NY FIVORIANA Natao ny Talata 25 Febroary Tolak andro - Pejy - Fitohizan ny fivoriana 01 - Famelabelaran-kevitra mikasika ny fifidianana Fiatoan ny fivoriana Fitohizan ny fivoriana 12 - Fandraisana fanapahan-kevitra amin ny hanaovana tsangan-tanana ny fifidianana ireo Filohan ny Vaomiera Fifidianana ireo Filohan ny Vaomiera Maharitra sy ny Mpampakateny Jeneralin ny Vaomieran ny Vola 13 - Fifidianana ny Filohan ny Commission des Finances et du Budget» 14 - Fifidianana ny Filohan ny Commission Juridique Fifidianana ny Filohan ny «Commission des Affaires Etrangères et Relations Internationales» Fifidianana ny Filohan ny «Commission de la Décentralisation» Fifidianana ny Filohan ny «Commission de la Défense Nationale» 16 - Fifidianana ny Filohan ny «Commission de l Aménagement du Territoire et de la Gestion Foncière» 16 - Fifidianana ny Filohan ny «Commission des Travaux Publics» Fifidianana ny Filohan ny «Commission de l Industrie, du Commerce et du Secteur Privé» Fifidianana ny Filohan ny «Commission de la Culture et du Patrimoine» Fifidianana ny Filohan ny «Commission du Tourisme et de l Artisanat» 18 - Fifidianana ny Filohan ny «Commission du Développement Rural». 19

3 - Fifidianana ny Filohan ny «Commission des Eaux et Forêt et de l Environnement» Fifidianana ny Filohan ny «Commission de l Energie, des Mines et des Hydrocarbures» Fifidianana ny Filohan ny «Commission de la Communication, des Télécommunications, des Postes et des Nouvelles Technologies» 20 - Fifidianana ny Filohan ny «Commission des Transports et de la Météorologie» Fifidianana ny Filohan ny «Commission de l Education Nationale et de la Formation Professionnelle» Fifidianana ny Filohan ny «Commission de la Jeunesse, de l Entrepreneuriat et des Loisirs» Fifidianana ny Filohan ny «Commission des Sports» 22 - Fifidianana ny Filohan ny «Commission de l Enseignement Supérieur» 22 - Fifidianana ny Filohan ny «Commission de la Santé Publique» 22 - Fifidianana ny Filohan ny «Commission de la Population et des Affaires Sociales» Fifidianana ny Filohan ny «Commission de la Fonction Publique, du Travail et des Lois Sociales» 23 - Fifidianana ny Filohan ny «Commission de la Sécurité Intérieure» Fifidianana ny Filohan ny «Commission Genre et Développement» 24 - Fifidianana ny Filohan ny «Commission de la Pêche et des Ressources Halieutiques» Fifidianana ny Filohan ny «Commission de l Intérieur et de la Gestion des Risques et Catastrophes».25 - Fifidianana ny «Rapporteur Général de la Commission des Finances et du Budget» Fiatoan ny fivoriana... 26

4 1 FIVORIAMBE FILOHA: Ramatoa RAZANAMAHASOA Christine Harijaona MPITANTSORATRA: - - Ramatoa RAHELIHANTA Jocelyne. FANDAHARAM-POTOANA: Fifidianana ny ho Filohan ny Vaomiera Maharitra sy ny Mpampakateny Jeneralin ny Vaomieran ny Fitantanam-bola sy ny Tetibola. FOTOANA: Talata 25 Febroary 2014, tamin ny 4 ora sy 50 minitra, tolak andro Fitohizan ny fivoriana- - Lakolosy - Tompokolahy sy Tompokovavy, mitohy ny fivoriantsika. Mikasika ny fifidianana, efa vita daholo ve ny «candidature», aiza ny dossier»? Misy fanamarihana kely, alohan ny hirosoantsika amin ny fifidianana. Voalohany indrindra aloha, mangataka an-dramatoa Filoha Lefitra na Andriamatoa Filoha Lefitra, atao haingankaingana, hiantso ny anaran ireo Solombavabahoaka tonga manatrika eto. Misy satroka. Andriamatoa RANDRIANASOLO Jean Nicolas Efa vita tamin ny maraina anie ny «appel» ka tsy tokony hasiana «appel» intsony izao, satria efa nahafeno «quorum» isika. Raha ohatra isika miverina amin izay, tsy mety intsony izany. Misaotra, Tompoko.

5 Famelabelaran-kevitra mikasika ny fifidianana - Tonga dia miroso avy hatrany amin ny famelabelaran-kevitra izany isika? Alohan ny hirotsahana amin izay asa tokony atao amin ny fifidianana dia eo amin ny famelabelaran-kevitra aloha izao. Sao dia misy manana hambara, alohan ny hirosoana. Manao satroka ny Solombavambahoakan Antalaha. Andriamatoa LAISOA Jean Pierre. Andriamatoa LAISOA Jean Pierre Misaotra betsaka, nanome ny fitenenana, Ramatoa Filoha. Araka ny resatsika mianadahy teo moa dia misy hafatra nampitondraina ahy, ho an ilay namana sasany izay tsy eto. Ka raha ohatra eken ny Solombavambahoaka namana sasany dia te-hangata-dalana aho, hamita an izay hafatra izay, Ramatoa Filoha, raha ohatra ka eken ny rehetra. Fangatahana ny ahy, amin ny maha Zoky Raiamandreny ato dia misy hafatra nampitainy tamiko, nifampidinihanay mianadahy tao, dia nanome toky azy moa izaho fa hanatontosa an izay, ka izay no angatahako amintsika rehetra. Azafady indrindra, omenareo làlana ve izy hitondra an ilay hafatra? Sa hanangan-tanana koa isika eto? Hanangan-tanana hoe homena sa tsy homena? Izao moa no ambara amintsika eto, izany hoe izy no hitondra hafatra amin izay alehany any, satria nisy nandrotsaka koa ireo, nandrotsaka hofidina ho amin ny Vaomiera ireo olona ireo. Manana an izay zo hirotsaka izay ihany koa izy. Izay no mahatonga ahy eto mijery ny tokony hisian ny égalité de traitement, ka atsipy aminareo ny hevitra, dia anjaranareo ny milaza hoe, izao no eritreritray amin ilay izy. Misy Solombavambahoaka manao satroka. Solombavambahoakan i Tsiroanomandidy. Andriamatoa RAMAHERIJAONA Hajanirina Lanto Marina fa manan-jo hirotsaka tokoa izy ireo, kanefa tsy hitako ny hiandrasana azy, fa rehefa tsy tonga eo izy dia efa tsy vonona amin ny fifidianana angamba. Manaraka izay, eo amin ny mode de scrutin, Ramatoa Filoha, no eritreretinay, ary sosokevitra ihany. «Candidat unique» no ankabeazany ao, afa tsy ny ao amin ny «Commission Juridique» ihany, ka azo atao tsara, tsy voafetra ao anatin ny Règlement Intérieur mihitsy hoe tsy

6 3 maintsy atao amin ny latsa-bato miafina io, fa rehefa tapa-kevitra isika dia aleo atao antsangan-tanana io mba ho haingana. Tsy hitako! Isika aza tsy matoky antsika, aiza moa no hatokisan ny olona antsika? Tsy misy procedure mihitsy hoe atao latsa-bato miafina io. Efa Solombavambahoaka ihany izahay taloha, fa ny fifidianana Filohan ny Vaomiera tsy voatery ho latsa-bato miafina, Tompoko. Satroka, ny Solombavambahoaka MAHARANTE Jean de Dieu. Andriamatoa MAHARANTE Rakotonandrasana Jean de Dieu Mikasika ny voalazan ny namana teo, manamafy an izay, raha ohatra ka eken ny rehetra. Ataoko hoe manamora zavatra izany tsangan-tanana izany, satria araka ny pratique parlementaire, ny Président de Commission tsy voatery handalo vote secret. Misaotra, Tompoko. Misy fangatahana fandraisana fitenenana? Ny Solombavambahoakan i Sakaraha; rehefa avy eo ny Solombavambahoakan i Moramanga. Andriamatoa RAHAROARILALA Tinoka Roberto Isika namana rehetra. Misy resaky ny olobe teo napetrany amintsika. Resak olon-dehibe napetraka amintsika hoe, manao akory fa izahay manam-paniriana ihany koa ny hiaraka aminareo. Sao dia tonga namana isika vao mavomavo, ka mangataka izahay, Andriamatoa Coordonateur, mangataka izahay mba tokony hodinihantsika izay resaky ny longontsika teo izay, fa resaky ny olobe izay, mifono zavatra be dia be koa. Sao dia mba hahasoa antsika izay, kanefa isika hiraparapa ihany hiroso amin ity zavatra atao ity. Izaho izany mba mangataka am-pahendrena antsika mianakavy mba handinika an izay zavatra izay. Misaotra, Tompoko. Misy handray fitenenena? Satroka. Ny Solombavambahoakan i Moramanga aloha no nanangan-tanana talohanao.

7 4 Andriamatoa RANDRIAMAHEFA Henri Charles Izaho izany te-hametraka fanontaniana amin Andriamatoa Sekretera Jeneraly, mikasika ny lalàna mifehy ny fifidianana. Marina fa «pratique» ilay tsangan-tanana, fa sao dia mitaky «vote secret» ny lalàna ka manjary diso «procédure» dia ho afa-baraka eto isika. Ny ahy izany, zavatra ara-dalàna ihany no tokony hivoaka eto. Mahakasika an izay, valiana avy hatrany. Ny article 12 sy article 13 ao amin ny Règlement Intérieur no milaza ny fandatsaham-bato mahakasika ny élection. «Article 13 : Le Président, les Vice-présidents et les Questeurs sont élus au scrutin secret uninominal à un tour..» Fa ny sisa tsy nilaza an izay. Ny «article 41» tsy nilaza an izay. Ireo izany no atao «vote secret», dia ny «Président», «Vice-présidents» ary ny «Questeurs». Mandray fitenenana ny Solombavambahoaka avy any Mahanoro, NAHARIMAMY Lucien Irmah. Ramatoa NAHARIMAMY Lucien Irmah Misaotra, Ramatoa Filoha nanome ny fitenenana. Ny slogan -tsika dia samy mahafantatra isika hoe, «ny Fitiavana no lehibe indrindra». Manamafy ny tenin ny Filoha Lefitry ny Faritanin i Toliara teo aho, tsy sanatria isika hanao ranon Ikopa ka tonga namana vao mavomavo. Raisintsika an-tanandroa ny havantsika izay vonona hiara-dia amintsika. Koa mangataka mba hitovy ny hevitsika manoloana an izay. Misaotra, Tompoko. Ny Solombavambahoaka laharana faha-36, avy any Antsiranana voalohany. Andriamatoa NASSER Ahmed Azafady amintsika namana Solombavambahoaka rehetra, hoatran ny mitongilana ny fitondrana antsika ato amin ny Antenimierampirenena. Rahatoa ka mety, Ramatoa Filoha, aleo présent eo ny namantsika rehetra, izay vao arosontsika ny fifidianana, satria efa nanao isika teo, izay danin ny kibo nataontsika, ka azontsika daholo ny Bureau Permanent. Izao hifidy Filohan ny Vaomiera isika. Ianareo izay hilatsaka ho Filohan ny Vaomiera tsirairay, tianareo ny hanaovana ny fifidianana androany, satria hirehareha ianareo efa tafiditra ho Filohan ny Vaomiera izao na izao.

8 5 Maro anefa isika ato, ka mba hampandeha ny raharahantsika ato anatin ity tokantrano ity, aoka isika rehetra mba samy eo, izany hoe, eo ny namantsika vao aroso ny fifidianana. Izay ny fiangaviako aloha. Mba hampety zavatra ny antony itenenako an izany. Aoka isika mba samy handinika. Misaotra anao. Solombavambahoakan i Mandritsara. Andriamatoa RAJAOZANANY Jean Claude Misaotra, Ramatoa Filoha, nanome ny fitenenana. Miombon-kevitra amin ny Filoha Lefitr i Toliara sy Toamasina teo aho, satria ilaina ny miaraka amin ny namana. Raha misy ny afaka amin ny fiarahana, afaka mifanampy amin ity zavatra ity, hanatanterahantsika an-tsakany sy an-davany ny zavatra rehetra atao ato, mangataka aho, mba ajanony aloha mba hifampiresaka. Mba miangavy indrindra, Tompoko. Satroka ho an ny Solombavambahoakan i Soavinandriana. Andriamatoa HARINOSY Rabenerika Charlot Misaotra betsaka, Ramatoa Filoha, nanome ny fitenenana. Marina tokoa ny resaka nataon ny namana rehetra teo. Tsy hoe tonga namana akory isika vao ho mavomavo. Ilay namantsika efa tonga teo, nilaza hiverina izy, hitondra hevitra. Ka inona marina ilay hevitra hoentin-dry zareo mba ho fantatra eto. Hiaraka amintsika ve izy hiady hevitra amin ity zavatra ity? Dia rahoviana? Sao ho lany fotoana eto indray isika fa tsy fantatra mihitsy. Ka mba mangataka ny. Efa lasa izy? Tsy fantatray ilay zavatra. Izahay eto miandry, miandry, tsy fantatray ilay zavatra. Ka inona àry? Aleo mba am-pahibemaso, ankarihary eto no miresaka, ka rehefa lanin ny besinimaro, ekena anie izany, tsy maninona! Misaotra, Tompoko. Solombavambahoakan Antananarivo Atsimondrano.

9 6 Andriamatoa RANDRIARIMALALA Harijaona Misaotra, Ramatoa Filoha, nanome ny fitenenana. Sosokevitra ihany ity. Isika anie efa matoky fa isika tsy maintsy lany foana e! Isika efa maro an isa ato. Ka izao ilay izy: efa ao ve ry zareo rehetra vonona hilatsaka? Raha eo izy ao anatin ny 10 minitra, ampandrosointsika izy, mametraka «candidature». Lany foana isika, fa sosokevitra ny ahy iny. Raha ohatra moa hihemotra rahampitso kosa ilay izy, tsy mety izay. Sosokevitra ny ahy iny, dia iarahantsika mijery eo. Satroka, Solombavambahoaka TODY Arnaud. Andriamatoa TODY Arnaud Ny tena mahagaga ahy, ilay olona teo, tsy navelantsika niresaka. Maninona izy no tsy navelantsika niresaka teto? Entintsika mivoaka mangingina ery izy, tsy fantatra inona ny zavatra resahin izy ireo any. Ny Coordonnateur -n ny MAPAR lasa any. Naninona raha nitondra Coordonnateur -n ny GPS koa nivoaka niaraka tany? Ny zavatra tokony nataontsika teto dia navelantsika niresaka izy, henon ny be sy ny maro ny zavatra noresahiny, tsy manao fausse interpretation amin izay eritreriny isika, fa olona iray na roa no mivoaka miaraka aminy any. Tsy d accord amin izany izahay, tonga dia efa ambaranay eto izay. Naninona izy no tsy navelantsika niresaka teto? Maninona izy entina mivoaka mangingina? Maninona ny GPS tsy nentina niaraka tany? Tsy tokony handeha any ny Coordonnateur -n ny GPS, satria tsy nantsoina handeha any. Miangavy ny Coordonnateur -n ny GPS hiverina izahay. Miangavy ny Coordonnateur -n ny GPS tsy hivoaka any. Efa tsy nentinareo izahay nandeha tany, dia mbola ho sahinareo milaza fa miaraka isika? - Lakolosy - Maninona izahay tsy nentinareo nandeha any? Satroka, ny Solombavambahoaka avy amin ny Boriboritany faha-vi, Ramatoa RAHERISOA Vololona. Ramatoa RAHERISOA Vololona Victorine Misaotra indrindra, Ramatoa Filoha, nanome ny fitenenana. Sintomina kely ny saintsika rehetra, azafady indrindra, Tompoko, amin ilay adihevitra. Tsy raharahan Antoko anankiray na roa ity fa ato anatin ny Lapan ny Demokrasia isika. Séance plénière ity ataontsika ity, ka samia mba mieritreritra kely, Tompoko, amin ilay zavatra teneniny ny tsirairay, sy ny adihevitra avoakantsika eto. Tena satroka ny ahy izay.

10 7 Misaotra, Tompoko. Misaotra anao. Satroka, ny Solombavambahoaka RANDRIANASOLO Jean Nicolas. Andriamatoa RANDRIANASOLO Jean Nicolas Misaotra, Ramatoa Filoha, nanome ny fitenenana. Efa manomboka misy ilay tsy fitovian-kevitra amin izao ka aoka mba samy ho mailo isika. Efa niresaka teo ny Cordonnateur -ntsika. Mitodika aminao izaho, Rahalahy, aza ampidirana resaka maro izy ity. Koa iangaviako, RamatoaFiloha, mba miandry an ireto isika, tsy fantatro na manao akory na manao akory, fa raha isika hiady hevitra amin ny zavatra be dia be, manjary mikorontana eto isika. Misaotra, RamatoaFiloha. Satroka, ny Solombavambahoaka laharana faha-115 Andriamatoa RATEFIARIVONY Jaona Isika angamba tokony hiverina kely amin ny hoe, ahoana moa no nahatongantsika amin izao ora izao. Taorian ny évènement niseho tamin ny maraina dia nisy tsangan-tanana natao teto hoe, hiroso ve isika sa tsy hiroso. Ny fanapahan-kevitra dia hoe, miroso amin izao procédure hifidianana sy hametrahana ny Filohan ny Vaomiera izao isika. Efa tonga amin izao ora izao indray isika ve hihemotra indray? Koa mangataka, Ramatoa Filoha, aleo hirosoana ilay zavatra efa nomanina hotanterahina ary efa notapahana tamin ny maraina; efa vonona ihany koa ireo ny bulletin unique, asa raha hanao tsangan-tanana isika na ho ao amin ny isoloir, hasiana ve ilay propagande sa tsy hasiana. Satroka, ny Solombavambahoakan i Moramanga. Andriamatoa RANDRIAMAHEFA Henri Charles Marina fa namana Andriamatoa LAISOA Jean Pierre. Namantsika izy, raha izao fihetsika ataony izao. Izaho anefa, Ramatoa Filoha, miombon-kevitra amin ilay namana niteny farany teo. Tokony hiroso isika. Izao ny antony: marina fa tsara ny fifandaminana, fa mety

11 8 hampikorotan-javatra, mety hampikorontana antsika ilay izy. Raha ohatra hoe esorina ity, esorina ity, tsy iry indray fa ity indray izao, ho rava isika. Manahy aho, ka alefaso ny fifidianana, araka ny lamina napetraka. Raha misy resaka hafa any ambonimbony any dia milaza amintsika izy hoe izao no tapaka any ambony any. Koa tokony handeha ny vote. Efa hatramin ny maraina isika no teto, efa amin ny 5 ora sy 10 minitra izao. Izaho manahy, raha ohatra ka misy mikorontana io commission io, hoe tsy izy indray ity, mety isika ato indray no hikorontana. Izay no teny ataoko, Ramatoa Filoha. Raha ny hevitro dia miroso amin ny fifidianana araka izay efa nanapahantsika azy isika. Manao satroka, Ramatoa RAHANTANIRINA Lalao, avy any Mahajanga Ramatoa RAHANTANIRINA Lalao Mamerina ny fiarahabana antsika Solombavambahoaka rehetra ato amin ity Lapan ny Demokrasia ity. Raha azo atao, Ramatoa Filoha, mangataka fitsaharana kely, mba mifanatona kely isika rehetra, raha azo atao. Ny GPS sy ny MAPAR no tiako tenenina amin izay. Misaotra, Tompoko. Misaotra ny Solombavambahoaka namana. Misy satroka nataon Andriamatoa TODY Arnaud. Andriamatoa TODY Arnaud Miangavy izahay, Ramatoa Filoha, hanao tsangan-tanana isika, hifidy sa tsy hifidy, fa izahay GPS rehetra efa vonona hifidy daholo izao. Efa vonona izahay. Mangataka fiatoana ny Solombavambahoaka RAHANTANIRINA Lalao. Manangan-tanana ihany koa ny Solombavambahoaka HELSON Brisson Erafa.

12 9 Andriamatoa HELSON Brisson Erafa Misaotra, Ramatoa Filoha, nanome ny fitenenana. Raharaham-pirenena no ataontsika eto. Efa nilaza isika fa amin ny 2 ora no mikatona ny dépôt de candidature ; amin ny 3 ora no manomboka ny fampielezan-kevitry ny tsirairay izay hilatsaka. Tsy hoe manosibohon-tanana ny Raiamandreny Solombavambahoakan Antalaha teo, fa tsy nolazainy ny tena votoatin ny zavatra tokony ho tenenina fa aleo any mangingina any. Tsy hiverina amin iny aho, fa izahay GPS dia tsy hivoaka intsony ary tsy hisintona izany, fa mangataka ny hirosoan ny fifidianana, satria matoa eto isika nanomboka tamin ny maraina, tsy nanosibohon-tanana ny sasany nivoaka, fa nandeha nivoaka hanao conférence de presse miaraka amin Andriamatoa JULES Etienne izy. Ka ho andrasantsika eto ve izay hetahetan-dreo izay? Ny hetahetan olona, hoy ny fitenenana izay, tsy hihinanam-boay antena. Noho izany, Ramatoa Filoha, mangataka izahay ny hirosoan ny fifidianana tsy misy hatak andro. Misaotra, Tompoko. Misaotra ny Solombavambahoaka HELSON Brisson Erafa Efa nanao tsangan-tanana isika teto aninkeheo maraina amin ny hirosoana amin ny fifidianana, satria feno ny quorum. Tsy hiverenana intsony ny tsangan-tanana izay natao, satria nanangan-tanana daholo isika rehetra tato, ka heveriko fa mba hirosoana amin ity raharaha ity dia tsy hiverenana intsony ny tsangan-tanana izay efa natao tamin ny maraina. Efa misy nametraka candidature ny Solombavambahoaka tato. Ny Solombavambahoaka izay nivoaka, mety nisy nanana intention izy ireny, kanefa moa nisafidy ny hivoaka izy. Rehefa natao ny fiantsoana anarana dia maro ny Solombavambahoaka tonga teto, ka isika rehetra izay tafajanona ato dia efa mahafeno ny quorum, satria efa ny antsasa-manila. Tsy hisy intsony angamba ny satroka, fa ny nahatonga ny fangatahan ireo Solombavambahoaka sasantsasany amintsika dia nisy zava-baovao tonga teo. Ka tokony hiditra ato an-trano daholo ny rehetra mba ahafahantsika miroso. Angamba tsy misy satroka intsony, fa ireo namana izay any ivelany, na avy aiza izy na firehana aiza dia tokony hiditra daholo. Andriamatoa Solombavambahoakan i Soalala. Andriamatoa HOUSSEN Abdallah Izany hoe, miala tsiny raha ohatra mbola hamoaka terme juridique indray, sao dia ataon ny olona manao étalage eto. Misy fitenintsika ao amin ny Fitsarana manao hoe, nul ne peut se prévaloir de sa propre turpitude.

13 10 Tsy isika no nandroaka azy ireo fa ry zareo no niala e! Isika koa teo efa nilaza tamin izy ireo hoe, tokony nandrasany aloha ny valin ny fanontaniana napetrak izy ireo. Raha ohatra ka nanao tsia isika izay ry zareo vao nandeha, azo eritreretina angamba izay. Fa raha ny tokony ho izy, amin izay fahadisoan izy ireo izay, izay turpitude -n izy ireo izay, rahampitso na afak ampitso dia izay no tsy hanasian izy ireo fotony antsika amin ity efitrano ity, mety hilaza izy ireo hoe, ireny anie efa nataonay toy izao kanefa nandefitra ihany. Izay izany no lafiny ilazako hoe, tokony hieritreritra tsara ihany isika. Ny andaniny anefa, ity Assemblée nationale ity, raha ohatra ka atao io fifidianana io amin ilay atao hoe penalty nomena antsika ity, anefa isika mampiditra baolina ihany no sarotiny, ho tafiditsika na tsy ho tafiditsika. Izany hoe, tsy eo ny aspect maha Lapan ny Demokrasia amin ny tokony hisian ny contradiction amin ny hevitra avy amin ny an-daniny sy ny an-kilany. Koa izaho mihevitra fa tsara ilay fangatahana pause, ahafahantsika mifandinika tsara hoe inona marina no tokony ataontsika, alohan ny handraisantsika fanapahan-kevitra hentitra mikasika ny raharaham-pirenena. Andaniny, sao dia rahampitso na rafak ampitso ataony hoe malemy isika, nialanay kely dia efa nitabataba, natao hoe averina dia nanaiky. Ankilany, Ramatoa Filoha, ny mission nomena ny Solombavambahoaka teo dia zavatra aléatoire. Tsy fantatra na ho mety na tsia. Izay daholo no risque, ka mety ny fisintahana kely ahafahantsika mandinika. Homena fepotoana izy ireo hoe hatramin ny firy. Raha telo andro ireo tsy tonga eto dia azy ny azy. Izay izany ny ahy, Ramatoa Filoha, fa dia misaotra, Tompoko. Misaotra anao, Andriamatoa Solombavambahoaka. Nisy nangataka fiatoana moa ka miato kely 10 minitra dia miverina eto isika. Nanao satroka ny Solombavambahoaka RANDRIANARISOA née RAMAHATODISOLOMANANA Vaonalaroy. Ramatoa RANDRIANARISOA née RAMAHATODISOLOMANANA Vaonalaroy Miala tsiny, Ramatoa Filoha. Miala tsiny amintsika Solombavambahoaka namana, tsy sanatria akory manohitra ilay fangatahana fiatoana izahay, fa izahay kosa manahy sao misy hevitra ambadika indray ity fiatoana kely 10 minitra ity. Ka raha tsy dia zavatra lehibe manao ahoana loatra no anton ny fiatoana fa hampidirana ny namana avy any ivelany, miangavy izahay, aleo hitohy ny asa ataontsika eto fa fandrebirebena be loatra izany ka tsy mety aminay, Ramatoa Filoha. Azafady, omena anao ny fitenenana, Solombavambahoaka RAHOLIDINA RANAIVO Herinantsoina.

14 11 Andriamatoa RAHOLIDINA RANAIVO Herinantsoina Ary miala tsiny raha mandroso ety anoloana aho fa ato anaty tanana be ato ka tsy ifanomezan-tsiny raha takona. Miala tsiny izahay, Ramatoa Filoha. Efa niandry teto izahay hatramin ny maraina mandrapaharivan ny andro. Solombavambahoaka mitovy daholo isika rehetra ato, ary nofidiambahoaka izahay, ka miala tsiny izahay, miala fondro, miala salohy fito fa tratran ny fandriky ny nivoaka io. Hivoaka indray izahay rahampitso, dia tadiavina any Analakely, sa ho tadiavina any amin ny V ème Arrondissement? Ataovy ny fifidianana. Izahay miangavy an izay. Toherinay izany miatoato izany. Ataovy ny fifidianana, fa rehefa tsy tonga izy, azy ny azy. Ny fihavanana amin ny Raiamandreny teo, ekeko. Mpampihavana aho taloha, mpikabary aho vao nanao politika, fa amin ny manaraka azo hihavanana aminy foana io. Izahay mipetraka eto adiny efatra, tsy mihinan-kanina, avy eo ilay olona taitaitra any ambadibadika any, dia tonga. Miala tsiny izahay, mangataka izahay, ataovy ny fifidianana, izay lany dia lany, izay tsy lany dia tsy lany, fa izahay tsy hiandry an i Paoly hametaka lakaoly. Misy satroka iray. Andriamatoa RATEFIARIVONY Jaona Mba miangavy, Ramatoa Filoha, raha manao satroka izahay mba jereo ihany, fa efa hatramin ny andro lasa maro angamba izay, tsy mahazo fitenenana mihitsy izahay ato, anefa Lapan ny Demokrasia ny ato, araka ny notenenin ny namana teo. Izaho te-hampatsiahy foana fa isika efa nomena malalaka, efa nomena fahafaham-po, kanefa isika ihany koa no sahala amin ny mifanipaka an-karona. Inona ihany koa no hangatahana hivoaka kely aloha. Raha amiko, misy zavatra tiana hampidirina ambadika angamba any, amiko manokana. Efa isika samy isika izao, mbola misy tsy fitovian-kevitra ihany. Isika ato samy olon-dehibe daholo ary tsy hanao kilalaon-jaza ka hangataka fiatoana isaky ny kelikely. Izay sy izay ny ahy, harosoy ny fifidianana, satria hitako izao fa ny anay GPS ihany no misy adversaire, fa izahay tsy matahotra ny adversaire izay hifanandrina aminay. Misaotra anao, Tompoko Fiatoan ny fivoriana Efa nekena fa haroso ny fifidianana. Nekena ihany koa anefa ny fiatoana, fa 10 minitra ihany. Fa ny fifidianana dia hiroso, satria efa lany izay tamin ny tsangan-tanana tamin ny maraina. 10 minitra ihany. Niato tamin ny 5 ora sy 20 minitra, hariva, ny fivoriana.

15 Fitohizan ny fivoriana - Nitohy tamin ny 6 ora sy 40 minitra, hariva, indray ny fivoriana. Tompokolahy sy Tompokovavy, naato izy teo noho ny fangatahan Andriamatoa «Coordonnateur Général»-n ny MAPAR sy ny Solombavambahoakan i Mahajanga. Hiroso amin ny fandaharam-potoana amin izao tolak andron ny Talata faha-25 Febroary 2014 izao isika, izay fivoriambe hanaovana ny fifidianana ny ho Filohan ny Vaomiera Maharitra sy ny Mpampakateny Jeneralin ny Vaomieran ny Fitantanam-bola sy ny Tetibola. Alohan ny hirosoana, sao dia mbola misy manana fitenenana. Tsy misy intsony! Raha tsy misy dia miroso isika. Araka ny tapaka tamin ny fivoriambe dia Vaomiera Maharitra miisa 27 no hapetraka eto amin ny Antenimierampirenena. Tapaka tao anatin io ihany koa fa ny Vaomieran ny Toekarena dia hatolotra ny Vondrona mpanohitra; noho izany dia ireo Filohan ny Vaomiera miisa 26 sy ny Mpampakateny Jeneralin ny Vaomieran ny Fitantanam-bola no hofidintsika Fandraisana fanapahan-kevitra amin ny hanaovana tsangan-tanana ny fifidianana ireo Filohan ny Vaomiera Izao ary isika dia hiroso amin ny fifidianana ny Filohan ireo vaomiera ireo. Alohan izany, fanontaniana ihany, atao an-tsangan-tanana ve sa atao fifidianana miafina? Atsangano àry ny tanan izay mandany fa atao an-tsangan-tanana ny fifidianana. 37 sy 38 izany. Iza no mitsipaka? Iza no tsy milaza ny heviny? - Tsy misy - - Tsy misy - Atao an-tsangan-tanana izany ny fifidianana.

16 Fifidianana ireo Filohan ny Vaomiera Maharitra sy ny Mpampakateny Jeneralin ny Vaomieran ny Vola - Hatramin ny 2 ora tolak andro teo moa no fe-potoana farany nahafahana nandrotsaka ny filatsahan-kofidina, ka ireto avy ny mpilatsaka hofidina isaky ny Vaomiera tsirairay. Hovakina ny anaran ireo candidat, koa mangataka ny Filoha Lefitra hamaky azy. Ao amin ny «Commission des Finances et du Budget», Andriamatoa NDREMANJARY Paraina Odilon. Ao amin ny Commission Juridique, Andriamatoa isany: TODY Arnaud, RAZARANAINA Nomenirina. Ao amin ny Commission des Affaires Etrangères et des Relations Internationales, Ramatoa MASY GOULAMALY. Mbola manonona anarana fotsiny aho. Sa misy satroka? Sa alefa tsirairay? Satroka anankiroa no tazako, dia ny Solombavambahoaka NDAHIMANANJARA née RANDRIANARISON Benedicte Johanita sy ny Solombavambahoaka RAHANTANIRINA Lalao. Ramatoa NDAHIMANANJARA née RANDRIANARISON Benedicte Johanita Mba hahaingana antsika, raha ohatra ka azo atao dia tononina izay «candidat» amin ny Vaomiera anankiray, dia tonga dia atao ny tsangan-tanana. Misaotra, Tompoko. Misaotra ny Solombavambahoaka NDAHIMANANJARA née RANDRIANARISON Benedicte Johanita. Mbola ilaina ve ny fampielezan-kevitra sa tsia?

17 Fifidianana ny Filohan ny Commission des Finances et du Budget» - Hanangan-tanana izany isika mikasika ny Commission des Finances et du Budget», Andriamatoa NDREMANJARY Paraina Odilon. - Tehaka - Vato fotsy: 00 Vato azon ny Solombavambahoaka NDREMANJARY Paraina Odilon: 75 Koa dia ambarako fa lany ho Filohan ny Commission des Finances et du Budget, Andriamatoa NDREMANJARY Paraina Odilon. - Tehaka Fifidianana ny Filohan ny Commission Juridique - Manaraka, Commission Juridique, Andriamatoa TODY Arnaud. Andriamatoa RAZARANAINA Nomenirina, izay mifidy azy, atsangano ny Tanana. - Tsy misy - Vato azon Andriamatoa TODY Arnaud : 75. Tsy misy ny vato azon Andriamatoa RAZARANAINA Nomenirina. Ambarako fa lany ho Filohan ny Commission Juridique, Andriamatoa TODY Arnaud.

18 Fifidianana ny Filohan ny «Commission des Affaires Etrangères et Relations Internationales» - Manaraka, «Commission des Affaires Etrangères et Relations Internationales», Ramatoa MASY GOULAMALY. Vato fotsy sy vato maty : 00 Vato azon ny Solombavambahoaka MASY GOULAMALY: 75. Ambarako àry fa lany ho Filohan ny «Commission des Affaires Etrangères et Relations Internationales», Ramatoa MASY GOULAMALY Fifidianana ny Filohan ny «Commission de la Décentralisation» - «Commission de la Décentralisation», Ramatoa RANDRIANARISOA née RAMAHATODISOLOMANANA Vaonalaroy. Vato azon ny Solombavambahoaka RANDRIANARISOA née RAMAHATODISOLOMANANA Vaonalaroy: 75. Ambarako fa lany ho Filohan ny «Commission de la Décentralisation», Ramatoa RANDRIANARISOA née RAMAHATODISOLOMANANA Vaonalaroy. - Tehaka -

19 Fifidianana ny Filohan ny «Commission de la Défense Nationale» - «Commission de la Défense Nationale», Andriamatoa RANDRIANASOLO Jean Nicolas. Vato azon ny Solombavambahoaka RANDRIANASOLO Jean Nicolas: 75 Ambarako àry fa lany ho Filohan ny «Commission de la Défense Nationale», Andriamatoa RANDRIANASOLO Jean Nicolas. Miarahaba anao Fifidianana ny Filohan ny «Commission de l Aménagement du Territoire et de la Gestion Foncière» - «Commission de l Aménagement du Territoire et de la Gestion Foncière», Andriamatoa RAHOLDINA RANAIVO Herinantsoina. Nandatsa-bato: 75 Vato azon ny Solombavambahoaka RAHOLDINA RANAIVO Herinantsoina: 75 Ambarako fa lany ho Filohan ny Commission de l Aménagement du Territoire et de la Gestion Foncière», Andriamatoa RAHOLDINA RANAIVO Herinantsoina.

20 Fifidianana ny Filohan ny «Commission des Travaux Publics» - «Commission des Travaux Publics», Andriamatoa RASALAMA Léon. Vato azon ny Solombavambahoaka RASALAMA Léon: 75 Koa dia ambarako fa lany ho Filohan ny Commission des Travaux Publics, Andriamatoa RASALAMA Léon Fifidianana ny Filohan ny «Commission de l Industrie, du Commerce et du Secteur Privé» - «Commission de l Industrie, du Commerce et du Secteur Privé», Andriamatoa RANDRIARIMALALA Harijaona. Vato azon ny Solombavambahoaka RANDRIARIMALALA Harijaona: 75 Ambarako fa lany ho Filohan ny «Commission de l Industrie, du Commerce et du Secteur Privé», Andriamatoa RANDRIARIMALALA Harijaona.

21 Fifidianana ny Filohan ny «Commission de la Culture et du Patrimoine» - «Commission de la Culture et du Patrimoine», Andriamatoa RAJAOZANANY Jean Claude dit SA-YAH. Vato azon ny Solombavambahoaka RAJAOZANANY Jean Claude: 75 Ambarako fa lany ho Filohan ny «Commission de la Culture et du Patrimoine», Andriamatoa RAJAOZANANY Jean Claude dit SA-YAH Fifidianana ny Filohan ny «Commission du Tourisme et de l Artisanat» - «Commission du Tourisme et de l Artisanat», Andriamatoa RATSIMBAZAFY Luc. Vato azon ny Solombavambahoaka RATSIMBAZAFY Luc: 75 Ambarako fa lany ho Filohan ny «Commission du Tourisme et de l Artisanat», Andriamatoa RATSIMBAZAFY Luc.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

Conversations en ligne : descriptions, perspectives. Louise Ouvrard

Conversations en ligne : descriptions, perspectives. Louise Ouvrard Conversations en ligne : descriptions, perspectives Eléments théoriques La variation Quelques caractéristiques du discours électronique La langue malgache Le corpus Présentation Analyse Quels apports à

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

Noely 2009 Taom-baovao 2010

Noely 2009 Taom-baovao 2010 FMM Fiombonana Miara-mivavaka eto Münich. Noely 2009 Taom-baovao 2010 Fa Zaza no teraka ho antsika, Zazalahy no omena antsika, ary ny anarany atao hoe Mahagaga, Mpanolon-tsaina, Andriamanitra Mahery, Rain

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

Ny Vaovao Mahafaly. La Bonne Nouvelle

Ny Vaovao Mahafaly. La Bonne Nouvelle Ny Vaovao Mahafaly La Bonne Nouvelle Ary tamin ny fahenim-bolana dia nirahin Andriamanitra ny anjely Gabriela ho any an-tanàna anankiray any Galilia atao hoe Nazareta, ho any amin ny virijina anankiray,

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

LANY TAMINGANA ETO AMINTSIKA

LANY TAMINGANA ETO AMINTSIKA cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

JEAN-MARC CHÂTAIGNIER Défenseur de Joaquim Chissano

JEAN-MARC CHÂTAIGNIER Défenseur de Joaquim Chissano cyan magenta jaune noir PROGRAMME P.7 QUOTIDIEN GRATUIT D INFORMATION N 0103 DU Vendredi 16 Juillet 2010 L accès sans peine à l information OIF SOATOAVINA TRAFIC Soutien de la médiation internationale

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

ATRIKA Le journal de l ASMF

ATRIKA Le journal de l ASMF Association des Anciens du Collège St-Michel en France ATRIKA Le journal de l ASMF OCTOBRE 2010 ÉDITION : Octobre 2010, NUMÉRO 12 Éditorial 2010 ASMF bureau 2009/2010 Joël Rambatomanga(1990) Président

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES DEPARTEMENT INTERDISCIPLINAIRE DE FORMATION PROFESSIONNELLE COMMUNICATION ET DYNAMIQUE LOCALE RAPPORT

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

GLOTTOPOL Revue de sociolinguistique en ligne

GLOTTOPOL Revue de sociolinguistique en ligne GLOTTOPOL Revue de sociolinguistique en ligne N 2 Juillet 2003 Anciens et nouveaux plurilinguismes SOMMAIRE Introduction Premier chapitre : Les situations de plurilinguisme : aménagement et représentations

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

FINOANA SY FAHAZAVANA FOI ET LUMIERE

FINOANA SY FAHAZAVANA FOI ET LUMIERE FINOANA SY FAHAZAVANA FOI ET LUMIERE BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 Gazety avoakan ny Mpiaramivavaka Kristianina Malagasy eto Bénélux (M.K.M.B.) Bulletin de liaison et d information de la

Plus en détail

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. "Dieu qualifie ceux qui sont appelés", hoy Rakotolehibe Mamy, Talen ny FMMB

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. Dieu qualifie ceux qui sont appelés, hoy Rakotolehibe Mamy, Talen ny FMMB Taniketsa - Laharana faha 58 - Septambra 2014 1 Gazetin ny Sampana Sekoly Alahady FJKM Andrainarivo Taniketsa Miseho isan-telo volana. Laharana faha 58. Septambra 2014. Vidiny: 400 Ariary. Tranokala: www.sa-andrainarivo.mg

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

AMBATONAKANGA SY NY MISIONERA ;

AMBATONAKANGA SY NY MISIONERA ; AMBATONAKANGA SY NY MISIONERA ; Raha miteny hoe Ambatonakanga isika protestanta amin izao andro ankehitriny izao dia ny trano fiangonana vita amin ny vato no tonga ao an-tsaintsika voalohany ary vitsy

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

Février - mars 2016 n 47 TRAIT D UNION

Février - mars 2016 n 47 TRAIT D UNION Février - mars 2016 n 47 TRAIT D UNION Le journal en ligne de la RNS Train Manakara-Fianarantsoa Éditorial 2 Lyon et ses incontournables 3 La tribune du coordinateur 4 Itinéraire d un sportif gâté 5 Lalaina

Plus en détail

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE -----------------------

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- MINISTERE DES TRANSPORTS ET DE LA METEOROLOGIE -------------- RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- I. CONTEXTE Malgré

Plus en détail

EDITORIAL. Un bon projet ALAHADY 26 SEPTAMBRA 2010. Fanompoampivavahana voalohany amin ny taona 2010-2011.

EDITORIAL. Un bon projet ALAHADY 26 SEPTAMBRA 2010. Fanompoampivavahana voalohany amin ny taona 2010-2011. BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 1 - Septembre 2010 EDITORIAL Un bon projet Mensuel - Editeur Responsable:

Plus en détail

LE LIBERAL «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!»

LE LIBERAL «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» LE LIBERAL «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» Etat malgache VERS L ANNI- HILATION? Bimensuel n 06, vendredi 29 juin 2012 A USAGE UNIQUE DU PARTI LEADER FANILO. NE PEUT ETRE VENDU. Consultable

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

MpANAMORY RAdO RABARILALA

MpANAMORY RAdO RABARILALA ENIM-BOLANA TSY TAFATSANGANA FANJAITRA MIISA 21 NO NESORINA TAO AN-KIBON i LALAINA P.06 N 3190 L u n d i 2 9 j u i n 2 0 1 5 PRIX : Ar 400 zatovolahy NANGALATRA volamena P.06 TENY AM-pASANA : NANONOFY

Plus en détail

DISPOSITIONS COMMUNES

DISPOSITIONS COMMUNES ORDONNANCE N 62-074 du 29 SEPTEMBRE 19 62 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics. ( J.O. n 248 du 12.10.62 p. 2248 ) modifiée et complétée

Plus en détail

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent cyan magenta jaune noir PROGRAMME P.7 RENCONTRE DE VONTOVORONA POSSIBLE ECHEC Les partis et associations de GRATUIT QUOTIDIEN D INFORMATION N 0137 DU Mercredi 25 Août 2010 FIARAHAMONINA HADIHADIANA NY

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

M o t d u P rov i n c i a l Temps de grâces

M o t d u P rov i n c i a l Temps de grâces Mot du Provincial Temps de grâces Plusieurs événements de la province et de l Église à Madagascar constituent nos sources d action de grâce à adresser au Seigneur. La visite fraternelle et édifiante du

Plus en détail

FANILO MIAMPITA. TÉLÉPHONIE FIXE La honte. Encore sous le monopole Après le drame libanais, voilà que resurgit

FANILO MIAMPITA. TÉLÉPHONIE FIXE La honte. Encore sous le monopole Après le drame libanais, voilà que resurgit cyan magenta jaune noir PROGRAMME P.7 L accès sans peine à l information QUOTIDIEN D INFORMATION GRATUIT N 080 DU Vendredi 18 Juin 2010 AFFAIRE LILA FANILO MIAMPITA TÉLÉPHONIE FIXE La honte TONGA NY ORA

Plus en détail