Aequorea victoria. Aequorine

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "Aequorea victoria. Aequorine"

Transcription

1 Aequorea victoria Cette méduse bioluminescente vit près de la côte ouest des Etats-Unis. Elle possède plus de 150 tentacules et fait environ 3cm de diamètre. C est grâce à l étude de cette méduse que les scientifiques ont découvert les protéines luminescentes aequorine et GFP (prix Nobel de chimie en 2008). L aequorine, en présence de calcium, émet une lumière bleue qui excite la GFP. Cette dernière émet alors une lumière verte. Aequorine MTSEQYSVKLTPDFDNPKWIGRHKHMFNF LDVNHNGRISLDEMVYKASDIVINNLGATPE QAKRHKDAVEAFFGGAGMKYGVETEWPEY IEGWKRLASEELKRYSKNQITLIRLWGDALF DIIDKDQNGAISLDEWKAYTKSDGIIQSSEDC EETFRVCDIDESGQLDVDEMTRQHLGFW YTMDPACEKLYGGAVP Emission lumineuse: bleu (470 nm) UniProt: P07164 (aequorin) PDB: 1SL8 Le calcium est indispensable à l émission de lumière bleue 1

2 Aequorea victoria Cette méduse bioluminescente (3 cm) se trouve sur la côte ouest de l Amérique du Nord. Elle possède plus de 150 tentacules. C est grâce à l étude de cette méduse que les scientifiques ont découvert l aequorineet la GFP. Shimomura, Martin Chalfieet Roger Y. Tsienontainsiobtenule prix Nobel de chimieen L aequorine, en présence de calcium, émet une lumière bleue qui excite la GFP. Cette dernière émet alors une lumière verte. GFP MSKGEELFTGVVPILVELDGDVNGHKFSVSG EGEGDATYGKLTLKFICTTGKLPVPWPTL VTTFSYGVQCFSRYPDHMKQHDFFKSAMPE GYVQERTIFFKDDGNYKTRAEVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYNSHNVYI MADKQKNGIKVNFKIRHNIEDGSVQLAD HYQQNTPIGDGPVLLPDNHYLSTQSALSKD PNEKRDHMVLLEFVTAAGITHGMDELYK Emission: vert (509 nm) UniProt: P42212 (Green fluorescent protein ) PDB: 1BFP 2

3 Aliivibrio fischeri (bactérie) Bactéries bioluminescentes qui vivent en symbiose avec de nombreux poissons, en colonisant différents organes. Luciférase MKFGNICFSYQPPGETHKLSNGSLCSAWYRLR RVGFDTYWTLEHHFTEFGLTGNLFVAAA NLLGRTKTLNVGTMGVVIPTAHPVRQLEDVLL LDQMSKGRFNFGTVRGLYHKDFRVFGVD MEESRAITQNFYQMIMESLQTGTISSDSDYIQ FPKVDVYPKVYSKNVPTCMTAESASTTE WLAIQGLPMVLSWIIGTNEKKAQMELYNEIAT EYGHDISKIDHCMTYICSVDDDAQKAQD VCREFLKNWYDSYVNATNIFNDSNQTRGYDY HKGQWRDFVLQGHTNTNRRVDYSNGINPV GTPEQCIEIIQRDIDATGITNITCGFEANGTEDE IIASMRRFMTQVAPFLKEPK Réaction biochimique Luciférine (FMNH2) + ATP + Mg +2 + (Luciférase + O 2 ) ---> (Oxyluciférine + photons) + Luciférase Emission lumineuse : bleu UniProt: P19907; Luciférase PDB: 1V5Y 3

4 Clytia gregaria organes sexuels Cette méduse(2cm de diamètre) est très abondante de l océan Pacifiqueentre l Alaskaet l Orégon. Les larves de l anémone de mer Peachia quiquecapitata sont friantes de ses organes sexuels Aequorine MADTASKYAVKLRPNFDNPKWVNRHKFMF NFLDINGDGKITLDEIVSKASDDICAKLGAT PEQTKRHQDAVEAFFKKIGMDYGKEVEFPA FVDGWKELANYDLKLWSQNKKSLIRDWGE AVFDIFDKDGSGSISLDEWKAYGRISGICSSD EDAEKTFKHCDLDNSGKLDVDEMTRQHLG FWYTLDPNADGLYGNFVP Emission lumineuse : bleu (470 nm) UniProt: Q08121 (clytin) PDB: 3KPX Le calcium est indispensable à l émission de lumière bleue 4

5 Obelia longissima Le cycle de vie de O. longissimaest composé de 3 étapes: (1) Colonies arborescentes (2) Méduse (pendant la période de reproduction) (3) Stade larvaire Aequorine MSSKYAVKLKTDFDNPRWIKRHKHMFDFL DINGNGKITLDEIVSKASDDICAKLEATPEQ TKRHQVCVEAFFRGCGMEYGKEIAFPQFLD GWKQLATSELKKWARNEPTLIREWGDAVF DIFDKDGSGTITLDEWKAYGKISGISPSQEDC EATFRHCDLDNSGDLDVDEMTRQHLGFWY TLDPEADGLYGNGVP Emission lumineuse: bleu (470 nm) UniProt: Q27709 (obelin) PDB: 1EL4 Le calcium est indispensable à l émission de lumière bleue 5

6 Ctenophore Beroe abyssicola Organismes marins carnivores qui se déplacent grâce à des cils alignés formant des peignes. Ils possèdent des neurones et des cellules musculaires. Aequorine MTERLNEQNNESYRYLRSVGNQWQFNVE DLHPKMLSRLYKRFDTFDLDSDGKMEMDE VLYWPDRMRQLVNATDEQVEKMRDAVRV FFLHKGVEPVNGLLREDWVEANRVFAEAER ERERRGEPSLIALLSNSYYDVLDDDGDGTVD VDELKTMMKAFDVPQEAAYTFFEKADTDKS GKLERTELVHLFRKFWMEPYDPQWDGVYA YKY Emission lumineuse: bleu (470 nm) UniProt: H8ZZK1 (berovin) PDB: 4MN0 Le calcium est indispensable à l émission de lumière bleue 6

7 Discosoma striata (corail champignon) Ce corail mou est natif de l Océan Indien. Il est souvent utilisé comme décoration dans les aquariums. GFP MSCSKSVIKEEMLIDLHLEGTFNGHYFEIKGK GKGQPNEGTNTVTLEVTKGGPLPFGWHI LCPQFQYGNKAFVHHPDNIHDYLKLSFPEGY TWERSMHFEDGGLCCITNDISLTGNCFYY DIKFTGLNFPPNGPVVQKKTTGWEPSTERLY PRDGVLIGDIHHALTVEGGGHYACDIKTV YRAKKAALKMPGYHYVDTKLVIWNNDKEF MKVEEHEIAVARHHPFYEPKKDK Emission lumineuse: bleu (483 nm) UniProt: Q9U6Y7 (GFP-like dsfp483) PDB: 3CGL 7

8 Entacmaea quadricolor (bubble-tip anemone) Cette anémone à bouts renflés peut avoir un diamètre de ~ 40 cm. Les extrémités des tentacules de l'anémone ne sont pas renflés si elle n'est pas squatées par plusieurs espèces de poissons commensaux (qui se nourrissent de ses déchets). GFP MNSLIKENMRMMVVMEGSVNGYQFKCTGE GDGNPYMGTQTMRIKVVEGGPLPFAFDILAT SFMYGSKTFIKHTKGIPDFFKQSFPEGFTWERV TRYEDGGVFTVMQDTSLEDGCLVYHAK VTGVNFPSNGAVMQKKTKGWEPNTEMLYPA DGGLRGYSQMALNVDGGGYLSCSFETTYRS KKTVENFKMPGFHFVDHRLERLEESDKEMFV VQHEHAVAKFCDLPSKLGRL Emission lumineuse: rouge (611 nm) UniProt: Q8ISF8 (Red fluorescent protein eqfp611) PDB: 3E5T 8

9 Pontellina plumata GFP MPAMKIECRITGTLNGVEFELVGGGEGTPEQ GRMTNKMKSTKGALTFSPYLLSHVMGYGF YHFGTYPSGYENPFLHAINNGGYTNTRIEKYE DGGVLHVSFSYRYEAGRVIGDFKVVGTG FPEDSVIFTDKIIRSNATVEHLHPMGDNVLVG SFARTFSLRDGGYYSFVVDSHMHFKSAI HPSILQNGGPMFAFRRVEELHSNTELGIVEY QHAFKTPIAFA Emission lumineuse: vert UniProt: Q6WV12 (GFP 2) PDB: 2G6X 9

10 Zoanthus sp. (corail mou) GFP MAHSKHGLKEEMTMKYHMEGCVNGHKFV ITGEGIGYPFKGKQTINLCVIEGGPLPFSEDI LSAGFKYGDRIFTEYPQDIVDYFKNSCPAGYT WGRSFLFEDGAVCICNVDITVSVKENCI YHKSIFNGMNFPADGPVMKKMTTNWEASC EKIMPVPKQGILKGDVSMYLLLKDGGRYRCQ FDTVYKAKSVPSKMPEWHFIQHKLLREDRSD AKNQKWQLTEHAIAFPSALA Emission lumineuse: jaune UniProt: Q9U6Y4 (GFP-like FP538) PDB: 1XAE 10

11 Phialidium sp. Une petite méduse qui émet de la bioluminescence de couleur jaune GFP MSSGALLFHGKIPYVVEMEGNVDGHTFSIR GKGYGDASVGKVDAQFICTTGDVPVPWSTL VTTLTYGAQCFAKYGPELKDFYKSCMPEGYV QERTITFEGDGVFKTRAEVTFENGSVYNR VKLNGQGFKKDGHVLGKNLEFNFTPHCLYI WGDQANHGLKSAFKIMHEITGSKEDFIVAD HTQMNTPIGGGPVHVPEYHHITYHVTLSKD VTDHRDNMSLVETVRAVDCRKTYL Emission lumineuse: jaune(537 nm) UniProt: Q6RYS7 (Yellow fluorescent protein) PDB: 2HPW 11

12 Anguilla japonica Ces anguilles vivent dans les fleuves, entre la Chine, la Corée, le nord des Philippines et le Japon. La femelle mesure un mètre et le mâle 50 centimètres. Elles sont très appréciées dans la gastronomie et sont aussi utilisées dans la médecine traditionnelle chinoise. GFP MVEKFVGTWKIADSHNFGEYLKAIGAPKELS DGGDATTPTLYISQKDGDKMTVKIENGPP TFLDTQVKFKLGEEFDEFPSDRRKGVKSVVNL VGEKLVYVQKWDGKETTYVREIKDGKLV VTLTMGDVVAVRSYRRATE Emission lumineuse: vert UniProt: P0DM59 (Unagi green fluorescent protein) PDB: 4I3C 12

13 Renilla reniformis (pensée de mer) Cette pensée de mer est composée d un ensemble de polypes qui ont des formes et des fonctions différentes (système d accroche, nourriture,...). Elle peut vivre dans l eau ou sous une fine couche de sable. Luciférase PEVTASERAYHLRKMKTRMKRVDVTGDGFI SREDYELIAVRIAKIAKLSAEKAEETRQEF LRVADQLGLAPGVRISVEEAAVNATDSLLKMK AEEKAMAVIQSLIMYDCIDTDKDGYVSL PEFKAFLQAVGPDITDDKAITCFNTLDFNKNG QISRDEFLVTVNDFLFGLEETALANAFY GDLL Réaction biochimique Luciférine + ATP + Ca +2 + (Luciférase + O 2 ) ---> (Oxyluciférine + photons) + Luciférase Emission lumineuse : bleu (480 nm) UniProt: P05938 PDB: 2HPS 13

14 Photinus pyralis (luciole) La famille des lucioles et des lampyres regroupe plus de 2000 espèces connues de coléoptères, produisant presque tous de la lumière (jaune à verdâtre), à l'état de larve et/ou adulte. Les femelles (qui ne peuvent pas voler) émettent des signaux lumineux pour attirer les mâles. Ces derniers reconnaissent le signal grâce à sa couleur et à son intensité. Les signaux lumineux sont propres à chaque espèce. Luciférase MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYAL VPGTIAFTDAHIEVNITYAEYFEMSVRLAEAMKRYGL NTNHRIVVCSENSLQFFMPVLGALFIGVAVAPANDI YNERELLNSMNISQPTVVFVSKKGLQKILNVQKKLPI IQKIIIMDSKTDYQGFQSMYTFVTSHLPPGFNEYD FVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACV RFSHARDPIFGNQIIPDTAILSVVPFHHGFGMFTTLG YLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFS FFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRF HLPGIRQGYGLTETTSAILITPEGDDKPGAVGKVVPF FEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYV NNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDR LKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDD DAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKK LRGGVVFVDEVPKGLTGKLDARKIREILIKAKKGGKS KL Réaction biochimique Luciférine (Photinus) + ATP + Mg +2 + (Luciférase + O 2 ) ---> (Oxyluciférine + photons) + Luciférase Emission lumineuse: vert UniProt: P08659; Luciférase PDB: 1BA3 14

15 Lampyris noctiluca (ver luisant) La famille des lucioles et des lampyres regroupe plus de 2000 espèces connues de coléoptères, produisant presque tous de la lumière (jaune à verdâtre), à l'état de larve et/ou adulte. Les femelles (qui ne possèdent pas d aile) émettent des signaux lumineux pour attirer les mâles. Ces derniers reconnaissent le signal grâce à sa couleur et à son intensité. Les signaux lumineux sont propres à chaque espèce. MEDAKNIMHGPAPFYPLEDGTAGEQLHKAMKRYAQ VPGTIAFTDAHAEVNITYSEYFEMACRLAETMKRYGL GLQHHIAVCSENSLQFFMPVCGALFIGVGVAPTNDIY NERELYNSLSISQPTIVFCSKRALQKILGVQKKLPIIQKI VILDSREDYMGKQSMYSFIESHLPAGFNEYDYIPDSFD RETATALVMNSSGSTGLPRGVELTHQNVCVRFSHCR DPVFGNQIIPDTAILTVIPFHHGFGMFTTLGYLTCGFRI VLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAKSTL VDKYDLSNLHEIASGGAPLAKEVGEAVAKRFKLPGIR QGYGLTETTSAIIITPEGDDKPGACGKVVPFFSAKIVDL DTGKTLGVNQRGELCVKGPMIMKGYVNNPEATSALI DKDGWLHSGDIAYYDKDGHFFIVDRLKSLIKYKGYQV PPAELESILLQHPFIFDAGVAGIPDPDAGELPAAVVVL EEGKTMTEQEVMDYVAGQVTASKRLRGGVKFVDEV PKGLTGKIDGRKIREILM MGKKSKL Luciférase Réaction biochimique Luciférine + ATP + Mg +2 + (Luciférase + O 2 ) ---> (Oxyluciférine + photons) + Luciférase Emission lumineuse: vert UniProt: Q2TNU5; Luciférase PDB: (modèle) 15

LA BIOLUMINESCENCE. 1 Introduction. 2 Définition. 3 Le phénomène. 4 Les différentes formes de bioluminescence

LA BIOLUMINESCENCE. 1 Introduction. 2 Définition. 3 Le phénomène. 4 Les différentes formes de bioluminescence LA BIOLUMINESCENCE 1 Introduction 2 Définition 3 Le phénomène 4 Les différentes formes de bioluminescence 5 Pourquoi les animaux émettent de la lumière 6 Annexes Introduction Des insectes comme le lampyre

Plus en détail

Lumière et couleur. 2 Rayonnement polychromatique et monochromatique.

Lumière et couleur. 2 Rayonnement polychromatique et monochromatique. Chapitre 19 Sciences Physiques - BTS Lumière et couleur 1 Introduction. La lumière fait partie des ondes électromagnétiques qui vont des rayons cosmiques aux ondes radar. Ces ondes se différencient par

Plus en détail

Quelques informations sur les méduses et leur prolifération

Quelques informations sur les méduses et leur prolifération Par Daniel Woehrling, département EMH, juin 2005 Quelques informations sur les méduses et leur prolifération Pêcheurs ou plaisanciers relatent périodiquement dans divers secteurs du littoral méditerranéen

Plus en détail

Application à l astrophysique ACTIVITE

Application à l astrophysique ACTIVITE Application à l astrophysique Seconde ACTIVITE I ) But : Le but de l activité est de donner quelques exemples d'utilisations pratiques de l analyse spectrale permettant de connaître un peu mieux les étoiles.

Plus en détail

RESEAU D'EPIDEMIO-SURVEILLANCE Bulletin n 12 du 30 août 2015 SITUATION

RESEAU D'EPIDEMIO-SURVEILLANCE Bulletin n 12 du 30 août 2015 SITUATION SITUATION Le Dollar spot reste très actif pour cette rentrée! L incidence du Dollar spot ne semble pas avoir ralenti, les intendants et gestionnaires sont confrontés à des attaques répétées sur toutes

Plus en détail

Microscopie Confocale. Principes de base & Applications en Biologie Cellulaire

Microscopie Confocale. Principes de base & Applications en Biologie Cellulaire Université Paris Descartes L3 - Licence Professionnelle «Industries chimiques et Pharmaceutiques Option Biotechnologie» Microscopie Confocale Principes de base & Applications en Biologie Cellulaire Bruno

Plus en détail

GUIDE CONSO-CITOYEN : LES ESPÈCES PROFONDES

GUIDE CONSO-CITOYEN : LES ESPÈCES PROFONDES GUIDE CONSO-CITOYEN : LES ESPÈCES PROFONDES CRIME EN EAUX PROFONDES LE MOBILE DU CRIME ET LE COMPLICE Parce qu on pêche trop, trop loin, trop profond, nos océans sont en train de mourir, tout spécialement

Plus en détail

CILDA 2010 Le 17 décembre Hôtel Clarion 202 rue de Rivoli LE FRELON ASIATIQUE INTERVENTION DE CLAIRE VILLEMENOT DU MUSEUM NATIONAL

CILDA 2010 Le 17 décembre Hôtel Clarion 202 rue de Rivoli LE FRELON ASIATIQUE INTERVENTION DE CLAIRE VILLEMENOT DU MUSEUM NATIONAL CILDA 2010 Le 17 décembre Hôtel Clarion 202 rue de Rivoli LE FRELON ASIATIQUE INTERVENTION DE CLAIRE VILLEMENOT DU MUSEUM NATIONAL Consulter le site Web inpn.mnhn.fr Présentation de l individu 2 espèces

Plus en détail

PARTIE II : Reproduction sexuée et maintien des espèces dans leur milieu de vie.

PARTIE II : Reproduction sexuée et maintien des espèces dans leur milieu de vie. PARTIE II : Reproduction sexuée et maintien des espèces dans leur milieu de vie. Une île volcanique vient de se former, que se passe-t-il au bout de plusieurs années? Comment font les êtres vivants pour

Plus en détail

III CRITERES POUR CHOISIR UN COUPLE DE FLUOROPHORES

III CRITERES POUR CHOISIR UN COUPLE DE FLUOROPHORES Page : 17/ 77 III CRITERES POUR CHOISIR UN COUPLE DE FLUOROPHORES Le choix d un couple donneur-accepteur dépend de la technique utilisée (FRET, TR- FRET, BRET, etc.) et des molécules disponibles pour ces

Plus en détail

Comprendre l Univers grâce aux messages de la lumière

Comprendre l Univers grâce aux messages de la lumière Seconde / P4 Comprendre l Univers grâce aux messages de la lumière 1/ EXPLORATION DE L UNIVERS Dans notre environnement quotidien, les dimensions, les distances sont à l échelle humaine : quelques mètres,

Plus en détail

L ACTE PHOTOCHIMIQUE DE LA PHOTOSYNTHESE

L ACTE PHOTOCHIMIQUE DE LA PHOTOSYNTHESE L ACTE PHOTOCHIMIQUE DE LA PHOTOSYNTHESE Acte photochimique Réactions chimiques L ACTE PHOTOCHIMIQUE DE LA PHOTOSYNTHESE I- La lumière et son énergie. A- Les radiations lumineuses Rappel : E = hν; h constante

Plus en détail

Leica MZ FLIII. Stéréomicroscope pour fluorescence un exemple lumineux de la technologie innovatrice de Leica.

Leica MZ FLIII. Stéréomicroscope pour fluorescence un exemple lumineux de la technologie innovatrice de Leica. Leica MZ FLIII Stéréomicroscope pour fluorescence un exemple lumineux de la technologie innovatrice de Leica. Leica MZ FLIII Observer en 3 dimensions L étude des organismes vivants, de leurs fonctions

Plus en détail

Chapitre 02. La lumière des étoiles. Exercices :

Chapitre 02. La lumière des étoiles. Exercices : Chapitre 02 La lumière des étoiles. I- Lumière monochromatique et lumière polychromatique. )- Expérience de Newton (642 727). 2)- Expérience avec la lumière émise par un Laser. 3)- Radiation et longueur

Plus en détail

Protéger la qualité du produit par un suivi microbiologique en temps réel

Protéger la qualité du produit par un suivi microbiologique en temps réel Kits d ATP-métrie de nouvelle Génération pour le suivi de l activité Microbiologique dans l industrie chimique : Peinture, enrobage, latex, émulsion de polymères Protéger la qualité du produit par un suivi

Plus en détail

Le s t hri p s du banani e r aux A nt i lle s

Le s t hri p s du banani e r aux A nt i lle s Les thrips sont des insectes de petite taille (1 à 2 mm), allongés et qui possèdent des ailes étroites bordées de longs cils caractéristiques. Les dégâts majeurs résultent de l alimentation des adultes

Plus en détail

LES DIODES ÉLECTRO- LUMINESCENTES

LES DIODES ÉLECTRO- LUMINESCENTES Roger Cadiergues MémoCad nd43.a LES DIODES ÉLECTRO- LUMINESCENTES SOMMAIRE nd43.1. Les diodes électroluminescentes (LED) nd43.2. Les très basses tension de sécurité (TBTS) nd43.3. Le montage des appareils

Plus en détail

Les frelons. De la même famille que les guêpes

Les frelons. De la même famille que les guêpes Les frelons De la même famille que les guêpes Les frelons font partie de la même famille d'insectes que les guêpes et les abeilles, les Hyménoptères. Ils sont les plus grands insectes de cette famille,

Plus en détail

Mesures de PAR. Densité de flux de photons utiles pour la photosynthèse

Mesures de PAR. Densité de flux de photons utiles pour la photosynthèse Densité de flux de photons utiles pour la photosynthèse Le rayonnement lumineux joue un rôle critique dans le processus biologique et chimique de la vie sur terre. Il intervient notamment dans sur les

Plus en détail

Données sur l état des populations du thon rouge de l atlantique (Thunnus thynnus).

Données sur l état des populations du thon rouge de l atlantique (Thunnus thynnus). Données sur l état des populations du thon rouge de l atlantique (Thunnus thynnus). Généralités : L exploitation du thon rouge de l Atlantique dans la Mer Méditerranée remonte au premier millénaire avant

Plus en détail

Les petites bêtes. Les décomposeurs utiles

Les petites bêtes. Les décomposeurs utiles Les petites bêtes Voici une liste non exhaustive des «bêtes» que vous pourrez observer dans votre lombricomposteur. Mais la plupart apparaîtront dans votre caisse seulement si elle se trouve en extérieur.

Plus en détail

Qui mange qui? Objectif : Prendre conscience des nombreuses relations qui existent entre les êtres vivants et notamment les relations alimentaires.

Qui mange qui? Objectif : Prendre conscience des nombreuses relations qui existent entre les êtres vivants et notamment les relations alimentaires. Qui mange qui? Objectif : Prendre conscience des nombreuses relations qui existent entre les êtres vivants et notamment les relations alimentaires. Tous les êtres vivants ont besoin d énergie pour vivre,

Plus en détail

Dr E. CHEVRET UE2.1 2013-2014. Aperçu général sur l architecture et les fonctions cellulaires

Dr E. CHEVRET UE2.1 2013-2014. Aperçu général sur l architecture et les fonctions cellulaires Aperçu général sur l architecture et les fonctions cellulaires I. Introduction II. Les microscopes 1. Le microscope optique 2. Le microscope à fluorescence 3. Le microscope confocal 4. Le microscope électronique

Plus en détail

Fluorescent ou phosphorescent?

Fluorescent ou phosphorescent? Fluorescent ou phosphorescent? On entend régulièrement ces deux termes, et on ne se préoccupe pas souvent de la différence entre les deux. Cela nous semble tellement complexe que nous préférons rester

Plus en détail

La Composition de la lumière De quoi est composée la lumière Blanche?

La Composition de la lumière De quoi est composée la lumière Blanche? La Composition de la lumière De quoi est composée la lumière Blanche? Introduction de dossier : Newton, dans sa vision de la blancheur de la lumière solaire résultant de toutes les 3 couleurs primaire

Plus en détail

EN QUÊTE DU MONDE. Les nids de fourmis rousses. Présentation de la vidéo... 2 Générique... 2 description... 2 Principaux thèmes abordés...

EN QUÊTE DU MONDE. Les nids de fourmis rousses. Présentation de la vidéo... 2 Générique... 2 description... 2 Principaux thèmes abordés... Présentation de la vidéo... 2 Générique... 2 description... 2 Principaux thèmes abordés... 2 Contenus... 3 niveaux, disciplines, compétences... 3 notions... 4 Vocabulaire... 4 découpage du film... 5 Suggestions

Plus en détail

C. Magdo, Altis Semiconductor (Corbeil-Essonne) > NOTE D APPLICATION N 2

C. Magdo, Altis Semiconductor (Corbeil-Essonne) > NOTE D APPLICATION N 2 C. Magdo, Altis Semiconductor (Corbeil-Essonne) - JANVIER 2008 INTRODUCTION La fabrication de semi-conducteurs nécessite un environnement de production extrêmement stable en température et hygrométrie.

Plus en détail

Les Protéines Fluorescentes. Tounsia Aït-Slimane, UMRS 938, CDR Saint-Antoine CHU Saint-Antoine

Les Protéines Fluorescentes. Tounsia Aït-Slimane, UMRS 938, CDR Saint-Antoine CHU Saint-Antoine Les Protéines Fluorescentes Tounsia Aït-Slimane, UMRS 938, CDR Saint-Antoine CHU Saint-Antoine Sondes fluorescentes et méthodes d imagerie en biologie : GFP, EGFP, BFP, CFP, YFP, dsred, mrfp1, Hc Red,

Plus en détail

SAVAIS-TU QUE DANS MA COUR D ÉCOLE...

SAVAIS-TU QUE DANS MA COUR D ÉCOLE... SAVAIS-TU QUE DANS MA COUR D ÉCOLE... Éditions Mariko Francoeur Miguel Hortega IL Y A DES ANIMAUX? 1 Mon école est à Montréal, rue Berri. C est une belle école primaire toute faite de briques. En temps

Plus en détail

Chapitre 4 - Lumière et couleur

Chapitre 4 - Lumière et couleur Choix pédagogiques Chapitre 4 - Lumière et couleur Manuel pages 64 à 77 Ce chapitre reprend les notions introduites au collège et en classe de seconde sur les sources de lumières monochromatiques et polychromatiques.

Plus en détail

Travaux Dirigés de Biologie Cellulaire. TD n 1 Compléments sur les microscopes

Travaux Dirigés de Biologie Cellulaire. TD n 1 Compléments sur les microscopes Travaux Dirigés de Biologie Cellulaire TD n 1 Compléments sur les microscopes Les différents types de microscopes photoniques A. Le microscope à fond noir B.Le microscope polarisant C.Le microscope à contraste

Plus en détail

Chapitre 2 La rétine : les photorécepteurs rétiniens génèrent des messages sensoriels

Chapitre 2 La rétine : les photorécepteurs rétiniens génèrent des messages sensoriels Chapitre 2 La rétine : les photorécepteurs rétiniens génèrent des messages sensoriels La rétine constitue l organe sensitif de l œil : c est elle qui capte les signaux lumineux et les transmet au cerveau

Plus en détail

Application et méthodologie d acquisition d images

Application et méthodologie d acquisition d images Application et méthodologie d acquisition d images Application industrielle et acquisition de l image 2 Imagerie industrielle est utilisée comme outil de contrôle et de gestion augmentation flexibilité

Plus en détail

Comment vit la fourmi?

Comment vit la fourmi? Comment vit la fourmi? Le corps Le corps de la fourmi est construit en trois parties: il y a la tête, le thorax et l abdomen. Le corps est tout recouvert d un subterfuge, un peu comme une carapace. La

Plus en détail

Projet mare. La faune des mares

Projet mare. La faune des mares Projet mare La faune des mares CET EXPOSE VOUS EST PRESENTE PAR: Aurélie F. Kelly C. Charly G. Les larves de moustiques Les larves de moustiques sont très nombreuses dans les mares car il y a peu de prédateurs

Plus en détail

La fluorescence des végétaux

La fluorescence des végétaux La fluorescence des végétaux Définition de la fluorescence La fluorescence est une émission lumineuse provoquée par l excitation d une molécule, généralement par absorption d un photon. Ce signal optique

Plus en détail

La fluorescence. Solution pour exploiter les résultats d expression de gènes bactériens dans une larve d insecte infestée

La fluorescence. Solution pour exploiter les résultats d expression de gènes bactériens dans une larve d insecte infestée Microscopie et Interactions hôtes/micro-organismes La fluorescence Solution pour exploiter les résultats d expression de gènes bactériens dans une larve d insecte infestée 1 Sylvie Pagès, Anne Lanois,

Plus en détail

obs.5 Sources de lumières colorées exercices

obs.5 Sources de lumières colorées exercices obs.5 Sources de lumières colorées exercices Savoir son cours Mots manquants Chaque radiation lumineuse peut être caractérisée par une grandeur appelée longueur d onde dans le vide. Les infrarouges ont

Plus en détail

Imagerie Médicale : Fondements. Radiographie et scanner CT

Imagerie Médicale : Fondements. Radiographie et scanner CT Imagerie Médicale : Fondements Radiographie et scanner CT Master 2 MultiMedia : Image et Son Numériques Pascal Desbarats (desbarats@labri.fr) IMF : Radiographie et scanner CT p.1 Questions Comment produit-on

Plus en détail

FRAP & FLIP. Dossier technique. M1 VRV 2011 Université de Strasbourg

FRAP & FLIP. Dossier technique. M1 VRV 2011 Université de Strasbourg Adrien Paoli Aurore Strugala FRAP & FLIP Technique FRAP Technique FLIP Avantages & inconvénients Exemples d application Alternatives Adrien Paoli Aurore Strugala Introduction > Technique FRAP > Technique

Plus en détail

EXERCICE 2 : SUIVI CINETIQUE D UNE TRANSFORMATION PAR SPECTROPHOTOMETRIE (6 points)

EXERCICE 2 : SUIVI CINETIQUE D UNE TRANSFORMATION PAR SPECTROPHOTOMETRIE (6 points) BAC S 2011 LIBAN http://labolycee.org EXERCICE 2 : SUIVI CINETIQUE D UNE TRANSFORMATION PAR SPECTROPHOTOMETRIE (6 points) Les parties A et B sont indépendantes. A : Étude du fonctionnement d un spectrophotomètre

Plus en détail

La recherche d'indices par fluorescence

La recherche d'indices par fluorescence La recherche d'indices par fluorescence Ces sources d éclairage à haute intensité permettent, en fluorescence, la mise en évidence d indices qui ne sont pas visibles ou peu à l oeil nu. Ex : empreintes

Plus en détail

L utilisation des micro-organismes pour la production de carburants et de produits (bio)-chimiques

L utilisation des micro-organismes pour la production de carburants et de produits (bio)-chimiques L utilisation des micro-organismes pour la production de carburants et de produits (bio)-chimiques I R. A L I S O N B R O G N A U X U N I T É D E B I O - I N D U S T R I E S G E M B L O U X A G R O B I

Plus en détail

TP 2: LES SPECTRES, MESSAGES DE LA LUMIERE

TP 2: LES SPECTRES, MESSAGES DE LA LUMIERE TP 2: LES SPECTRES, MESSAGES DE LA LUMIERE OBJECTIFS : - Distinguer un spectre d émission d un spectre d absorption. - Reconnaître et interpréter un spectre d émission d origine thermique - Savoir qu un

Plus en détail

Antony Subaquatique Commission Bio Vidéo. Les Vers

Antony Subaquatique Commission Bio Vidéo. Les Vers Antony Subaquatique Commission Bio Vidéo Les Vers C est quoi un vers? La notion de vers est dénuée de sens pour les puristes de la classification des espèces. Mais pour nous, plongeurs, on range dans ce

Plus en détail

Caractérisation de défauts par Magnétoscopie, Ressuage, Courants de Foucault

Caractérisation de défauts par Magnétoscopie, Ressuage, Courants de Foucault Page 1 25 octobre 2012 Journée «Contrôle non destructif et caractérisation de défauts» Caractérisation de défauts par Magnétoscopie, Ressuage, Courants de Foucault Henri Walaszek sqr@cetim.fr Tel 0344673324

Plus en détail

Chapitre 1 : La lumière, sources et propagation.

Chapitre 1 : La lumière, sources et propagation. Chapitre 1 : La lumière, sources et propagation. Items Connaissances Acquis Qu est-ce qu une source primaire de lumière? Donner des exemples. Qu est-ce qu un objet diffusant? Donner des exemples. Quelles

Plus en détail

3: Clonage d un gène dans un plasmide

3: Clonage d un gène dans un plasmide 3: Clonage d un gène dans un plasmide Le clonage moléculaire est une des bases du génie génétique. Il consiste à insérer un fragment d'adn (dénommé insert) dans un vecteur approprié comme un plasmide par

Plus en détail

Les UV ( lampe de Wood, basée sur la fluorescence ultra violette).

Les UV ( lampe de Wood, basée sur la fluorescence ultra violette). Les UV ( lampe de Wood, basée sur la fluorescence ultra violette). Ce type de lumière a été découvert en 1801 par Ritten. Après des recherches par Stoke et Schumann entre 1862 et 1903 c'est en fin de compte

Plus en détail

CORRIGES Plan de la séance

CORRIGES Plan de la séance CORRIGES Plan de la séance 1. Corriges Compréhension écrite 2. Corriges Compréhension orale 3. Corriges Syntaxe 4. Corriges Vocabulaire 5. Corriges Conjugaison 6. Corriges Lecture d'élargissement 7. Corriges

Plus en détail

Calopteryx vierge Mâle et femelle ne se ressemblent pas. Le mâle du Calopteryx vierge a des ailes brun noir foncé veinées de bleu. Ce redoutable prédateur reste perché sur des plantes de la berge ou sur

Plus en détail

Annales corrigées. Sujet. Question D (0,5 point) Question A (1 point) Question E (1 point) Comment aborder le sujet. Question B (0,5 point)

Annales corrigées. Sujet. Question D (0,5 point) Question A (1 point) Question E (1 point) Comment aborder le sujet. Question B (0,5 point) Difficulté Sujet Durée 25 min CONCOURS AiDE-SOiGNANT, LOiRE, SESSiON 2010 Toutes les étapes du calcul doivent figurer sur vos copies. Question A (1 point) on prépare un buffet pour réunir une grande famille.

Plus en détail

www.sika.fr La Protection durable des constructions contre les termites Sika Anti Termites film

www.sika.fr La Protection durable des constructions contre les termites Sika Anti Termites film www.sika.fr La Protection durable des constructions contre les termites Sika Anti Termites film Sika, groupe mondial, développe, fabrique, commercialise des procédés techniques à destination du Bâtiment,

Plus en détail

La lessive qui lave plus blanc que blanc

La lessive qui lave plus blanc que blanc La lessive qui lave plus blanc que blanc Antoine ÉLOI, antoine.eloi@ens.fr Vendredi 5 Mars 1 Intéraction Matière Rayonnement Le Rayonnement visible : Chaque couleur est caractérisée par une longueur d

Plus en détail

La vie des étoiles. La vie des étoiles. Mardi 7 août

La vie des étoiles. La vie des étoiles. Mardi 7 août La vie des étoiles La vie des étoiles Mardi 7 août A l échelle d une ou plusieurs vies humaines, les étoiles, que l on retrouve toujours à la même place dans le ciel, au fil des saisons ; nous paraissent

Plus en détail

Où sont les Hommes sur la Terre

Où sont les Hommes sur la Terre Où sont les Hommes sur la Terre Introduction : Notre planète est constituée de régions peuplées et d autres qui sont presque vides, ainsi 90% de la population vit dans l hémisphère nord. Dans certains

Plus en détail

Cellules procaryotes (toujours unicellulaire) Cellules eucaryotes (unicellulaire ou pluricellulaire)

Cellules procaryotes (toujours unicellulaire) Cellules eucaryotes (unicellulaire ou pluricellulaire) 4- Organisation structurale et fonctionnelle des cellules Organismes unicellulaires Organismes pluricellulaires cellule Cellules procaryotes (toujours unicellulaire) Cellules eucaryotes (unicellulaire

Plus en détail

LAMPES FLUORESCENTES BASSE CONSOMMATION A CATHODE FROIDE CCFL

LAMPES FLUORESCENTES BASSE CONSOMMATION A CATHODE FROIDE CCFL LAMPES FLUORESCENTES BASSE CONSOMMATION A CATHODE FROIDE CCFL Economisons notre énergie et sauvons la planète Présentation générale 2013 PRESENTATION I. Principes de fonctionnement d une ampoule basse

Plus en détail

LA VISION DES COULEURS. Un prisme www.sjefs.net/ ~huldra/i/0006/. http://da.wikipedia.org/wiki/billede:prismer_med_forskellig_dispersion.

LA VISION DES COULEURS. Un prisme www.sjefs.net/ ~huldra/i/0006/. http://da.wikipedia.org/wiki/billede:prismer_med_forskellig_dispersion. LA VISION DES COULEURS La couleur d un objet dépend de la lumière qu il renvoie. 1) La décomposition de la lumière blanche : Un prisme www.sjefs.net/ ~huldra/i/0006/. http://da.wikipedia.org/wiki/billede:prismer_med_forskellig_dispersion.jpg

Plus en détail

Comment les rongeurs choisissent leurs aliments. Jean-Michel Michaux

Comment les rongeurs choisissent leurs aliments. Jean-Michel Michaux Comment les rongeurs choisissent leurs aliments Jean-Michel Michaux Comment les rongeurs choisissent leurs aliments Nécessité de mieux comprendre le comportement alimentaire du rongeur, Nombreux échecs

Plus en détail

Microscopies plein champs 3D & 3D n couleurs+temps

Microscopies plein champs 3D & 3D n couleurs+temps Microscopies plein champs 3D & 3D n couleurs+temps Dr Fabrice Cordelières, IR2 CNRS Institut Curie - Section de recherche/ CNRS UMR 146 Plateforme d'imagerie Cellulaire Bâtiment 112 - Centre universitaire

Plus en détail

1028 Lampes Tubes Fluorescents

1028 Lampes Tubes Fluorescents 1028 Lampes Tubes Fluorescents legende photo appli 2 Lampes Tubes Fluorescents 1029 Tubes Fluorescents Les tubes fluorescents sont des lampes à décharge tubulaires à vapeur de mercure basse pression dont

Plus en détail

2. Les agents de maladies infectieuses

2. Les agents de maladies infectieuses 2. Les agents de maladies infectieuses 2a. Ce qui est un agent pathogène des plantes? Les organismes phytopathogènes sont pour la plupart les champignons, les bactéries, les nématodes, et les virus (il

Plus en détail

La drosophile à ailes tachetées État de situation. Christian Lacroix, agronome

La drosophile à ailes tachetées État de situation. Christian Lacroix, agronome La drosophile à ailes tachetées État de situation Christian Lacroix, agronome Origines de l insecte Originaire d Asie Japon (1916), Chine et Corée (1936) Amérique Centrale Costa Rica (1997), Équateur (1998)

Plus en détail

Le manchot. Le savais-tu?

Le manchot. Le savais-tu? Auteur: Monica Le manchot Le manchot vit sur une banquise. Le manchot est un carnivore. Il mange du plancton et du poisson. Le cri du manchot c est le braiement ou le jabotement. Auteur: Mohamed L orque

Plus en détail

COMPRÉHENSION ÉCRITE : L ENVIRONNEMENT. Les gaz à effet de serre

COMPRÉHENSION ÉCRITE : L ENVIRONNEMENT. Les gaz à effet de serre 1 COMPRÉHENSION ÉCRITE : L ENVIRONNEMENT Que fait-on en France? Gaz à effets de serre En France, il est possible de diviser par 4 les gaz à effet de serre avant 2050. Mais ça ne sera pas facile Les gaz

Plus en détail

Le ver luisant. Antonin

Le ver luisant. Antonin L'éphémère Amélie L'éphémère est un petit insecte qui a de courtes antennes et un corps très fin. Il possède deux ailes transparentes et ne peut vivre que quelques heures. Le ver luisant Le ver luisant

Plus en détail

Un couple de Pandas géants au Zoo de Mulhouse!

Un couple de Pandas géants au Zoo de Mulhouse! Janvier 2008 Tourisme et attractivité : Un couple de Pandas géants au Zoo de Mulhouse! «MULHOUSE j y crois.» est une association dont le but est de faire émerger des idées concrètes, réalistes et constructives

Plus en détail

SPECTROSCOPIE RAMAN I APPLICATIONS

SPECTROSCOPIE RAMAN I APPLICATIONS SPECTROSCOPIE RAMAN La spectroscopie Raman est une technique d analyse non destructive, basée sur la détection des photons diffusés inélastiquement suite à l interaction de l échantillon avec un faisceau

Plus en détail

Chapitre 2 : La couleur des objets (p. 29)

Chapitre 2 : La couleur des objets (p. 29) PRTIE 1 - OSERVER : OULEURS ET IMGES hapitre 2 : La couleur des objets (p. 29) onnaissances : Phénomènes d absorption, de diffusion et de transmission. Savoir-faire : Utiliser les notions de couleur blanche

Plus en détail

Végétaux Exemples d individus

Végétaux Exemples d individus Végétaux Formation Biologie 2011 2012 Végétaux Exemples d individus Végétaux Embranchement Classification Description Reproduction Mode de vie Exemples d individu Végétaux Règne > Etymologie «Végetaux»

Plus en détail

N 4 Du 16 au 22 nov. 2011

N 4 Du 16 au 22 nov. 2011 N 4 Du 16 au 22 nov. 2011 LA SÉANCE D ACTU DE LA SEMAINE L article choisi de la semaine : C est qui, ce frelon asiatique? FICHE ÉLÈVE LES MOTS DE LA SEMAINE ACTIVITE 1 : JE ME RAPPELLE 1 - Voici les mots

Plus en détail

La drosophile à ailes tachetées : nouvelle réalité québécoise

La drosophile à ailes tachetées : nouvelle réalité québécoise La drosophile à ailes tachetées : nouvelle réalité québécoise Jean-Philippe Légaré, Biologiste-entomologiste, Laboratoire de diagnostic en phytoprotection Taxonomie Ordre: Diptères Famille: Drosophilidae

Plus en détail

VistaCam ix Des images parfaites, un excellent diagnostic de caries

VistaCam ix Des images parfaites, un excellent diagnostic de caries VistaCam ix Des images parfaites, un excellent diagnostic de caries Une caméra, de multiples possibilités AIR COMPRIMÉ ASPIRATION IMAGERIE ODONTOLOGIE CONSERVATRICE HYGIÈNE Dispositif Médical de classe

Plus en détail

Qu est-ce-que l Indice de Rendu des Couleurs?

Qu est-ce-que l Indice de Rendu des Couleurs? Qu est-ce-que l Indice de Rendu des Couleurs? La couleur: concrétisation de la lumière La propriété de la source lumineuse qui influence l aspect/l apparence des objets en terme de couleur est appelé «Le

Plus en détail

CELLULAIRE. FORMATION pour le LBFA

CELLULAIRE. FORMATION pour le LBFA CYTOMÉTRIE TRIE EN FLUX ET MICROSCOPIE CONFOCALE: 2 TECHNIQUES COMPLÉMENTAIRES MENTAIRES POUR L EXPLORATION L DU FONCTIONNEMENT CELLULAIRE FORMATION pour le LBFA Cécile COTTET 2006 3 sessions : I- Pré

Plus en détail

Microbiologie BIOL 3253. Étude de la structure microbienne: microscopie et préparation des échantillons

Microbiologie BIOL 3253. Étude de la structure microbienne: microscopie et préparation des échantillons Microbiologie BIOL 3253 Étude de la structure microbienne: microscopie et préparation des échantillons Les lentilles et la déviation de la lumière Quand un rayon lumineux passe d un milieu à un autre,

Plus en détail

Texte : Michel Guillaume et Jean-Paul Bardoul

Texte : Michel Guillaume et Jean-Paul Bardoul Texte : Michel Guillaume et Jean-Paul Bardoul En septembre 2012, un nid de Frelon asiatique a été découvert au Val-André. Bien camouflé et difficilement accessible au sommet d un conifère, il a cependant

Plus en détail

Comment se protéger des frelons asiatiques?

Comment se protéger des frelons asiatiques? PREFET de l AUDE Comment se protéger des frelons asiatiques? Vous trouverez ci-dessous des conseils pour vous protéger du frelon asiatique, que vous soyez particulier, maire ou apiculteur ainsi que des

Plus en détail

HAGEN H. STEHR, A.O UN PIONNIER DE L AQUACULTURE

HAGEN H. STEHR, A.O UN PIONNIER DE L AQUACULTURE HAGEN H. STEHR, A.O UN PIONNIER DE L AQUACULTURE Hagen Stehr est un pionnier qui a enfin trouvé ce qu il a appelé «le Saint Graal» de l aquaculture. Grâce à son esprit visionnaire et à sa détermination,

Plus en détail

"Blonde", 2kW Softlight Minibrute colonnes orientables

Blonde, 2kW Softlight Minibrute colonnes orientables LES OUTILS 1) Les projecteurs a) A incandescence (tungstène 3 200 K) "Blonde", 2kW Softlight Minibrute colonnes orientables Autre softlight "mandarines", "blondes", PAR 64, Dedolights, etc. lumière chaude,

Plus en détail

Expression de la Concession et de l Opposition in. La photographie scientifique Par Gérard BETTON (PUF, 1975) 04/06/2015

Expression de la Concession et de l Opposition in. La photographie scientifique Par Gérard BETTON (PUF, 1975) 04/06/2015 1 Expression de la Concession et de l Opposition in La photographie scientifique Par Gérard BETTON (PUF, 1975) 2 Concession /Opposition Compléter avec un des mots ou expressions suivantes : au lieu de

Plus en détail

Chapitre 2 : VISION ET COULEUR

Chapitre 2 : VISION ET COULEUR Chapitre 2 : VISION ET COULEUR Rappel : Un prisme ou un réseau permettent de décomposer la lumière. On obtient alors un spectre. Dans le cas de la lumière blanche, ce spectre est continu et constitué par

Plus en détail

DIFFRACTion des ondes

DIFFRACTion des ondes DIFFRACTion des ondes I DIFFRACTION DES ONDES PAR LA CUVE À ONDES Lorsqu'une onde plane traverse un trou, elle se transforme en onde circulaire. On dit que l'onde plane est diffractée par le trou. Ce phénomène

Plus en détail

Approche documentaire : «Oscillateur optique, Laser»

Approche documentaire : «Oscillateur optique, Laser» Approche documentaire : «Oscillateur optique, Laser» Objectifs : en relation avec le cours sur les ondes, les documents suivants permettent de décrire le fonctionnement d un laser en termes de système

Plus en détail

Présentation générale de la drosophile du cerisier, Drosophilasuzukii: description, biologie, cycle, plantes-hôtes et dégâts

Présentation générale de la drosophile du cerisier, Drosophilasuzukii: description, biologie, cycle, plantes-hôtes et dégâts Présentation générale de la drosophile du cerisier, Drosophilasuzukii: description, biologie, cycle, plantes-hôtes et dégâts J. Zini, M. Dubrulle, E. Bullen, GFWasbl C. Fassotte, CRA-W D. suzukii- taxonomie

Plus en détail

Fiche N 5-2B : La couleur : application aux filtres

Fiche N 5-2B : La couleur : application aux filtres Les filtres 3 questions (-exemples) auxquelles cette fiche va essayer de répondre : Question 1 Que va-t-il se passer si j utilise un filtre bleu dans une zone qui est d autre part éclairée par un autre

Plus en détail

Chimie Analytique I: Chapitre 14 Introduction aux méthodes spectroscopiques

Chimie Analytique I: Chapitre 14 Introduction aux méthodes spectroscopiques Chimie Analytique I: Chapitre 14 Introduction aux méthodes spectroscopiques 14.1 Molécule: Quelles libertés? Pour une molécule possédant N atomes, il existe 3N degrés de liberté (de mouvement). C'est dans

Plus en détail

Chimie des matériaux CHM506

Chimie des matériaux CHM506 Chimie des matériaux CHM506 Yue Zhao Properties of Materials Mary Anne White Qu est-ce qui est dans la chimie des matériaux? Covers solid-state chemistry, both inorganic and organic, and polymer chemistry,

Plus en détail

3. METHODES ALTERNATIVES

3. METHODES ALTERNATIVES POURQUOI? Inconvénients des méthodes classiques Besoins: Rapidité Précision Faible coût Spécificité Principe des méthodes alternatives: pas de mise en culture LES ACTIVITES ENZYMATIQUES PHOSPHATASES 4-paranitrophényl

Plus en détail

LES ACARIENS LE BOMBYX

LES ACARIENS LE BOMBYX LES ACARIENS De nombreuses espèces d acariens attaquent les arbres et arbustes d ornement. Larves, nymphes et adultes vident les cellules notamment dans les jeunes organes. Les symptômes observés dépendent

Plus en détail

Les vers marins. Deux embranchements représentent les vers marins de nos côtes littorales: les vers plats (plathelminthes) et les vers segmentés

Les vers marins. Deux embranchements représentent les vers marins de nos côtes littorales: les vers plats (plathelminthes) et les vers segmentés Les vers marins A partir des vers marins, les animaux se complexifient dans l organisation de leur tissus. Nous avons vu qu avec les coraux, les organismes possédaient deux feuillets séparés d une gelée.

Plus en détail

Introduction. «Les Dossiers de l Étrange» renferme nombre d énigmes,

Introduction. «Les Dossiers de l Étrange» renferme nombre d énigmes, Introduction «Les Dossiers de l Étrange» renferme nombre d énigmes, d histoires insolites et de mystères inexplicables. Elle vous entrainera dans un chaos thématique prédéterminé afin de vous plonger dans

Plus en détail

Etude comparative de solutions de nourrissement protéinées pour la production de gelée royale et

Etude comparative de solutions de nourrissement protéinées pour la production de gelée royale et Etude comparative de solutions de nourrissement protéinées pour la production de gelée royale et l élevage de reines B. Poirot, V. Nevers. APINOV, Pôle technologique 40 rue Chef de Baie 17 000 La Rochelle,

Plus en détail

Le compost. Un petit écosystème au jardin

Le compost. Un petit écosystème au jardin Le compost Un petit écosystème au jardin En utilisant du compost au jardin, nous rendons les matières organiques produites par le jardin ou par notre alimentation, à l écosystème naturel. Ainsi l écosystème

Plus en détail

Observer vision et image TP : Couleur. Couleurs

Observer vision et image TP : Couleur. Couleurs I) SYNTHESE ADDITIVE Couleurs I.1 Couleur spectrale et couleur perçue Lumière blanche et couleur spectrale Exp prof : décomposition de la lumière par un prisme (ou un réseau) Couleurs spectrales (exemples)

Plus en détail

Pour une meilleure qualité de vie

Pour une meilleure qualité de vie Cohabiter avec le Goéland à bec cerclé 3 Cohabiter avec le Goéland à bec cerclé Vous pouvez consulter cette publication sur le site Internet d Environnement Canada : www.qc.ec.gc.ca Vous pouvez aussi obtenir

Plus en détail

29- Les chaines alimentaires commence toujours par un. et se termine par un

29- Les chaines alimentaires commence toujours par un. et se termine par un Fiche de révision fin d'année 4 eme primaire Complète les phrases suivantes: 1- L'absorption des aliments digère à lieu à travers. 2- Les amidons sont digères par 3- La.. est la transformation des aliments.

Plus en détail

Qui bourdonne au jardin? Complément

Qui bourdonne au jardin? Complément Qui bourdonne au jardin? Complément 1. Bourdon terrestre Description : noir, jaune et blanc. Bande jaune à l avant du thorax. Très velu. Langue relativement courte. Ouvrière 11 à 17 mm, 4 ailes, dard à

Plus en détail

Chapitre 1 La perception de la lumière et des couleurs par l'œil humain

Chapitre 1 La perception de la lumière et des couleurs par l'œil humain 1 1 9 9 7 7 2 2 Perception des couleurs par l œil humain................ 4 La température des couleurs et la balance des blancs.......... 4 La compensation de la lumière par l œil................ Le gamma..............................

Plus en détail