Introduction à la bio-informatique

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "Introduction à la bio-informatique"

Transcription

1 Introduction à la bio-informatique Hélène Touzet Équipe Bioinfo LIFL USTL

2 A C G G T G C C T A ADN A U C C U A G Transcription ARN messager Traduction prote ine

3 fonction de la prote ines pre diction de ge nes A C G G T G C C T A A U C C U A G Transcription ARN messager ADN Traduction prote ine pre diction de structure comparaison de se quences

4 Quête du Graal de la bio-informatique... ctgcaggacgcctactaaggcggcggggaaaaacaaacgttattacaccgagacagaagg tgcactgcgttatgttgtcgcggacaacggcgaaaaggggctgaccttcgctgttgaacc aattaagttggcgctatctgantctcatactgtttcacagacctgctgccctgcggcggc caatcttcctttattcgcttataagcgtggagaattaaaatgcgacatcctttagtgatg ggtaactggaaactgaacggcagccgccacatggttcacgagctggtttctaacctgcgt aaagagctggcaggtgttgctggctgtgcggttgcaatcgcaccaccggaaatgtatatc gatatggcgaagcgcgaagctgaaggcagccacatcatgctgggtgcgcaaaacgtgaac ctgaacctgtccggcgcattcacgggtgaaacctctgctgctatgctgaaagacatcggc gcacagtacatcatcatcggtcactctgaacgtcgtacttaccacaaagaatctgacgaa ctgatcgcgaaaaaattcgcggtgctgaaagagcagggcctgactccggttctgtgcatc ggtgaaaccgaagctgaaaatgaagcgggcaaaactgaagaagtttgcgcacgtcagatc gacgcggtactgaaaactcagggtgctgcggcattcgaaggtgcggttatcgcttacgaa cctgtatgggcaatcggtactggcaaatctgcaactccggctcaggcacaggctgttcac aaattcatccgtgaccacatcgctaaagttgacgctaacatcgctgaacaagtgatcatt cagtacggcggctccgtaaacgcgtctaacgctgcagaactgtttgctcagccggatatc gacggcgcgctggttggtggtgcttctctgaaagctgacgccttcgcagtaatcgttaaa gctgcagaagcggctaaacaggcttaagtctgacaggtgccggatttcgatatccggcac ttactttccttaactcttcgccttaacgcaaaatctcacactgatgatcctgaatttcct cggctgaagcacggttaagcgtcagtagatttcgttgtgtcgccagcaatacaaatgagt tatcactctgccgtaccatcgccagcccgtagcgtcccatatgttcccgcgcctcaggta cttcttctgccagcatcataaatgggctgcgttgtaccagttcgctttccgttacccgac gcgcaggtattcatgcccgcgcaaaccacctggcagtggcaaccagcggctgctgatgtt cgccagattgttatcgag...

5 Quête du Graal de la bio-informatique... ctgcaggacgcctactaaggcggcggggaaaaacaaacgttattacaccgagacagaagg tgcactgcgttatgttgtcgcggacaacggcgaaaaggggctgaccttcgctgttgaacc aattaagttggcgctatctgantctcatactgtttcacagacctgctgccctgcggcggc caatcttcctttattcgcttataagcgtggagaattaaaatgcgacatcctttagtgatg ggtaactggaaactgaacggcagccgccacatggttcacgagctggtttctaacctgcgt aaagagctggcaggtgttgctggctgtgcggttgcaatcgcaccaccggaaatgtatatc gatatggcgaagcgcgaagctgaaggcagccacatcatgctgggtgcgcaaaacgtgaac ctgaacctgtccggcgcattcacgggtgaaacctctgctgctatgctgaaagacatcggc gcacagtacatcatcatcggtcactctgaacgtcgtacttaccacaaagaatctgacgaa ctgatcgcgaaaaaattcgcggtgctgaaagagcagggcctgactccggttctgtgcatc ggtgaaaccgaagctgaaaatgaagcgggcaaaactgaagaagtttgcgcacgtcagatc gacgcggtactgaaaactcagggtgctgcggcattcgaaggtgcggttatcgcttacgaa cctgtatgggcaatcggtactggcaaatctgcaactccggctcaggcacaggctgttcac aaattcatccgtgaccacatcgctaaagttgacgctaacatcgctgaacaagtgatcatt cagtacggcggctccgtaaacgcgtctaacgctgcagaactgtttgctcagccggatatc gacggcgcgctggttggtggtgcttctctgaaagctgacgccttcgcagtaatcgttaaa gctgcagaagcggctaaacaggcttaagtctgacaggtgccggatttcgatatccggcac ttactttccttaactcttcgccttaacgcaaaatctcacactgatgatcctgaatttcct cggctgaagcacggttaagcgtcagtagatttcgttgtgtcgccagcaatacaaatgagt tatcactctgccgtaccatcgccagcccgtagcgtcccatatgttcccgcgcctcaggta cttcttctgccagcatcataaatgggctgcgttgtaccagttcgctttccgttacccgac gcgcaggtattcatgcccgcgcaaaccacctggcagtggcaaccagcggctgctgatgtt cgccagattgttatcgag...

6 Quête du Graal de la bio-informatique MRHPLVMGNWKLNGSRHMVHELVSNLRKELAG VAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQ NVDLNLSGAFTGETSAAMLKDIGAQYIIIGHS ERRTYHKESDELIAKKFAVLKEQGLTPVLCIG ETEAENEAGKTEEVCARQIDAVLKTQGAAAFE GAVIAYEPVWAIGTGKSATPAQAQAVHKFIRD HIAKVDANIAEQVIIQYGGSVNASNAAELFAQ PDIDGALVGGASLKADAFAVIVKAAEAAKQA

7 Quête du Graal de la bio-informatique MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP AQAQAVHKEIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD AFAVIVKAAEAAKQA

8 Quête du Graal de la bio-informatique MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP [AV] Y E P [LIVM] W [SA] I G T[GK] AQAQAVHKEIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD AFAVIVKAAEAAKQA signature d un site actif triosphosphate isomérase

9 Quête du Graal de la bio-informatique MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP AQAQAVHKEIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD AFAVIVKAAEAAKQA Eléments de la structure secondaire hélice alpha feuillet beta Domaine conservé

10 Quête du Graal de la bio-informatique

11 Quête du Graal de la bio-informatique

12 biologie moléculaire bio-informatique 1865 théorie de l hérédité (Mendel) 1944 ADN support de l information génétique (Avery) 1951 première protéine séquencée insuline (Sanger) 1953 strcture en double hélice de l ADN (Watson-Crick) 1961 code génétique 1967 arbre phylogénétique (Nirenberg et Matthaei) 1970 comparaison de séquences 1974 prédiction de structures de protéines 1977 séquençage d ADN 1978 premières banques de données 1984 invention de la PCR 1980 alignement local 1990 programme international de séquençage du génome humain 1990 logiciel Blast 1996 génome de la levure 1991 prédiction de gènes 2000 brouillon du génome humain génomes

13 1978 : séquence du phage phix174 (premier génome à ADN, 5386 bp) Bactéries 1995 : Haemophilus Influenzae 1996 : Bacillus Subtilis 1996 : Escherichia Coli Eucaryotes 1990 : programme international de séquençage Génome Humain 1996 : levure (premier eucaryote) 1998 : Caenorhabditis Elegans ( pluri-cellulaire) 2000 : Arabidopsis Thaliana (premier génome de plante) 2000 : brouillon du génome humain Aujourd hui : 340 génomes publiés, 1500 en cours souris, drosophile, rat, zebra fish,maïs, poulet, chimpanzée, etc.

14 Les bases de données nucléiques International Nucleotide Sequence Database Collaboration Trois partenaires EMBL (Europe) Genbank (Etats-Unis) DDBJ (Japon) Contributeurs: organismes de recherche, programmes de séquençage Tous types de séquences chromosome, contigs, ARN messagers, EST,... Août 2005 : nucléotides organismes

15 Janvier 2006: nucléotides

16 Répartition par organismes (en nucléotides)

17 Les bases de données protéiques Structure Structure Structure Structure primaire secondaire tertiaire quaternaire Swissprot : séquences TrEMBL : séquences PDB : 243 structures

18 Les bases de données protéiques Swissprot : banques de protéines séquencées TrEMBL : banques de protéines prédites à partir d ARN messagers PDB : Protein Data Bank - banque de structures de protéines résolues expérimentalement cristallographie, résonance magnétique nucléaire Lien entre la séquence et la structure dans PDB, toutes les protéines avec plus de 25 % d identité partagent la même structure

19 La comparaison de séquences Assemblage de contigs (séquençage) Recherche de séquences homologues Prédiction de gènes Recherche d une fonction commune etc.

20 Exemple : l insuline éléphant hamster FVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTGVCSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKSGIVDQCCTSICSLYQLENYCN éléphant baleine FVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTGVCSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKAGIVEQCCASTCSLYQLENYCN éléphant alligator FVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTGVCSLYQLENYCN AANQRLCGSHLVDALYLVCGERGFFYSPKGGIVEQCCHNTCSLYQLENYCN

21 Alignement Mise en correspondance de deux séquences (ADN ou protéines) R D I S L V K N A G I R N I - L V S D A K N V G I 3 événements mutationnels élémentaires Score d une opération substitution } insertion indel délétion substitution : score de similarité indel : pénalité Le score de l alignement est la somme des scores élémentaires

22 2 séquences plusieurs alignements possibles R D I S L V K N A G I R D I - - S L V K N A G I R N I - L V S D A K N V G I R N I L V S D A K N V G I R D I - - S L V K N A G I R N I L V S D A K N V G I Scores : 19, -11 et 25 respectivement Bon/mauvais alignement? matrices de substitutions Mismatch : Match : Indel : G, N : 6 DN : 1 R, K : 5 5 AV, LD : 0 A, I, L, S, V : 4

23 2 séquences plusieurs alignements possibles R D I S L V K N A G I R D I - - S L V K N A G I R N I - L V S D A K N V G I R N I L V S D A K N V G I R D I - - S L V K N A G I R N I L V S D A K N V G I Scores : 19, -11 et 25 respectivement Bon/mauvais alignement? matrices de substitutions Mismatch : Match : Indel : G, N : 6 DN : 1 R, K : 5 5 AV, LD : 0 A, I, L, S, V : 4

24 Alignement global Needleman & Wunsch Évaluation d une ressemblance globale entre deux séquences Données deux séquences (nucléotides ou acides aminés), des scores de similarité et des pénalités. Problème Quel est l alignement de score maximal?

25 Algorithme Séquences ACGGCTAT et ACTGTAT, scores match = 2, mismatch = -1 et indel= -2. Que peut-il se passer pour la dernière opération? Substitution de T en T ACGGCTA T??? ACTGTA T score de ACGGCTA ACTGTA +2 Délétion de T ACGGCTA T??? ACTGTAT - score de ACGGCTA ACTGTAT 2 Insertion de T ACGGCTAT -??? ACTGTA T score de ACGGCTAT ACTGTA 2

26 Sim(i, j) : score optimal entre U(1..i) et V (1..j) Formule de récurrence : Sim(0, 0) = 0 Sim(0, j) = Sim(0, j 1) + Ins(V (j)) Sim(i, 0) = Sim(i 1, 0) + Del(U(i)) Sim(i 1, j 1) + Sub(U(i), V (j)) Sim(i, j) = max Sim(i 1, j) + Del(U(i)) Sim(i, j 1) + Ins(V (j))

27 Que se passe-t-il si on implémente ces formules de manière récursive

28 Programmation dynamique Formulation d problème sous forme récursive le problème est réduit à plusieurs instances plus petites, elle-mêmes résolues par décomposition. Stockage des résultats intermédiaires dans une table Extraction de la solution optimale à partir de la table Ici calculs intermédiaires = scores d alignements entre préfixes

29 Étape 1: création d une table indexée par les deux séquences. A C G G C T A T A C T G T A T Case (i, j) : score entre les i premières bases de ACGGCTAT et les j premières bases de ACTGTAT.

30 Étape 1: création d une table indexée par les deux séquences. Cas de base - initialisation aa A C G G C T A T A C T G T A T

31 Étape 1: création d une table indexée par les deux séquences. Remplissage ligne par ligne aa A C G G C T A T A C T G T A T

32 Étape 1: création d une table indexée par les deux séquences. Remplissage ligne par ligne aa A C G G C T A T A C T G T A T

33 Étape 2 : recherche du chemin des scores maximaux dans la matrice. A C G G C T A T A C T G T A T

34 Étape 3 : construction de l alignement Sur le chemin des scores maximaux, on regarde quelle est l opération correspondante. insertion délétion substitution ou identité Résultat A C G G C T A T A C T G - T A T

35 Complexité de l algorithme Pour le calcul du score d alignement : (étape 1) O(n m) en temps O(min{n, m}) en espace Pour la construction de l alignement : (étapes 1, 2 et 3) O(n m) en temps et en espace

36 Enrichissement du modèle: les scores Traitement des gaps Gap: succession de délétions ou d insertions correspond à un seul événement mutationnel (insertion ou disparition d un bloc). T C A G A C G A G T C T C A G A C G A G T C -> T C G G A - G C - T G T C G G A - - G C T G nouvelles pénalités :pénalité d ouverture de gap (exemple : -10) + pénalité d extension de gap (exemple : -0.5) Score de substitutions ADN : identité, transition/transversion Protéines : matrice pour les 20 acides aminés

37 Matrices pour les acides aminés: PAM, BLOSUM aliphatiques M V I L F Y C W A G G T S D E K H R P Q petits très petits positifs non polarisés aromatiques chargés polarisés

Algorithmes de comparaison de séquences

Algorithmes de comparaison de séquences Algorithmes de comparaison de séquences Hélène Touzet Équipe Bioinfo LIFL USTL Master recherche informatique www.lifl.fr/~touzet/masterrecherche.html Pourquoi comparer des séquences? Puisque c est la structure

Plus en détail

Cours 1. Comment tout savoir sur la biologie moléculaire en moins de 90 minutes?... quitte à faire quelques simplifications

Cours 1. Comment tout savoir sur la biologie moléculaire en moins de 90 minutes?... quitte à faire quelques simplifications Cours 1 Comment tout savoir sur la biologie moléculaire en moins de 90 minutes?... quitte à faire quelques simplifications Hélène Touzet La cellule 2 Que trouve-t-on dans une cellule? 30% ions,... 4% phospolipides

Plus en détail

Alignements de deux séquences

Alignements de deux séquences Alignements de deux séquences Informatique Génomique - Master 1 Guillaume Blin IGM-LabInfo UMR 8049, Bureau 4B066 Université de Marne La Vallée gblin@univ-mlv.fr http://igm.univ-mlv.fr/ gblin 2007-08 Plan

Plus en détail

Introduction à l Analyse des séquences biologiques.

Introduction à l Analyse des séquences biologiques. Introduction à l Analyse des séquences biologiques Christian.Fondrat@dsi.univ-paris5.fr Les outils d analyse de séquences C est QUOI? DES BASES DE DONNEES DES PROGRAMMES Utilitaires (consultation, acquisition

Plus en détail

AVL Liban La Bioinformatique. Bioinformatique

AVL Liban La Bioinformatique. Bioinformatique AVL Liban 2011 La Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu www.cs.sjsu.edu/faculty/khuri Sami Khuri sami.khuri@sjsu.edu Qu est-ce

Plus en détail

Alignement de séquences (2/2)

Alignement de séquences (2/2) Alignement de séquences (2/2) Observation à l aide de l outil graphique : le dotplot. Simple, visuel, Très informatif : Permet de repérer une similarité globale Permet de repérer des similarités locales

Plus en détail

Alignements de séquences

Alignements de séquences de séquences Problématique Matrices de points Distance d édition + calcul d un alignement optimal Qu est-ce qu une distance Méthode naïve: énumération de tous les alignements possibles Programmation dynamique

Plus en détail

Recherche de similarités au moyen de BLAST

Recherche de similarités au moyen de BLAST Recherche de similarités au moyen de BLAST Guy Perrière Laboratoire de Biométrie et Biologie Évolutive UMR CNRS 5558 Université Claude Bernard Lyon 1 http://pbil.univ-lyon1.fr/members/perriere/cours/m1/

Plus en détail

Introduction. Alignement multiple = Alignement simultané de plusieurs séquences (Nt ou Prot)

Introduction. Alignement multiple = Alignement simultané de plusieurs séquences (Nt ou Prot) Introduction Alignement multiple = Alignement simultané de plusieurs séquences (Nt ou Prot) Outil essentiel pour : Signatures protéiques Homologie avec une famille de protéines particulière Structure secondaire

Plus en détail

Alignement Multiple de séquences

Alignement Multiple de séquences Alignement Multiple de séquences Introduction Alignement multiple = Alignement simultané de plusieurs séquences (Nt ou Prot) Outil essentiel pour : Signatures protéiques Homologie avec une famille de protéines

Plus en détail

Structures des ARN.

Structures des ARN. Structures des RN Hélène TOZET touzet@lifl.fr Structure secondaire de l RN ppariements : Watson-rick :, Wobble :,,... Pseudo-nœuds Triplets de bases Exemple : RN de transfert (lanine E. coli) Structure

Plus en détail

BIOINFORMATIQUE APPLIQUÉE - CHMI 3206 F. Professeur : Eric R. Gauthier. Test de mi-session. 31 octobre Votre nom :

BIOINFORMATIQUE APPLIQUÉE - CHMI 3206 F. Professeur : Eric R. Gauthier. Test de mi-session. 31 octobre Votre nom : BIOINFORMATIQUE APPLIQUÉE - CHMI 3206 F Professeur : Eric R. Gauthier Test de mi-session 31 octobre 2006 Votre nom : Consignes : 1) Durée : 85 min 2) 5 questions sur 5 pages, pour 80 points. Compte pour

Plus en détail

Introduction à la comparaison de séquences

Introduction à la comparaison de séquences Introduction à la comparaison de séquences - Université de Lille 1-2 eme Semestre Pourquoi comparer des séquences Recherche de similarités. Déterminer si des séquences sont homologues. Rechercher les exons/introns....

Plus en détail

Introduction à l annotation des protéines

Introduction à l annotation des protéines Introduction à l annotation des protéines - Université de Lille 1-2 eme Semestre Pistes sur les fonctions des protéines Comparaison aux banques de séquences Recherche dans les banques de motifs ou domaines

Plus en détail

Comparaison et alignement. de séquences LV348 -BI. Sophie Pasek

Comparaison et alignement. de séquences LV348 -BI. Sophie Pasek Comparaison et alignement de séquences LV348 -BI Sophie Pasek sophie.pasek@upmc.fr Comment comparer deux séquences? Le Dot-Plot Tableau indexé par les caractères des deux séquences Identité : Non Identité:

Plus en détail

Algorithmes pour la comparaison de séquences II

Algorithmes pour la comparaison de séquences II Algorithmes pour la comparaison de séquences II Hélène TOUZET touzet@lifl.fr Equipe Bioinfo Master recherche informatique www.lifl.fr/~touzet/masterrecherche.html Pourquoi comparer des séquences? Puisque

Plus en détail

Banques de Données de séquences

Banques de Données de séquences Banques de Données de séquences D après cours de l équipe Bonsai, CRIStAL UMR 9189 Sylvain.legrand@univ-lille1.fr 7 et 8 Septembre 2016 Sylvain Legrand Introduction Définition bioinformatique Un domaine

Plus en détail

M2 - STL. Algorithmes sur les séquences en bioinformatique. Qu est-ce que la bioinformatique? Cours 1: Introduction

M2 - STL. Algorithmes sur les séquences en bioinformatique. Qu est-ce que la bioinformatique? Cours 1: Introduction M2 - STL Qu est-ce que la bioinformatique? Algorithmes sur les séquences en bioinformatique La bioinformatique est définie d habitude comme l analyse, la prédiction et la modélisation de données biologiques

Plus en détail

Exemple 1 - heat shock protein beta 9. Comparaison de séquences deux à deux. Exemple 3 : domaine conservé. Exemple 2 - E.coli peptidyl trna hydrolase

Exemple 1 - heat shock protein beta 9. Comparaison de séquences deux à deux. Exemple 3 : domaine conservé. Exemple 2 - E.coli peptidyl trna hydrolase Exemple 1 - heat shock protein beta 9 Comparaison de séquences deux à deux >human MQRVGNTFSN ESRVSRCPS VGLERNRV TMPVRLLRDS PQEDNDH RDGFQMKLD HGFPEELVV QVDGQWLMVT GQQQLDVRDP ERVSYRMSQK VHRKMLPSNL SPTMTCCLT

Plus en détail

A BIOINFORMATIQUE FONCTIONNELLE

A BIOINFORMATIQUE FONCTIONNELLE Biologie moléculaire-2017 1 A BIOINFORMATIQUE FONCTIONNELLE PRÉDIRE LA FONCTION D UNE PROTÉINE INCONNUE Supposons que vous avez trouvé la séquence d'acides aminés d'une protéine inconnue et que vous souhaitez

Plus en détail

Alignement de séquences

Alignement de séquences Bioinformatique appliquée ours lignement de séquences principes un algorithme d'alignement: programmation dynamique alignement global, alignement local -- Les comparaisons de séquences DOPLO j'ai séquences,

Plus en détail

Master 1 IUP Génomique et Protéomique Examen de GP4 - Bioinformatique

Master 1 IUP Génomique et Protéomique Examen de GP4 - Bioinformatique Master 1 IUP Génomique et Protéomique Examen de GP4 - Bioinformatique Exercice 1 : banques de données. Durée de l épreuve : 2h Documents autorisés Q1) Le schéma ci-dessous représente le nombre d articles

Plus en détail

Modélisation et recherche de motifs biologiques

Modélisation et recherche de motifs biologiques Modélisation et recherche de motifs biologiques Hélène Touzet Équipe Bioinfo LIFL USTL Licence Master Motifs biologiques Motifs approchés décrits par un modèle ADN : sites de fixation de facteurs de transcription,...

Plus en détail

Biologie moléculaire. Les gènes et leurs fonctions

Biologie moléculaire. Les gènes et leurs fonctions Liste d exercices 3i019 Biologie moléculaire 1. Définissez ce qu est un génome. 2. Expliquer les différences entre les molécules d ADN et d'arn. 3. Expliquer le processus de réplication de l ADN. 4. Expliquer

Plus en détail

L ADN (DNA) Dans tous ses états. Présentation du TP

L ADN (DNA) Dans tous ses états. Présentation du TP L ADN (DNA) Dans tous ses états et Présentation du TP Depuis quand est-il connu? - 1855 Louis Pasteur - 1865 Mendel Depuis quand est-il connu? - 1869 Friedrich Miescher Nucléine - 1889 Richard Altman Nucléine

Plus en détail

Introduction. La bioinformatique : Traitement des informations biologiques par des méthodes informatiques et/ou mathématiques.

Introduction. La bioinformatique : Traitement des informations biologiques par des méthodes informatiques et/ou mathématiques. Introduction La bioinformatique : Traitement des informations biologiques par des méthodes informatiques et/ou mathématiques. Interdisciplinaire par nature, la bioinformatique est fondée sur les acquis

Plus en détail

Biologie Moléculaire et Organismes Modèles

Biologie Moléculaire et Organismes Modèles Biologie Moléculaire et Organismes Modèles Sami Khuri Department of Computer Science San José State University khuri@cs.sjsu.edu Plan du Cours Biologie Moléculaire et Organismes Modèles Qu est-ce que la

Plus en détail

Algorithmes sur les arbres et les graphes en bioinformatique

Algorithmes sur les arbres et les graphes en bioinformatique M2 - IAD Algorithmes sur les arbres et les graphes en bioinformatique Cours 1: Introduction Alessandra Carbone Université Pierre et Marie Curie Programme du cours 1. Introduction aux mécanismes biologiques

Plus en détail

Introduction à l annotation de séquences

Introduction à l annotation de séquences Introduction à l annotation de séquences - Université de Lille 1-2 eme Semestre But de l annotation de séquences Les séquences nucléiques : Détecter la présence de gènes Trouver la structure des gènes

Plus en détail

Présentation de l applet de recherche de gènes

Présentation de l applet de recherche de gènes Présentation de l applet de recherche de gènes Régis Monte et François Rechenmann INRIA Rhône-Alpes Juin 2005 Cette applet vous permet de chercher, dans une sous-séquence du génome de la bactérie B. subtilis,

Plus en détail

Initiation à la Bioinformatique

Initiation à la Bioinformatique Université d Alexandrie Initiation à la Bioinformatique Basic Local Alignment Search Tool BLAST Université d Alexandrie AUF Auteur(s): Mohamed GAD 2009/2010 Auteur(s) : Mohamed GAD Professeur à l institut

Plus en détail

ORGANISATION MOLÉCULAIRE DES GÈNES ET RÉPLICATION DE L ADN

ORGANISATION MOLÉCULAIRE DES GÈNES ET RÉPLICATION DE L ADN ORGANISATION MOLÉCULAIRE DES GÈNES ET RÉPLICATION DE L ADN I- Définition moléculaire du gène Génos qui donne naissance Classe II (structure) Classe III Classe I Gène A Gène B Gène C mrna trna rrna Protéines

Plus en détail

Quelques définitions et notions génétiques pour commencer

Quelques définitions et notions génétiques pour commencer La CODOMINANCE le phénotype de l hétérozygote est intermédiaire entre les phénotypes des deux homozygotes, et on a 1 génotype = 1 phénotype Quelques définitions et notions génétiques pour commencer Le

Plus en détail

Alignements multiples

Alignements multiples Alignements multiples Celine Brochier celine.brochier@up.univ-mrs.fr http://194.57.197.233:800/ 04.91.10.64.75 Intérêt des alignements multiples Caractérisation des familles multigéniques Démontrer l homologie

Plus en détail

Chapitre 3 : L expression de l information génétique. Activité 1 : Les deux étapes de l expression de l information génétique

Chapitre 3 : L expression de l information génétique. Activité 1 : Les deux étapes de l expression de l information génétique Connaissances L'ADN contient des unités d'information appelées gènes. Le génome est l ensemble du matériel génétique d un organisme. Chez les eucaryotes, la transcription a lieu dans le noyau, la traduction

Plus en détail

LES BASES MOLECULAIRES DE L ORGANISATION DU GENOME HUMAIN

LES BASES MOLECULAIRES DE L ORGANISATION DU GENOME HUMAIN LES BASES MOLECULAIRES DE L ORGANISATION DU GENOME HUMAIN I. STRUCTURE DE L ADN Le génome humain est contenu dans des NOYAUX (EUCARYOTES) Petite quantité d ADN en dehors du noyau dans la MITOCHONDRIE Sous

Plus en détail

Introduction à l Algorithmique et la Programmation feuille de Projet Alignement de Séquences

Introduction à l Algorithmique et la Programmation feuille de Projet Alignement de Séquences Introduction à l Algorithmique et la Programmation feuille de Projet Alignement de Séquences Le thème de ce projet est l alignement de séquences. Il permet d illustrer comment les principes algorithmiques

Plus en détail

Alignement multiple H el` ene Touzet

Alignement multiple H el` ene Touzet Alignement multiple Hélène Touzet Alignement 2 à 2 2 séquences quelconques détection d une similarité syntaxique? fonction commune? Alignement multiple Famille de séquences partageant une même fonction

Plus en détail

Taille des génomes. Exemple génomes eucaryotes. Exemple génomes procaryotes. Mycoplasma genitalium 0,58. Heamophilus influenzae 1,8

Taille des génomes. Exemple génomes eucaryotes. Exemple génomes procaryotes. Mycoplasma genitalium 0,58. Heamophilus influenzae 1,8 Taille des génomes Exemple génomes procaryotes Exemple génomes eucaryotes Species Genome size (Mb) Bacteria Mycoplasma genitalium 0,58 Heamophilus influenzae 1,8 Escherichia coli K12 4,6 Bacillus subtilis

Plus en détail

Vivant ou non vivant?

Vivant ou non vivant? Vivant ou non vivant? Vivant ou non vivant? BACTERIE Cellule animale Cellule végétale Problématique: Les êtres vivants sont I. Les éléments chimiques des êtres vivants Le non vivant Le vivant Un méduse

Plus en détail

LES BASES MOLÉCULAIRES DE L HÉRÉDITÉ Archibald Garrod Reginald Punnett and William Bateson 1907

LES BASES MOLÉCULAIRES DE L HÉRÉDITÉ Archibald Garrod Reginald Punnett and William Bateson 1907 ADN : matériel génétique LES BASES MOLÉCULAIRES DE L HÉRÉDITÉ 1909 Archibald Garrod Reginald Punnett and William Bateson 1907 Du gène à la protéine Les protéines représentent le lien entre le génotype

Plus en détail

Prédiction de gènes. Licence master

Prédiction de gènes. Licence master Prédiction de gènes Hélène Touzet Licence master Deux approches 1. Prédiction par similitude comparaison à des banques d EST EST : expressed sequence tags outil de localisation : BLST comparaison à des

Plus en détail

Licence master

Licence master Prédiction de gènes Hélène Touzet Licence master www.lifl.fr/~touzet/m1/ Deux approches 1. Prédiction par similitude comparaison à des banques d EST EST : expressed sequence tags outil de localisation

Plus en détail

Heuristiques pour l alignement et la recherche dans les banques de données biologiques

Heuristiques pour l alignement et la recherche dans les banques de données biologiques Heuristiques pour l alignement et la recherche dans les banques de données biologiques Plan I. Introduction II. Matrices de substitutions: PAM, BLOSUM III. Algorithmes de Filtrage Basés sur la recherche

Plus en détail

Développement d un modèle d alignements flexibles pour la reconnaissance de repliements des protéines

Développement d un modèle d alignements flexibles pour la reconnaissance de repliements des protéines Développement d un modèle d alignements flexibles pour la reconnaissance de repliements des protéines Guillaume Collet INRA, unité Mathématique, Informatique et Génome 26 juin 2006 Guillaume Collet (MIG)

Plus en détail

Chapitre 4 : un regard sur l'évolution de l'homme Objectif : l'évolution de l'homme - B2I

Chapitre 4 : un regard sur l'évolution de l'homme Objectif : l'évolution de l'homme - B2I Objectif : l'évolution de l'homme - B2I Observation : l Homme (Homo sapiens) a une histoire évolutive qui s inscrit au sein d'autres espèces en particulier les Primates. Problème : comment placer l'homme

Plus en détail

Introduction à la bioinformatique

Introduction à la bioinformatique Faculté des Sciences - Rabat Laboratoire de Microbiologie et Biologie Moléculaire -------------------------------------- Université Mohamed V - Agdal Faculté des Sciences B.P. 1014 - Rabat - MAROC TD Biologie

Plus en détail

Bioinformatique Appliquée Recherche de similitudes

Bioinformatique Appliquée Recherche de similitudes Besoin d'accélérer la recherche de similitude dans une banque Bioinformatique Appliquée Recherche de similitudes La recherche de similitude permet de comparer une séquence appelée requête (query) à une

Plus en détail

Construisez un arbre phylogénétique!

Construisez un arbre phylogénétique! Construisez un arbre phylogénétique! Il est possible de construire un arbre phylogénétique à partir de différents types de données: - les données morphologiques (écailles ou plumes, présence de certains

Plus en détail

Brin transcrit : chaine de l ADN qui, par complémentarité des nucléotides, sert de modèle pour la synthèse de l ARN messager

Brin transcrit : chaine de l ADN qui, par complémentarité des nucléotides, sert de modèle pour la synthèse de l ARN messager Fin du cours chap 5 La transcription : de l ADN à l ARN : Par définition, le brin transcrit est le brin d ADN complémentaire de l ARN : c est le brin qui sert à la synthèse de l ARN, donc ici le brin2.

Plus en détail

Vivant ou non vivant?

Vivant ou non vivant? Vivant ou non vivant? Vivant ou non vivant? BACTERIE Cellule animale Cellule végétale Les êtres vivants sont constitués de cellules. Problématique: Quels sont les constituants de la matière du vivant?

Plus en détail

3I019 : Travaux Pratiques

3I019 : Travaux Pratiques 3I019 : Travaux Pratiques Alignement par paire Responsables. Hugues Richard (hugues.richard@upmc.fr) et Juliana Silva-Bernardes (juliana.silva_bernardes@upmc.fr). Enseignants TP. Yasaman Karami (yasamankarami@gmail.com)

Plus en détail

X- Rôles multiples de l ARN. A- L ARN catalytique

X- Rôles multiples de l ARN. A- L ARN catalytique X- Rôles multiples de l ARN A- L ARN catalytique ! Seules les protéines ont une activité catalytique : idée profondément ancrée en biochimie! Arguments Structures tridimensionnelles variées Diversité chaînes

Plus en détail

Programmation dynamique. La méthode est longue à la main! Mais elle peut être informatisée => TD et TP

Programmation dynamique. La méthode est longue à la main! Mais elle peut être informatisée => TD et TP Programmation dynamique La méthode est longue à la main! Mais elle peut être informatisée => TD et TP 91 Matrices nucléiques de substitution Pour l'instant, nous avons considéré en cas de substitution

Plus en détail

BIOCHIMIE ET BIOLOGIE MOLECULAIRE Biochimie des acides nucléiques et de l information génétique (Professeur Joël Lunardi - PCEM )

BIOCHIMIE ET BIOLOGIE MOLECULAIRE Biochimie des acides nucléiques et de l information génétique (Professeur Joël Lunardi - PCEM ) BIOCHIMIE ET BIOLOGIE MOLECULAIRE Biochimie des acides nucléiques et de l information génétique (Professeur Joël Lunardi - PCEM1 2006-2007) CHAPITRE 1. INTRODUCTION CHAPITRE 2. LES ACIDES NUCLEIQUES I.

Plus en détail

Les principales bases de données en bioinformatique

Les principales bases de données en bioinformatique Les principales bases de données en bioinformatique 156 Bases de données en bioinformatique Nombreuses bases de données en bioinformatique Données issues d'expériences, de publications, d'analyses faites

Plus en détail

Cours de Biologie moléculaire de Licence professionnelle 2011

Cours de Biologie moléculaire de Licence professionnelle 2011 Cours de Biologie moléculaire de Licence professionnelle 2011 Sommaire 1. Introduction 2.1. La structure de l ADN 2.2. La structure de l ARN 2.3. Du gène à la protéine 2.3.1. La réplication 2.3.2. La transcription

Plus en détail

Informatique et biologie moléculaire

Informatique et biologie moléculaire UE09s Méthodes d étude et analyse du génome Techniques d analyse des gènes à grande échelle Bio-informatique PACES 2013-2014 Dr Nicolas SEVENET Informatique et biologie moléculaire Avertissement Utilisation

Plus en détail

LA BIOLOGIE SYNTHETIQUE. Qu est-ce que c est?

LA BIOLOGIE SYNTHETIQUE. Qu est-ce que c est? LA BIOLOGIE SYNTHETIQUE Qu est-ce que c est? L ADN Qu est-ce: L ADN Molécule renfermant l'ensemble des informations nécessaires au développementet au fonctionnementd'un organisme. Support de l'hérédité:

Plus en détail

éléments répétés gènes des ARN stables (ARNr, ARNt) gènes protéiques Nb de gènes, taille du génome et complexité pseudogènes régions régulatrices

éléments répétés gènes des ARN stables (ARNr, ARNt) gènes protéiques Nb de gènes, taille du génome et complexité pseudogènes régions régulatrices Plan 3. Annotation des génomes a) Annotation structurale : localisation des éléments génétiques éléments répétés gènes des ARN stables (ARNr, ARNt) gènes protéiques Nb de gènes, taille du génome et complexité

Plus en détail

Introduction à la bioinformatique structurale sous Linux

Introduction à la bioinformatique structurale sous Linux Introduction à la bioinformatique structurale sous Linux Karim Mezhoud Ir. agronome PhD. Toxicologie, Protéomique, Bioinformatique Centre national des Sciences et Technologies Nucléaires Sidi Thabet Tunis

Plus en détail

Alignement de séquences biologiques

Alignement de séquences biologiques lignement de séquences biologiques Nadia El-Mabrouk Inspiré de: n introduction de Bioinformatics lgorithms www.bioalgorithms.info Neil C. Jones and Pavel. Pevzner Motivation Identification des gènes: Est-ce

Plus en détail

Du gène à la Protéine. Réplication Transcription Traduction

Du gène à la Protéine. Réplication Transcription Traduction Du gène à la Protéine Réplication Transcription Traduction Transfert bidirectionnel de «messages»; de protéines,etc.. Membrane Nucléaire ADN Information Information Réplication Dogme de la biologie moléculaire

Plus en détail

Microbiologie BIOL La génétique microbienne: les mécanismes de la variation génétique

Microbiologie BIOL La génétique microbienne: les mécanismes de la variation génétique Microbiologie BIOL 3253 La génétique microbienne: les mécanismes de la variation génétique Reproduction sexuée et asexuée Contrairement aux organismes eucaryotes, les procaryotes n effectuent pas de reproduction

Plus en détail

Alignement de séquences Principes et méthodes. Karim Mezhoud Ir. agronome PhD. Toxicologie, Protéomique, Bioinformatique

Alignement de séquences Principes et méthodes. Karim Mezhoud Ir. agronome PhD. Toxicologie, Protéomique, Bioinformatique lignement de séquences Principes et méthodes Karim Mezhoud Ir. agronome PhD. oxicologie, Protéomique, Bioinformatique entre national des Sciences et echnologies Nucléaires Sidi habet unis Pourquoi analyser

Plus en détail

REFERENTIEL : GENOTYPE ET PHENOTYPE

REFERENTIEL : GENOTYPE ET PHENOTYPE REFERENTIEL : GENOTYPE ET PHENOTYPE CONNAITRE Du gène à la protéine La structure de l ADN La séquence codante Le code génétique Les niveaux de phénotypes O.G.M. Définition du gène Double chaîne de nucléotides

Plus en détail

Bio-informatique et bio-analyse :

Bio-informatique et bio-analyse : Fiche 1 Bio-informatique et bio-analyse : Jean-Loup Risler La «bio-informatique». J entends ce mot depuis bien longtemps, mais je ne sais toujours pas ce qu il veut dire Je me souviens d une rencontre

Plus en détail

Examen de Biologie moléculaire 2011(1, 2), Faculté des Sciences-Semlalia, Université Cadi Ayyad, Marrakech, Maroc. Durée 1 heure

Examen de Biologie moléculaire 2011(1, 2), Faculté des Sciences-Semlalia, Université Cadi Ayyad, Marrakech, Maroc. Durée 1 heure Examen de Biologie moléculaire 2011(1, 2), Faculté des Sciences-Semlalia, Université Cadi Ayyad, Marrakech, Maroc. Durée 1 heure Examen 1 (Corrections 1) -- Examen 2 (Corrections 2) -- Examen 1 - Partie

Plus en détail

AVL Liban 2011 Biologie Moléculaire et Organismes Modèles

AVL Liban 2011 Biologie Moléculaire et Organismes Modèles AVL Liban 2011 Biologie Moléculaire et Organismes Modèles Sami Khuri Department of omputer Science San José State University San José, alifornia, USA sami.khuri@sjsu.edu www.cs.sjsu.edu/faculty/khuri Plan

Plus en détail

Interactions protéine-protéine:

Interactions protéine-protéine: Interactions protéine-protéine: des réseaux globales à l'atome... Interactions protéine-protéine Introduction et Prédiction des réseaux d'interactions (JS) Mesure des réseaux d'interactions (EB) Interactions

Plus en détail

THEME 1 A. Chapitre 3 : expression du patrimoine génétique

THEME 1 A. Chapitre 3 : expression du patrimoine génétique THEME 1 hapitre 3 : expression du patrimoine génétique I LES ENES ONTROLENT L SYNTHESE DES PROTEINES - les protéines, des macromolécules essentielles aux cellules. (F n 7) Les fonctions essentielles des

Plus en détail

Bioinformatique dans l IUP

Bioinformatique dans l IUP Bioinformatique dans l IUP Intervenants Equipe Bioinfo (Laboratoire d Informatique Fondamentale de Lille) Cours : Jean-Stéphane Varré (jean-stephane.varre@lifl.fr) TD sur machine : Jean-Stéphane Varré,

Plus en détail

Du galactose à la glycolyse. Approche génétique. Intérieur de la cellule

Du galactose à la glycolyse. Approche génétique. Intérieur de la cellule Du galactose à la glycolyse. Approche génétique Perméase Milieu extérieur Intérieur de la cellule Analyse génétique 2 sites mutés 1 souche de levure m5 double mutante [gal-, lys-] Double mutant Quel déterminisme

Plus en détail

S1133: Bases de données en bioinformatique

S1133: Bases de données en bioinformatique S1133: Bases de données en bioinformatique Chloé-Agathe Azencott 2016 Objectifs Savoir où et comment chercher un type spécifique d information sur un gène, une protéine, ou une mutation. Connaître les

Plus en détail

Distance d édition. Pour comparer des séquences, on va définir une distance:

Distance d édition. Pour comparer des séquences, on va définir une distance: Distance d édition Pour comparer des séquences, on va définir une distance: Définition: Une distance D est une relation ayant les propriétés suivantes: D(x, x)=0 D(x, y)=d(y, x) D(x, z) apple D(x, y)+d(y,

Plus en détail

Partie 1 : Les acides uncléiques. Chapitre 1 La structure des nucléotides Les bases Les oses Les nucléosides 9

Partie 1 : Les acides uncléiques. Chapitre 1 La structure des nucléotides Les bases Les oses Les nucléosides 9 Avant-propos III Partie 1 : Les acides uncléiques Chapitre 1 La structure des nucléotides 2 1. Les bases 2 2. Les oses 8 3. Les nucléosides 9 4. L acide phosphorique 10 5. Les nucléotides 11 6. Les polynucléotides

Plus en détail

Chapitre 7 Les acides nucléiques

Chapitre 7 Les acides nucléiques Chapitre 7 Les acides nucléiques Section 3: La réplication de l ADN http://highered.mcgrawhill.com/olcweb/cgi/pluginpop.cgi?it=swf::535::535::/sites/dl/free/0072 437316/120076/micro04.swf::DNA%20Replication%20Fork

Plus en détail

Corrigé série N 2. Exercice 1 QCS (V/F)

Corrigé série N 2. Exercice 1 QCS (V/F) Exercice 1 Corrigé série N 2 QCS (V/F) V1-Les acides nucléiques sont des polymères de nucléotides F2-Un nucléotide est un enchaînement base glucide F3-Les bases azotées sont toutes complémentaires F4-Les

Plus en détail

[CAHIER MODULE GENETIQUE ] FACULTE DE MEDECINE D ALGER.DEPARTEMENT DE MEDECINE.CYCLE GRADUE COMITE PEDAGOGIQUE GENETIQUE

[CAHIER MODULE GENETIQUE ] FACULTE DE MEDECINE D ALGER.DEPARTEMENT DE MEDECINE.CYCLE GRADUE COMITE PEDAGOGIQUE GENETIQUE 1ére ANNEE FACULTE DE MEDECINE D ALGER.DEPARTEMENT DE MEDECINE.CYCLE GRADUE COMITE PEDAGOGIQUE GENETIQUE [CAHIER MODULE GENETIQUE ] Dans ce cahier vous trouverez les informations relatives au module :

Plus en détail

BIOINFORMATIQUE APPLIQUEE (BI4U2) EXAMEN DE SECONDE SESSION JUIN 2013

BIOINFORMATIQUE APPLIQUEE (BI4U2) EXAMEN DE SECONDE SESSION JUIN 2013 Année universitaire 2012/2013 Site : X Luminy X St-Charles o St-Jérôme o Cht-Gombert o Aix-Montperrin o Aubagne-SATIS Sujet session de : o 1 er semestre - o 2 ème semestre - X Session 2 Examen de : X L1/L2/oL3

Plus en détail

EXPRESSION, STABILITÉ ET VARIATION DU PATRIMOINE GÉNÉTIQUE

EXPRESSION, STABILITÉ ET VARIATION DU PATRIMOINE GÉNÉTIQUE Première S - Cours 1 suite EXPRESSION, STABILITÉ ET VARIATION DU PATRIMOINE GÉNÉTIQUE III. Relations complexes entre génotype et phénotype : 1 ) Les différentes échelles d un phénotype : Rappel : Le génotype

Plus en détail

Module de Bioinformatique appliquée. GB Karine Robbe-Sermesant Romain Gautier

Module de Bioinformatique appliquée. GB Karine Robbe-Sermesant Romain Gautier Module de Bioinformatique appliquée à l analyse des séquences GB3 2012-2013 Karine Robbe-Sermesant Romain Gautier Objectifs du module Bioinformatique appliquée à l analyse des séquences Comprendre et apprendre

Plus en détail

Biologie cellulaire. Cours 8 : Synthèse des protéines

Biologie cellulaire. Cours 8 : Synthèse des protéines Département des Troncs Communs Sciences de la Nature Faculté des Sciences de la Nature et de la Vie Université Abderrahmane Mira de Bejaia Biologie cellulaire Cours 8 : Synthèse des protéines Année universitaire

Plus en détail

Transcription ??? NOYAU. ARNm. ADN Séquence de nucléotides : transmission de l info pour produire la protéine

Transcription ??? NOYAU. ARNm. ADN Séquence de nucléotides : transmission de l info pour produire la protéine NOYAU Transcrip ARNm ADN Séquence de nucléotides : transmission de l info pour produire la protéine??? Séquence de nucléotides = gène qui contient l info pr synthétiser une protéine Séquence d acides aminés

Plus en détail

Chapitre 1 La recherche de parentés chez les Vertébrés. L établissement de phylogénies. I Critères de comparaison. A Données embryologiques

Chapitre 1 La recherche de parentés chez les Vertébrés. L établissement de phylogénies. I Critères de comparaison. A Données embryologiques Chapitre 1 La recherche de parentés chez les Vertébrés. L établissement de phylogénies. Les êtres vivants, très diversifiés, partagent pourtant des propriétés communes : - une structure cellulaire - un

Plus en détail

Biotechnologie et médicaments biologiques

Biotechnologie et médicaments biologiques Biotechnologie et médicaments biologiques I. Les médicaments biologiques 1. Marché biopharmaceutique 2. Différents types de médicaments biologiques 2.1. Les protéines 2.2. Les anticorps monoclonaux 2.1.1.

Plus en détail

INTRODUCTION À LA BIO-INFORMATIQUE

INTRODUCTION À LA BIO-INFORMATIQUE Biologie moléculaire-2017 1 INTRODUCTION À LA BIO-INFORMATIQUE Dans cette section, on désire vous donner une introduction sur l utilisation du site web du National Center for Biotechnology Information

Plus en détail

Thème 1A-Expression, stabilité et variation du programme génétique

Thème 1A-Expression, stabilité et variation du programme génétique Extrait du bulletin officiel : Thème 1. La Terre dans l Univers, la vie et l évolution du vivant Thème 1 - A Expression, stabilité et variation du patrimoine génétique Ce thème s appuie sur les connaissances

Plus en détail

DS n 2 : Expression de l information génétique, réplication de l'adn et hérédité

DS n 2 : Expression de l information génétique, réplication de l'adn et hérédité DS n 2 : Expression de l information génétique, réplication de l'adn et hérédité I. La cellule 2 µm ------------- Dessin d une cellule animale I.1. Légender la cellule sur le polycopié. I.2. Retrouver

Plus en détail

Fiche technique : utilisation d Anagène en ligne

Fiche technique : utilisation d Anagène en ligne Fiche technique : utilisation d Anagène en ligne La nouvelle version du logiciel Anagène en ligne permet de réaliser des TP de génétique dans des domaines aussi variés que la synthèse protéique, les comparaisons

Plus en détail

Profile personnel. Naissance de cheveux. Lobe de l oreille. Articulation du pouce. Mains pliés. Ligne du nez

Profile personnel. Naissance de cheveux. Lobe de l oreille. Articulation du pouce. Mains pliés. Ligne du nez Profile personnel Naissance de cheveux Lobe de l oreille Articulation du pouce Mains pliés Ligne du nez Unité 2: la génétique Vocabulaire :Utilisez Ch 4.1 et 4.2 (pages 120-131) dans le texte de Biologie

Plus en détail

Analyse in-silico de séquences biologiques

Analyse in-silico de séquences biologiques Analyse in-silico de séquences biologiques Carl Herrmann IBDML Université de la Méditerranée herrmann@ibdm.univ-mrs.fr année 2006-2007 1 Génomique "traditionnelle" organisme à séquencer séquençage "contigs"

Plus en détail

Projet MINT Les valises ADN et caeno

Projet MINT Les valises ADN et caeno Projet MINT Les valises ADN et caeno Dr. Marie-Pierre Chevron Faculté des lettres CERF Dr. Chantal Wicky Faculté des sciences Département de biologie Chinese scientists genetically modify human embryos

Plus en détail

Algorithmes pour la comparaison d ARN : distance d édition entre arbres. Serge Dulucq (LABRI)

Algorithmes pour la comparaison d ARN : distance d édition entre arbres. Serge Dulucq (LABRI) Algorithmes pour la comparaison d ARN : distance d édition entre arbres Serge Dulucq (LABRI) Hélène Touzet (LIFL) : bases appariées (tige) : base libre (boucle) Représentation arborescente pour la structure

Plus en détail

L ADN, support de l information génétique

L ADN, support de l information génétique Biochimie - Biologie moléculaire L AD, support de l information génétique Julien FAURÉ Institut de Formation en Soins Infirmiers 1 ère Année Année universitaire 2014-2015 à la recherche de l information

Plus en détail

Points du module. Objectifs du module Bioinformatique appliquée à l analyse des séquences. Module de Bioinformatique appliquée

Points du module. Objectifs du module Bioinformatique appliquée à l analyse des séquences. Module de Bioinformatique appliquée Objectifs du module Bioinformatique appliquée à l analyse des séquences Module de Bioinformatique appliquée Comprendre et apprendre à utiliser les informations et les outils disponibles sur internet pour

Plus en détail

Activité 1 : STRUCTURE ET FONCTION DE LA PROTEINE CODEE PAR UN GENE HOMEOTIQUE

Activité 1 : STRUCTURE ET FONCTION DE LA PROTEINE CODEE PAR UN GENE HOMEOTIQUE TP6 : La diversification des êtres vivants avec modification des génomes Mise en situation et recherche à mener www.larecherche.fr/content/recherche/article?id=25131 Montrer à partir des différents documents,

Plus en détail

Séance 5. Les Acides Nucléiques. 3. Conservation de l information génétique: Réplication semi-conservative de l ADN

Séance 5. Les Acides Nucléiques. 3. Conservation de l information génétique: Réplication semi-conservative de l ADN UNIVERSITE MOHAMMED V-AGDAL FACULTE DES SCIENCES Les Acides Nucléiques DEPARTEMENT DE BIOLOGIE Filière Sciences de la Vie (SVI) Module de Biochimie (M 11) Élément : Biochimie structurale - Semestre 3-2005-2006

Plus en détail