AMBATONAKANGA SY NY MISIONERA ;

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "AMBATONAKANGA SY NY MISIONERA ;"

Transcription

1 AMBATONAKANGA SY NY MISIONERA ; Raha miteny hoe Ambatonakanga isika protestanta amin izao andro ankehitriny izao dia ny trano fiangonana vita amin ny vato no tonga ao an-tsaintsika voalohany ary vitsy ihany angamba no mba manadihady ny amin ny antony sy ny fomba nahatonga azy io teo ;Izao fankalazana vanimpotoana maningana eo amin ny tantaran ny fiangonana izao no famohazana ny lasa satria adidin izay mahalala no mampita izay fantany amin ny taranaka mifandimby. Koa mihevitra àry ny mpanoratra ity lahatsoratra ity fa tsara sy mety ny mampahalala ny rehetra fa matoa nisy ny fiangonana teto Madagasikara dia noho ny ezaka nataon ny vahiny anglisy izay fantatra amin ny anarana hoe «misionera». Tsy voambolana vaovao izy io ho an ny efa ela nihetezana rehetra kanefa tsy mba teny henon ny taranaka ankehitriny intsony kosa satria efa lasa daholo ireo misionera. Tsy azo atao anefa ny manadino fa miorina amin ny lasa ny zava-drehetra ka izany no anton ity famohazana azy eto ity amin ny teny fohy ihany. INONA MOA IZANY MISIONERA IZANY? Toerana falehan ny tantsambo avy amin ny firenena samihafa ny morontsirak i Madagasikara ary izy ireny dia notondroina tamin ny anaran-tokana hoe vazaha. Raharaham-barotra isan-karazany no nosahaniny teto fa tsy namela asa maharitra izy satria rehefa vita ny nataony dia lasa izy. Taty amin ny fiandohan ny taon-jato faha-19 dia niova ny tantaran i Madagasikara satria nifandray ara-diplomatika tamin ny fanjakana anglisy izay iray tamin ireo firenena natanjaka indrindra erantany ny mpanjaka Radama I ary nanao sonia fifanaraham-piaraha-miasa taminy. Tafiditra tao anatin izany fifanarahana izany ny fangatahany mba handefasana mpahay taozavatra hampianatra asa vaovao an ny vahoakany. Tsy nandà koa anefa izy ny hampianarana ny fivavahana kristiana teto. Rehefa vita ny fifampirahararahana dia tonga tokoa ireo vazaha anglisy avy amin ny London Missionary Society hanatanteraka io fanirian ny mpanjaka Radama I io. Fifanarahana politika teo amin ny fanjakana roa tonta no nisy kanefa iraka avy amin ny fikambanam-pivavahana kristiana no nalefa.ny anton izay dia izao : ity London Missionary Society,fantatra amin ny fanafohezan-teny hoe L.M.S,ity ihany no fikambanana efa zatra naniraka olona nankany amin ny bolabolan-tany atsimon izao tontolo izao, ka efa nanana ny fahaiza-manao teo amin izany andraikitra izany,izay no nahatonga ny fanjakana britanika nifanaraka taminy mba handefasany ireo sokajin olona notadiavin ny mpanjaka Radama I ireo. Olona efa nahazo fiofanana manokana na teo amin ny ara-pahalalana, na teo amin ny ara-tsaina ary indrindra teo amin ny arapanahy ireo olona faniraka tao amin ny LMS ireo, ary izy ireo no fantatra tamin ny anarana hoe «misionera» rehefa nogasiana ny teny anglisy «missionary».

2 AVY AIZA IZY IREO? Ireto nalefa nankaty Madagasikara ireto dia avy any Pays de Galles, Ecosse, Angletera no fihaviany ary nanaraka fiofanana ho amin izany andraikitra izany tany amin ny sekoly fanomanana mpitandrina sy mpitoriteny. Mazava ho azy fa tsy maintsy olona nanana toe-pahasalamana tsara izy ireo satria samy nahafantatra mialoha ny asa mafy tsy maintsy ho sahaniny dia ny fanelezana ny fampianarana ny filazantsara tamin ny mponina any amin ny tany lavitra an i Eoropa izay noheverina mihitsy aza fa olon-dia. Tsy niompana fotsiny tamin ny fandalinana ny soratra masina ny fianarana nataon ireo niomana ho misionera ireo fa nisandrahaka tamin ny lafiny maro satria tao ny mpampianatra, ny dokotera, ny mpanao mari-trano, sy ny sisa. Soritana eto koa fa filatsahana an-tsitrapo fa tsy an-tery no nidiran ireo misionera tao amin ny L.M.S ary tsy nisy fampanantenana tombon-tsoa na karama be. Olona efa nanana izay naha-izy avy tany amin ny tany nihaviany izy ireo ary niandahy niambavy mihitsy sady feno fahavononana tanteraka hisetra ny fahasahiranana tsy maintsy ho sendra azy na eny an-dalana rehefa hamakivaky ny ranomasina na rehefa tonga any amin ny toerana hiasany.. Izany no natao hoe «misionera». 2-FIANGONANA VOALOHANY. Raha ny tantara navelan ny pasitera Rabary no zohina dia nitana ny laharana voalohany teo amin ny lafiny maro ny fiangonana Ambatonakanga : izy no fiangonana protestanta malagasy voalohany, izy no nanorina ny sekoly alahady voalohany,tao no nasiana ny trano porinty voalohany teto Madagasikara. Raha ny trano fiangonana indray no ho resahina dia izy no tranovato vita voalohany tamin ireo efatra natokana ho fahatsiarovana ny maritiora protestanta malagasy. Voninahi-dehibe ho azy izany ka amin izay maha-fiangonana zokiny azy izay indrindra angamba no nahatonga ny fanorenana toeram-pandevenana ho an ny misionera ao an-tokotaniny tamin ny taona Ao tokoa no nalevina ireo misionera maromaro izay tratra hariva teto amin ny tanintsika ho fanasoavana antsika malagasy satria tsy tafaverina tany amin ny tanindrazany intsony. Tsy toeram-pandevenana fotsiny anefa io toerana io fa firaketana ny tantaran i Madagasikara mihitsy satria matory mandrakizay ao i James Hastie, solontenan ny fanjakana anglisy voalohany izay nanampy ny mpanjaka Radama tamin ny lafiny maro mba hampiova ny fomba amam-panao teto, Ao koa i James Cameron izay nahavita be ho antsika raha tsy ho lazaina afa-tsy ny fampidirina ny biriky ho fanaovan-trano izay nanova ny endriky ny tanànan Antananarivo sy tany amin ny faritany betsileo,ao ry William Johnson telo mianaka sy ireo hafa izay nametraka ny dian-tanany teo amin ny tantaran ny fiangonana protestanta eto Madagasikara.

3 Adidy napetraka tamin ny fiangonana Ambatonakanga,izay zokiny indrindra, ny fikarakarana izany toerana mirakitra tantara izany satria io no milaza mangina ny niandohan ny fivavahana protestanta teto. Tokony ho fantatry ny taranaka izany tantara izany mba tsy hahatonga azy ireny ho tompon-trano mihono sy mba hieritretany fa nisy fiandohana dahoholo ny zava-drehetra ka matoa misy izany fivavahana protestanta izany dia satria tao ny misionera niezaka nametraka azy io teto ka nahafoy ny tenany sy ny ainy mihitsy aza mba hampaharitra ny fampianaran i Kristy eto Madagasikara ary dia ireo izy tavela ao amin ity toeram-pandevenana ao Ambatonakanga ity.. NY ASANY TETO AMINTSIKA. Protestanta ireo misionera ireo ary mazava ho azy fa ny fanelezana izany antokom-pivavahana izany no tanjona voalohany nokendreny ho tratrarina, koa raha niorina ny fiangonana voalohany teto Madagasikara dia mazava ho azy fa fiangonana protestanta, manaraka ny fanavaozana nentin i Luther sy Calvin. Marobe ireo misionera anglisy protestanta tonga teto niantomboka tamin ny taona 1820 ka samy namafy voa tsara izay nitsimoka, nitombo, nandrobona ary tamin ny farany dia namokatra ny fiangonana protestanta malagasy efa 180 taona izao. Tsy àry ho voatanisa ny asa vitan izy ireo teto fa ny lehibe indrindra dia ny fanorenana fiangonana sy sekoly ary hopitaly, izay midika fa nomeny lanja lehibe teo amin ny andraikitra nosahaniny ny ara-panahy sy ny ara-tsaina ary ny ara-nofo. Izy ireo no nanoritra ny lalana hizoran ny fivavahana protestanta teto ary niezaka mba handraisan ny tompon-tany andraikitra tanteraka fa tsy ho tantanan-dava ary tsy azo ambara fa raharaha mora izany kanefa dia tanteraka. Nisy tokoa ny fitavozavozana teo amin ireo mpitandrina malagasy kanefa nataon ny misionera adidy ny nanitsy moramora ny lalany mba tsy hivily any amin ny tsy izy. Toetra iray miavaka nananan ireo misionera ireo tokoa io faharetana eo amin ny asa nataony io ka isika rehetra ankehitriny no mahatsapa ny vokany. Isan ny zavatra iray tsy maintsy tsindriana koa ny fomba nameloman ireo misionera ireo ity antokom-pivavahana ity dia ny famoronan-kira izany. Ny ezaka voalohany nataon ny misionera tonga teto ny fianarana sy fandalinana ny teny malagasy ka tsy nionona teo amin ny fanazavana ny soratra masina izy fa nanome aina ihany koa ny fotoampivavahana tamin ny alalan ny hira. Tany am-piandohana aloha dia ny hira tamin ny teniny no natao fa taty aoriana dia niezaka izy nandika tamin ny teny malagasy ireo hira fanaony tany aminy, ka mbola hitantsika ao anatin ny boky fihirana protestanta ny anaran ireo nahavita izany.

4 Tsy azo kosehina eo amin ny tantara koa izany asa makadiry vitany izany satria mpisava lalana izy ireo fa nanara-dia azy kosa isika Malagasy ary nampitoviany tamin ireo kristiana protestanta maneran-tany izay nampianariny. Tokony ho reharehantsika ny fahafantarana fa nampiasaina tamin ny fandikana hira malaza fanao amin ny Krismasy maneran-tany koa ny tenintsika ka nahazahoana ilay hira manao hoe «Mihainoa», raha toa ka «Stille nacht» ny an ny Alemana, na «Douce nuit» ny an ny Frantsay. Ohatra iray fotsiny io fa jereo ny takelaka fanondroana pejy ao anaty boky fihirana fa ho hitantsika ao ny anaran ireo misionera anglisy nandika ny hirany tamin ny teny malagasy madio rano tanteraka. Izay raha atao bango tokana ny tantaran ny misionera protestanta anglisy sy ny asa napetrany ho an ny protestanta malagasy ka misy hieritretan ny tsirairay satria tsy dia mety loatra ny hanaovana azy ireny ho toy ny vato natsindry hahazana sy ny hamelana azy ireny hatelin ny fanadinoana. Jeanne Rasoanasy TANTARAN NY NY FIANGONANA KRISTIANA PROTESTANTA VOALOHANY TETO AMBATONAKANGA I. NY FIANDOHANA Ny LMS (London Missionary Society). Ny London Missionary Society izay nanorina ny Fiangonana LMS teto Madagasikara, dia fikambanana kristiana niorina tany Londres tamin ny Septambra Kristiana avy tamin ireo Fiangonana natao hoe «independent churches», na «fiangonana mahaleo tena» na «fiangonana tsy miankina» daholo ny olona nanorina azy, dia ny Fiangonana Kongregasionalista-ny Fiangonana Episkopaliana- ny Fiangonana Metodista ny Fiangonana Batistany Fiangonana Frenjy na Quakers- ny Fiangonana Kalvinista ary ny Fiangonana

5 Loterana. Natao hoe «Fiangonana mahaleo tena» ireo kristiana ireo ary natao hoe koa «Puritains».Izy ireo dia niezaka hankato ara-bakiteny ny Soratra Masina.Tamin ny finoana sy fitondrantena no nanehoany izany ka nolaviny ny fampiasana fomba ivelany tao amin ny fanompoam-pivavahana (fitafiana,sary,hazofijaliana,orga ).Nafana fo tamin ny fitorian-teny,nyfanajana ny Alahady, ary ny fahefan ny Loholona ireo fiangonana ireo. (Ramambasoa 1995). Ny antom-pisian ny LMS dia ny «fitoriana ny Filazantsara amin ny olona tsy mahalala an i Jesoa Kristy» fa tsy ny hanorina Fiangonana kongregasionalista na fiangonana episkopliana na fiangonana metodista tsy akory! Nantenainy fa ireo olona niova ho kristiana noho ny Filazantsara notoriany dia hanana fahalalahana hanorina ny Fiangonany, hamorona ny fitsipika hitondrany azy ary hahay mamory ny vola ho entiny miasa. Nanangom-bola an-tsitrapo ireo olona ireo, avy tamin ny fanomezana tsotra, ary nanao ho zava-dehibe ny fiaraha-mivavaka «amin ny fo torotoro sy mangorakoraka». Ny misionera voalohany tonga taty Madagasikara. David Jones telo mianaka sy Thomas Bevan telo mianaka. Mpitandrina vita fianarana tao amin ny Kolejy fanomanana Mpitandrina tany Neuaddlwyd, any Wales (Pays de Galles), David Jones sy Thomas Bevan, no misionera nanolo-tena voalohany ho aty Madagasikara. Tamin ny Alatsinainy 3 Jolay 1818 ny Misionera roa lahy sy ny vady amanjanany no niala tany Angletera ary tonga tao Toamasina tamin ny Talata 18 Aogositra Nanaovan ny olona trano tao Manareza izy eni-mianaka, ary niantomboka nampianatra tao tamin ny Talata 8 Septambra Mbola niverina kely tany Maurice anefa ry zareo vao niomana hiakatra ho any Antananarivo.Ry Ingahy David Jones telo mianaka no niainga taloha fa ry Ingahy Bevan telo mianaka mbola nijanona kelikely tao Maorisy. Nony tonga tao Toamasina Ingahy David Jones telo mianaka, dia nararin ny tazo Mme Jones sy ny zazakely.maty tamin ny 13 Desambra ny

6 zazakely ary Mme Jones koa dia maty tamin ny 29 Desambra 1818.Ingahy David Jones irery no sisa velona! Nony tonga tao Toamasina Thomas Bevan telo mianaka dia kivy fatratra nandre fa maty Mme Jones sy ny zanany kely. Tsy ela koa anefa dia narary Ingahy Thomas Bevan mivady sy ny zanany kely.maty ny zazakely tamin ny 24 Janoary 1819 Maty koa Ingahy Thomas Bevan tamin ny 31 Janoary ary Mme Bevan tamin ny 3 Febroary Ingahy David Jones irery no sisa velona tamin izy eni-mianaka! Niverina nankany Maorisy izy aloha mba hitsabo tena.nipetrapetraka tany herintaona sy roa volana izy vao niakatra ho any Antananarivo ary tonga teto tamin ny Talata 3 Oktobra 1820, niaraka tamin Ingahy James Hastie, Ira-Panjakana Britanika. Jonjilava no anarana niantsoan ny olona azy. Noraisin ny Mpanjaka Radama tamim-boninahitra lehibe izy ka nanapoahana tafondro ary notsenaina miaramila sy manamboninahitra. Nony niditra ny Rova izy dia notsenain-dradama teo Anaty Rova avaratra ka noraisiny tao amin ny Tranovola. Ny nahatongavan ny Rev. David Griffiths mivady. Ingahy David Griffiths koa dia Mpitandrina nivoaka avy tao amin ny Kolejy nivoahan i David Jones sy Tomas Bevan tao Neuaddlwyd. Tonga tao Antananarivo izy mivady sy ny zanany vao teraka tao Maorisy tamin ny Alarobia 30 Mey 1821.Faly ery hono ny olona nahita ilay zana-bazaha voalohany hitan ny masony! 2. NY FIANTOMBOHAN - DRAHARAHA : FANORENANA SEKOLY 1. Ny Sekoly voalohany nosokafan ny misionera:ny Sekolin i David Jones: 8 Desambra Tamin ny Zoma 8 desambra 1820 no nanomboka nampianatra Rev David Jones. Tao an-tranony teo Andafiavaratra no nanaovany ny fampianarana. Zaza telo no nampianariny, dia Rakotobe zanak i Rabodosahondra anabavindradama, Ramasy zana-drasoamananoro zanak olo-mirahavavay tamindrabodosahondra ary zaza anankiray tsy fantatra anarana.vetivety foana dia tonga 16 ny isan ny mpianatra.

7 Nony tsy omby intsony ny trano dia nafindra tao Anatirova ny Sekoly.Io no Sekoly faharoa.tamin ny1823 dia nafindra tany Amparibe ny Sekolin i Mr David Jones. 2.Ny Sekoly faharoa dia ilay nosokafan ny Rev David Griffiths:23 Oktobra Tamin ny 23 Oktobra1821 no nanomboka nampianatra Rev David Griffiths mivady.zazalahy 11 sy zazavavy 4 no nampianariny.teo Ambodinandohalo no nisy ny toerana.tao amin ny trano kely nitoerany ihany no nisy ny sekoly. Avy hatrany Mr Griffiths dia niara-nampianatra tamin i Mr Jones. Efa nisy mpianatra zazavavy maro tamin izay sady efa nampianarina hira ny ankizy.tian ny Mpanjaka Radama ery hono ny hiran ireo mpianatra ireo ka matetika izy no tonga mihaino ny hirany.voalaza koa aza fa taty aoriana dia isan ny mpankafy ny hira nampianarin ny misionera Ranavalona I ary nahafantatra hira maro izay nohiraina sy notendrena tamin ny zava-maneno tao an-dapa! Natomboka tamin ny 7 Fevrie 1822 ny fanaovana ny trano hazo sarendry lehibe.misy efitra maro nitoeran-dry Rev David Griffiths mianakavy sy efitra makadiry natao sekoly andavanandro ary trano fiangonana isan Alahady Juin 1822 Nanomboka Sekoly iray tao Ambatonakanga koa ny Rev Jeffreys, ka dia tonga telo ny Sekoly niorina teto Antananarivo. Zazalahy 9 sy zazavavy 3 no tonga nianatra tato amin ity sekoly vaovao ity. 4. Ny nanakambanana ny Sekoly teto Antananarivo. Nasain ny Mpanjaka nakambana ho Sekoly Iray Lehibe ny Sekoly telo, dia ny an i Mr Jones tao Amparibe, ny an i Mr Griffiths tao Ambodinandohalo ary ny an i Mr Jeffreys tao Ambatonakanga. Ny nanakambanana azy dia tao Ambodinandohalo.Ny mpampianatra dia i Mr Jones sy Mr Griffiths hampian ny Tovolahy Malagasy sasany.madame Jones sy Mme Griffiths no hampianatra zaitra ny zazavavy ary Mr Jeffreys mivady nangatahina ho any Ambatomanga hanorina Sekoly any. Ny anaran ny Sekoly mitambatra dia atao hoe Central School na Royal Missionary College Ny nampianarina tao amin ny Royal Missionary College dia vakiteny,soratanana, teny anglais, sy teny malagasy, grammaire etc Koa amin ireo fiteny roa ireo no ampianarana ariihmétique,trigonométrie,ary sténographie sy

8 ny fampiasana ny Globe (sarin-tany).fanampin izany dia exercices amin ny Anglais adika ho Malagasy sy Malagasy adika ho Anglais. Mr Jones no mitondra ny sekoly isan Alatsinainy sy Talata sy Alarobia ary Mr Griffiths kosa isan Alakamisy,Zoma,Sabotsy. Isan-kerinandro izahay, hoy izy, dia samy manana andro roa manontolo sy fotoana ao anelanelan ny ora ampianarana handikanay ny Baiboly sy hiomanana amin ny raharaha Alahady. Ny kilasy voalohany tao amin ny Royal Missionary College no natao hoe Ny Roambinifololahy.Izy rehetra dia zanak olona ambony avokoa.izao avy ny anarany:rakotobe,zanaky ny Princesse Rabodosahondra,anabavin-dRadama, Raharolahy, Ratsimandisa, Ralaimaholy,Rasatranabo,Ramaka (zanadralala),ratsisetraina, Ramaka (zanak Andriakoto), Rabohara,Rasoanitsiriana, Ratsitohaina. Ny antony nanakambanana ny Sekoly hanjary Sekoly lehibe dia ny Royal Missionary College dia ny mba ho renin ny Sekoly rehetra eto Imerina, sady hanomanana koa ny ho mpampianatra any aoriana Radama no tompon izany hevitra izany izay neken ny misionera tamim-pankasitrahana. Nandeha namangy an-dradama ny misionera roa lahy,david Jones sy David Griffiths ka nanambara taminy fa ny zavatra kendren ny LMS dia izao: : Hampianatra ny firenen-drehetra hatahotra an Andriamanitra, hanome voninahitra ny Mpanjaka sy ho tia ny namana;ary hampianatra koa ny olondrehetra ny lalana izay mankamin ny fahasambarana eto an-tany sy any ankoatra Nankasitrahan-dRadama indrindra izany teny izany. Ny fampianarana asa tanana. Nanoratra taratasy ho an ny LMS tany Londres ny Mpanjaka Radama, nangataka misionera mpampianatra asa tanana. Nahafaly ny Misiona LMS izany fangatahana izany ka dia nandefa misionera mpanao asa tanana izy. Koa tamin ny Alatsinainy 10 Jona 1822, dia tonga tao Antananarivo, Mr J Jeffreys mpampianatra asa tanana, niaraka tamin i Mr Brooks mpandrafitra, Mr Chick mpanefy, Mr Rowlands mpanenona, Mr Canham,mpandon-koditra sy mpanao kiraro. Tapa-bolana taorian ny nahatongavany anefa dia maty Mr Brooks,mpampianatra rafitra! Andro vitsivity taorian ny nahatongavany dia nanomboka niasa ireo misionera mpanao asa tanana ireo. Mr Rowlands lasa namboly rongony tany Ifody,atsinanan Angavo,hanaovan-damba- Mr Canham lasa nonina teny

9 Fenoarivo,nandon-koditra sy nanao kiraro.mr Chick, nonina tao Amparibe nampianatra nanefy vy.. 3.Vita ka notokanana tamin ny 28 Desambra 1823 ny Fiangonana Lehibe, trano hazo sarendry tao Ambodinandohalo izay natomboka naorina tamin ny 7 Fevrie 1822.Nazoto niangona tao Rambolamasoandro renin-dradama ary na dia Imavo (Ranavalona I fony tsy mbola nanjaka) aza dia niangona matetika tao koa. Ny fitaran ny fampianarana eran Imerina Ny mpianatra zokiny avy tany amin ny Sekoly, dia nalefa nampianatra sy nitory teny tany ambanivohitra ary tsara dia tsara ny vokatry ny asa vitany. Tamin ny 1825 dia nitombo eran Imerina ny sekoly, tao amin ny faritr i Voromahery(Antanananarivo) teny Alasora, teny Marovatana(Ambohidratrimo), teny Ambodirano ary teny Avaradrano. Nisy sekoly 28 tany amin ny zokim-bohitra manodidina an Antananarivo. Ary noho ny vokatra tsara vitan ny fampianarana dia maro tamin ireo mpianatra nahavita fianarana no nirotsaka nampianatra koa. «Ny mpianatra zokiny,izay mampianatra tany ambanivohitra,hoy Mr Griffiths, dia mihoatra noho ny nantenaiko ny fahaizany mampianatra Ny fandrosoan ny mpianatra amin ny fahalalana ny tenin ny famonjena dia manatanjaka ny fonay Tena nahafa-po ny fampianarana tany amin ny sekoly,hoy ihany ny tatitra.. Tamin ny fotoana nialan ny Misionera, noho ny fandrarana ny fivavahana tamin ny 1831 dia efa nisy mpianatra tokony ho Ny mpianatra sasany,indrindra fa ireo natao hoe «Ny Roambinifolo Lahy» dia efa nianatra ny fotopototry ny siansa, nahay teny anglisy tsara, ary efa nanomboka nianatra ny teny latina sy grika aza saingy nosakanan ny Fanjakana. Ny Sekoly fianaran-taozavatra dia nandroso fatratra koa. Ny isan ny mpianatra nampianarin-dry Mr Cameron sy ny namany dia tokony ho 2000.Ny an i Mr Cameron fotsiny dia efa nahatratra 500 mahery.izy ireo dia nianatra ho mpanefy vy,mpandrafitra,mpandon-koditra,mpanao kiraro, mpanao savony, mpamoly,mpanenona sns

10 Tamin ny Marsa 1827 dia toy izao ny toe-javatra teto Antananarivo sy ny manodidina:isan ny Sekoly:38 Isan ny mpinatra: 2309 Isan ny Malagasy nahay nanoratra :4.000 Ny Programan ny Fampianarana. Vakiteny-soratanana-teny anglisy sy teny malagasy- grammaire Katakizin ny Dr Watts (Katekisma nataon ny Dr Watts) ny programa rehetra dia manomana ny mpianatra ho kristiana mahay sady mazoto mamaky ny Baiboly ary mahay mampianatra ny olona Ny misionera dia efa nanomana teksta tamin ny teny malagasy,ho vakina sy atao tsianjery,hampiasaina any amin ny sekoly rehetra. Ireo zava-dehibe telo vaovao. Nisy zavatra telo lehibe nitranga izay nanan-danja manokana tamin ny fandrosoan ny fitoriana ny Filazantsara dia ireto: 1 Tamin ny 1 Septambra 1822 dia nisy 10 mianadahy ny misionera niasa teto Antananarivo.Nanapaka hevitra izy ireo fa hiorina ho Fiangonana kristiana ka handray ny Fanasan ny Tompo. Koa tamin ny Alahady 7 Septambra 1822 izy dia niara-nandray ny Fanasan nytompo teto Antananarivo. 2.Tamin ny 31 Desambra 1822, dia nanapaka hevitra ny misionera fa hosoratana ny teny malagasy.ireto ny anaran ireo misionera ireo : David Jones mivady- David Griffiths mivady J. Jeffreys mivady-mrchick-mr Rowlands ary MrCanham. 3.Hadika ho teny malagasy ny Baiboly

11 3. NY NANDIKANA NY BAIBOLY HO TENY MALAGASY. Tamin ny volana Avily 1824 dia hoy ny filazan ny Rev David Griffiths tamin ny Foibe LMS : Mandroso mandika ny Genesisy, Eksodosy,Matio, ary Lioka ho teny malagasy izahay; ary manantena fa ho vita amin ny faran ity taona 1824 ity izany. Tamin ny fiandohan ny taona 1825 tokoa dia efa voadikan i MrJones sahady ny Genesisy, ny tapaky ny Levitikosy, ny Samoela I, Matio ary ny ankamaroan ny Jaona, ny Asan ny Apostoly, Galatiana sy ny Filipiana; Mr Griffiths kosa dia efa nahavita ny Eksodosy, ny ankamaroan ny Salamo,Marka,Lioka,Korintiana Voalohany sy Faharoa. Ary tamin ny 21 Novambra 1826 dia tonga teto Antananarivo Mr Hovenden,misionera Mpanonta printy Mampalahelo anefa fa maty tamin ny 15 Desambra 1826 izy! Mr Cameron sy Mr Jones no niezaka nanangana sy nampandeha ilay milina fanontam-printy.koa tamin ny 4 Desambra1827,dia nandraman I MrJones sy MrGriffiths natao printy ny Genesisy 1, andininy 1-23.Tonga nanampy azy roa lahy koa ny vehivavy misionera nanampy nitsimpona sy nandahatra ny lohavy.nifotetaka saro-bakina ny taratsay voalohany fa ny faharoa manaraka dia niha-tsara ka azo novakina. Vetivety foana dia nahavita porofo1500 tsara tarehy ny Misionera ka nozaraina natao famakian-teny tany amin ny Sekolim-piangonana maro efa nijoro tamin izay. Tamin ny 3 Marsa 1828,dia nanoratra ho an ny LMS Foibe indray ny misionera nanao hoe: Efa ho tapitra izao ny fandikanay ny Baiboly manontolo, afa-tsy ny teny sasany saro-pantarina ao amin ny Levitikosy sy Deotornomia,izay mbola navelanay ho faramparany.miomana indray hamerina handinika azy rehetra tsirairay izahay.ary rehefa nahavita ny anjarany amin ny dikasoratra Mr

12 Griffiths dia nangatahinay ho mpiadidy ny fanontana printy.mihaona indroa isan-andro izahay, mifampitsara sy miady hevitra fatratra, mandinika isanandininy,isam-pirazy,isan-teny. Ary raha misy sendra tsy nahalavorary ny anjarany (na Mr Jones na Mr Griffiths) dia mitondra mody, ka milofo any antranony samy irery) Nanampy azy be dia be koa ireo mpianany natao hoe Ny Roambinifolo Lahy izay efa nomaniny nandritra ny taona maro, dia Rakotobe (zanak anabavindradama),raharolahy,raleimaholy (Rainifiringa),Rasatranabo (Rainandrianan- draina),ratsisetraina,ralaiseheno(ramaka) zana-dralala, Ratsimihera,Ramaka zanak Andriankoto, Rabohara, Rasoanitsiriana,Ratsitohaina,Ratsimandisa (Rainisoa). Tamin ny volana marsa 1830 no vita printy ny Testamenta Vaovao ary no indray navoaka.nody hiala sasatra Mr David Jones.Mr Johns (Jonjifohy) sy Mr Freeman indray no nanampy an i Mr Griffiths namita ny Testamenta taloha. Maty tamin ny 1828 Radama.Nanjaka nandimby azy Ranavalona I.Dodona dia dodona ny Misionera hamita ny dikan ny Baiboly malagasy manontolo.koa tamin ny 21 Jona 1835 dia vita printy avokoa ny Baiboly malagasy manontolo ka voatambatra ny TestamentaTaloha sy ny TestamentaVaovao Ny toe-javatra taorian ny nahafatesan-dradama Toy izao no filazan i Mr Griffiths : «Ny Fiangonana tandremako dia mitambatra amin ny tranoko ary mahalany olona arivo mahery.izahay sy Mr Jones, dia samy mitory teny,ny iray amin ny teny anglisy ary ny iray amin ny teny malagasy.tao anatin ny roa volana izahay roa lahy dia nifandimby nankany ambanivohitra amin izay misy sekoly mba hitory teny sy hampianatra katekizina. Izany no natao isan alahady.ny trano fiangonana eto an-tanàna dia feno hipoka,feno olona mitangorona hatreny am-baravarambe sy hatreny am-baravarankely aza.telo arivo, efatra arivo ary indraindray aza dimy arivo ny mpiangona eto antanàna,ary matetika roa arivo na telo arivo any ambanivohitra».

13 Mahagaga anefa fa na dia maro aza ny mpiangona dia tsy mbola nisy olona nanolo-tena hatao batisa. Samy hafa anefa ny toe-javatra fahavelon-dradama sy taorian ny nahafatesany. «Faha-velon-dRadama», hoy ny fitantaran ny misionera, dia tonga mba hihaino «hiram-bazaha» ny ankamaroan ny mpiangona. Taorian ny nahafatesan-dradama, dia ny hitady an Andriamanitra no nahatongavan ny ankamaroan ny mpiangona tany am-piangonana Ny fony mangorakoraka, ny ranomasony latsaka,ny hafanam-po tsaroana eran ny trano.manaraka ny misionera any an-tranony izy miresadresaka aminy, mianatra hevi-teny» «Tsy mbola nisy toy izao,hoy Mr Baker tamin ny taratasy nosoratany tamin ny 1 Jolay 1930.Ny resaka ataon ny Malagasy dia momba ny toriteny reny, ary manan-kery lehibe ka mahavoa ny fieritreretana Mahafaly tokoa,hoy ihany Mr Baker, ny mahita fivoriana ao am-piangonana.maro be ny olona tonga alohan ny fotoana ary ny ankabeazany dia hita fa olona te-hamototra ny fampianarana, te-ho mpanaraka an i Jesosy.Tamin ny elanelan andro dia nisy fotoam-pivavahan-kariva koa tany an-tranon ny Kristiana sasany.ny Malagasy no mpitari-draharaha ary matetika tonga koa ny misionera». 4. NY FIANGONANA PROTESTANTA MALAGASY VOALOHANY TAO AMBATONAKANGA SY TAO AMBODINANDOHALO. Nandritra ny valo taona mahery ( ) niasan ny misionera, dia faly niara- niangona sy nihaino hiram-bazaha fotsiny ny olona.niova izany tato aoriana, nanomboka tamin ny 1829 Tamin ny 22 Mey 1831 dia nivoaka ny tenin Andriana nilaza fa azo atao ny Batisa sy ny fandraisana ny Fanasan ny Tompo.Efatra andro taorian io filazana io, tamin ny 26 Mey 1831 dia nanoratra tamin ny Rev Johns Misionera Ratsilainga mba hatao Batisa sy ho mpandray izy mivady sy Rasoamanambola mivady,sy Ratsimandisa mivady ary Raintsiheva mivady.koa dia ny Alahady 12 Jona 1831 no natao batsia Ratsilainga sy ireo namany ka nandray ny Fanasan nytompo tamin io Alahady io koa.

14 .Koa tamin ny faran ny taona 1830 dia nisy Fiangonana naorina tao Ambatonakanga ary tamin ny 5 Jona 1831 dia nitokanana io Fiangonana io. Tamin io andro io, dia nisy olona valo-lehilahy fito sy vehivavy iray- natao batisa dia nandray koa ny Fanasan ny Tompo.Ny efatra tamin ireo dia Paoly Rainitsiheva,sy Razafy vadiny,rasoamanambola sy Ratsilainga Tamin ny Alahady 29 Mey 1831, dia nisy olona roapolo nataon i Mr Griffiths batisa tao Ambodinandohalo.Isan ireny Rasalama, maritiora voalohany sy Ratsimandisa ary Ranivomanana vadiny. Koa tamin ny Alahady 12 Jona 1831 dia niorina ho Fiangonana Protestanta Malagasy voalohany ny mpandray tao Ambatonakanga. Rev David Johns no mpitandrina tao, ary J. Cameron no diakona. Tamin io fotoana io,hono, dia hoy ny Rev. Johns mpitandrina : -Manantena aho fa ity Fiangonana ity dia haharitra ho Fiangonana mandrapahatapitr izao tontolo izao». Tamin ny Alahady 6 Aogositra 1831 koa dia niorina ho Fiangonana Protestanta Malagasy faharoa Ireo mpandray vaovao 37 tao Ambodinandohalo. Rev Griffiths no Mpitandrina tao. Nazava tsara hatramin izay fa ny atao hoe Fiangonana dia ny fiombonan ny olona vita batisa sy mpandray ny Fanasan ny Tompo. Ireo kristiana vitsivitsy tao Ambatonakanga sy tao Ambodinandohalo ireo no nanangana ny Fiangonana kristiana protestanta malagasy voalohany, 21 taona taorian ny nahatongavan ny Misionera voalohany tao Antananarivo. Talohan io andro nandraisany ny Fanasan ny Tompo io, dia voalaza fa mpiangom-potsiny ny kristiana malagasy.fa hatramin io fotoana io kosa dia niara-nitondra tamin ny misionera izy.ny 29 Mey nanaovam-batisa voalohany sy ny 5 Jona nandraisana voalohany ary ny 12 Jona niorenan ny Fiangonana Malagasy voalohany dia fotoana lehibe amin ny tantaran ny Fiangonana Kristiana Malagasy. 5. NY MARITIORAN AMBATONAKANGA;

15 Rafaravavy Rasalama maritiora. Tamin ny Zoma 4 Aogositra 1837 no voalohany nitondrana andrafaravavy Rasalama hovonoina.saiky novonoina tamin ny Sabotsy maraina izy kanefa nisy zavatra nisakana izany dia ny haintrano be nahatsiravina teny Ambohimitsimbina.Novoriana tao Ambatondrafandrana (ny Fitsarana Tampony tamin izany) indray ny Manamboninahitra sy ny Andriambaventy (ireo Mpitsara Ambony) ary ny vahoaka.nentina tao koa ny mpanao badisa dia ireo kristiana izany)..hanatanteraka Fitsarana tampony no anton io fivoriana io. Nony nirava ny fitsarana dia nalefa tany an-tranon-dramiandravola havany Rafaravavy Rasalama.Nisy resaka henjana nifanaovan-drasalama tamin-dramiandravola tao.tamin ny farany dia tsy zakan-dramiandravola intsony ny resaka ka tapaka ny heviny fa hampahafantatra ny resaka nataondrafaravavy Rasalama taminy any amin-drainiharo izy.nony nahare ny tatitra nataon-dramiandravola Rainiharo dia nilaza fa tsy maintsy vonoina ny ampitson io Rafaravavy Rasalama.Andro alahady io ampitso io. Nentina niala tao an-tranon-dramiandravola Rafaravavy Rasalama ka nafindra tao amin ny Fiangonana tao Ambatonakanga.Novàna ny gadrany ka natao gadra ombifohy izy; gadra izay nampiforitra ny tenany ka nampifanendry ny loha sy ny lohalika.tsy avy niaina sady nangirifiry fatratra Rasalama nandritra ny alina. Ny ampitso izy dia nentina maraina ka nolefonina tany Ambohipotsy. Nony efa holefonina izy dia nivavaka ary nony vita ny vavaka dia nihira ny hira hoe Hitako ny lalan-tsara ka hizorako izao. Dia nolefonina izy ka dia maty Ny Alatsinainy 14 Aogositra 1837 io andro nandefonana an-drasalama maritiora io.izy no maritiora malagasy voalohany. Rainitsiheva Paoly sy Razafy vadiny.. Nony tapitra voaroaka nody daholo ny misionera tamin ny 24 Jolay 1836 dia Raintsiheva mivady sy Rafaravavy Maria no isan ireo olom-bitsy nanatanjaka tamin ny finoana ny namany ka nampahery ny kristiana efa notandindomin ny fahafatesana. Raha vao nanomboka ny fanenjehana dia nisy kristiana 40 na 50 isanalina nivory sy nivavaka tao amin ny trano fisainana tao amin ny Fiangonana Ambatonakanga.Nony tsy azo natao intsony izany dia tao an-tranondrainitsiheva mivady indray no nivoriana sy nivavahana isan alina.nolazin izay mpankany taty aoriana, fa tsy mbola nisy andro nananany fahasambarana sy fiadanam-po hoatra ny tamin ireo fotoana ireo. Niara-nosamborina tamin-drafaravavy Rasalama tamin ny 4 Aogositra 1837 Rainitsiheva ary efa isan izay ho vonoina.nogadraina mafy sady natokantrano tao Ambatondrafandrana izy satria noheverin ny Fanjakana fa lehiben ny mpivavaka naman-drafaravavy Rasalama.

16 Tamin ny 8 Jolay 1840 no notapahin-doha Rainitsiheva sy Razafy vadiny niaraka tamin ny kristiana fito hafa.nasain ny mpanjaka nahantona ny lohandrainitsiheva,ka noho izany dia isan ireo loha nalain Idadabe Rainimamonjy mpitandrina tao Amparibe taty aoriana ka naleviny tao an-tranony ary nafindra ao amin ny fasana ao andrefan ny Fiangonana ao Ambatonakanga izao. Rabodomanga,vadin-dRatsilainga dia voasambotra ka natao gadra mitohy tany Ankazonamoizana ary maty tamim-pangirifiriana fatratra. Ratsilainga. Ratsilainga dia isan ireo natao hoe Loha-Fiangonana izay toy ny mpitandrina nikarakara ny Fiangonana taorian ny Fanenjehana. Raha nikabary tao Andohalo ny Mpanjaka tamin ny Zoma 3 jolay1857 ka niantso ny olona hiampanga tena, dia tsy nisy tonga niampanga tena intsony ny olona fa natahotra ny hovonoina toy ireo niampanga tena taloha kanefa novonoina ihany.koa dia nisy fisamborana, ka toy izao ny nitranga: -Nisy 14 voasambotra ka notoraham-bato teny Fiadanana. -Nisy 50 nampinomina. Ny valo tamin ireo dia maty.ny efa-polo dia ninona kanefa velona.ny roa dia ninona amboa ka velona.. -Nisy sivy afa-nandositra dia Ratsilainga, Andriambelo,Ralaimavo, Andriantsoa, Rasoalavavolo, Renibonga,,Ramiandry,Rafiringa,Rakotovao aryandriampatsa. Ratsilainga, isan ny dimy lahy VAHINY Ratsilainga koa dia isan ireo Kristiana dimy lahy Mpitarika sady Mpitory teny tamin ny andron ny fanenjehana. Nahay niafina ka tsy mba voasambotra mihitsy izy.ireo ary nataon ny namany hoe «nyvahiny», dia Ratsilainga,Andriambelo,Ralaimavo,Rasoalavavolo,aryAndriantsoa. Hoy ny filazan-drabary Mpitandrina momba azy ireo: Nantsoina an-kabary isan-tsena sy isaky ny matso, sady natao sava hao nandritra ny taona maro,nefa nafenin Andriamanitra ka tsy azo mihitsy!fony tany am-pierena izy dimy lahy dia nozohin ny mpitsikilo hatraiza hatraiza, nifanakanan ny miaramila eran ny tany ka ny anton-toerany dia tany anaty ala,tany an-johy, tany an-tendrombohitra sns.kanefa nony tonga antanindrazana indray dia tena tsy mba nanana na dia izay hametrahana ny loha aza (Ny Daty Malaza.TPFLM 2007, p231.) 6. NY NIFIDIANANA AN-DRATSILAINGA HO MPITANDRNA TETO AMBATONAKANGA Tamin ny 2 Febroary 1862 dia voafidy ho Mpitandrina tao Ambatonakanga Ratsilainga ary nitondra ny Fiangonana sy ny zana-piangonany niaraka tamin ny Misionera hatramin ny 1873.

17 Ny Misionera niara-nitondra Fiangonana taminy dia i Mr W. Ellis ( ) sy Mr.W.E.Cousins ( ) ary Mr C.F. Moss ). 6. Ny nandorana ny sampim-panjakana sy ny nandefasana evanjelistra hitory teny any amin ireo tanàna nitahirizana ny sampy(8,9,10 Septambra 1869). Nony may ny sampy dia nikorontana ny mponina tany amin ireo tanàna nitahirizana ny sampy.maro no tezitra tamin ireo iraky ny Mpanjaka nandoro ny sampy.maro koa no tezitra tamin ny Mpanjaka.Maro indrindra koa ny niandry fanazavana sy tori-teny hahafantarany izay tsara sy mety hatao. Noho izany dia nivory niara-nidinika ny Mpitandrina teto Antananarivo sy ny Misionera ary nifanaraka ny amin izao fanapahan-kevitra izao: hisy Mpitoriteny halefa any amin ny tanàna efatra malaza indrindra tamin ireo nitahirizana ny sampim-panjakana nodorana, dia izy efa-dahy maintimolaly dia Ratsilainga, Ramaroanaka, Rasoalavavolo, ary Raindratavy.Ambohimanambola no nalaza indrindra tamin ny tanàna efatra, ka dia Ratsilainga no nalefa teny. Pour confection du livre sur le temple d Ambatonakanga (jobily ) De : Soavelohaja Rajaonson «L Angleterre en donnant ces édifices à Madagascar, rattacherait les combats et les victoires de cette église naissante à la source où celle-ci puise le salut, sous la bénédiction de Dieu ; elle perpétuerait les sentiments de sympathie et d amour qui unissent les chrétiens anglais à leur frères de Madagascar» (Appel à contribution financière du missionnaire Ellis) - James Cameron était un écossais né le 6 Janvier Sous la London Missionary Society, il a fait vingt-trois années de service à Madagascar ( ; ) au cours desquels il a joué un rôle majeur dans la christianisation et l'industrialisation. - Ranavalona 1ère, païenne pieuse, était irritée par l'action spirituelle des missionnaires qui lui semblait ébranler l'ordre social d'alors. Elle leur fit donc suggérer de rentrer dans leur pays "de peur que leurs parents ne s'ennuient d'eux." Ceux-ci remercièrent la Reine de son attention mais lui firent savoir qu'ils étaient venus pour enseigner bien des choses nouvelles à son peuple: le grec, l'hébreu. La Reine leur fit dire que ces langues n'avaient pour son peuple aucun intérêt, mais qu'elle préfèrerait de beaucoup du savon. Deux semaines plus tard, Cameron lui fit présenter une barre de savon "acceptable." Ce succès, remporté avec des produits du crû, eut de profondes conséquences, les missionnaires purent achever la traduction et l'impression de la Bible.

18 - L'action missionnaire et la situation des chrétiens malgaches devinrent de plus en plus critiques. Cameron et Chick se virent offrir par la Reine un contrat de travail, à condition qu'ils s'abstiennent de toute activité religieuse. Or, ils n'étaient pas venus pour promouvoir le progrès matériel mais comme missionnaires du Christ et ils s'intéressaient d'abord aux gens. Ils refusèrent donc et se retirèrent avec quelques autres missionnaires en 1835 et s'installèrent en Afrique du Sud. - Pendant 26 ans, Cameron exerça ses talents à Capetown comme géomètrearpenteur et comme entrepreneur de bâtiments. Même démissionné de la LMS, il restait en relation étroite avec elle. Il continuait également à s'intéresser à la Grande Ile et se tenait au courant de ce qui s'y passait grâce aux lettres que des amis malgaches s'efforçaient de lui faire parvenir. - Du temps de Radama II ( ), le missionnaire W. Ellis de La Société des Missions de Londres (LMS) réorganisa le christianisme à Madagascar. Ellis forma le projet de construire un certain nombre d'églises en pierre dans des sites admirables sur les hauteurs de Tananarive, aux emplacements où les martyrs avaient subi des supplices pour commémorer. Radama II lui octroya les terrains pour les constructions d églises commémoratives des martyrs malgaches morts pour leur foi. Les chrétiens d Angleterre souscrirent en deux ans, à la demande pressante d Ellis, les francs sollicités. - Des dispositions furent prises à Londres pour l'engagement de l'architecte Sibree. Ellis demanda à Cameron, qui était toujours au Cap, de se joindre à eux. Il y eut quelques confusions dans les instructions données, ce qui n'empêcha pas Cameron de prendre une part importante au projet, en particulier pour les églises d'ambatonakanga et de Faravohitra. - Cameron a entrepris une grande variété d'activités laïques et missionnaires après son retour d Afrique du Sud. L'œuvre de Cameron ( ) domine Tananarive. Il a construit plusieurs bâtiments sur le Rova dont «le Manampisoa» traduit par "surcroît de beauté» (1866), la tombe royale (1868), la coquille en pierre du Palais de la Reine «le Manjakamiadana» (1869) Il a été le premier à recenser et cartographier l Imerina et la région de Fianarantsoa. Un autre travail important fut de creuser le lac Anosy et son canal d'arrivée d'eau, élément d'un grand projet concernant une poudrière, conçu par Cameron et Chick. Ces constructions ont donné une impulsion à la civilisation malgache. English traduction "England by giving these buildings to Madagascar, would link the struggles and triumphs of this early church to the source from which it draws the salvation, under the blessing of God; it would perpetuate the feelings of sympathy and love that bind English Christians to their brothers in Madagascar "(Call for financial support of missionary Ellis) - James Cameron was a Scottish born January 6, Under the London Missionary Society, he wrote twenty-three years of service in Madagascar ( , ) during which he played a major role in the Christianization and industrialization. - Ranavalona 1st, pious pagan, was irritated by the spiritual action of the missionaries who seemed to undermine the social order of the day. So she made them suggest to return to their country "for fear that their parents do not get bored of them." They thanked the Queen for her attention but they made know that they were there to teach many new things to her people, Greek, Hebrew. The Queen sent words that these languages had no interest for her people, but she would prefer soap. Two

19 weeks later, Cameron made him have a bar of "acceptable" soap. This success, winning with the growth products, had profound consequence, the missionaries were able to complete the translation and printing of the Bible. - The missionary and the situation of Christians in Madagascar became increasingly critical. Cameron and Chick were offered by the Queen an employment contract, provided they refrain from any religious activity. But they were not there to promote material progress, but as missionaries of Christ and they were concerned about people first. So they refused and retreated with some other missionaries in 1835 and settled in South Africa. - For 26 years, Cameron exercised his talents in Cape Town as a surveyor and building contractor. Even resigned from the LMS, he had a close relationship with them. He also continued to focus on the Big Island and was aware of what was going through the letters that friends Malagasy trying to send. - From Radama II time ( ), the missionary W. Ellis of the London Missionary Society (LMS) reorganized Christianity in Madagascar. Ellis formed the project to build a number of stone commemorative churches in the wonderful sites on the hills of Antananarivo, where the martyrs had suffered tortures. Radama II granted him the land for construction of Malagasy Martyrs memorial churches, died for their faith. Christians of England subscribed two years, at the urging of Ellis, francs requested. - Steps were taken to London for the commitment of the architect Sibree. Ellis asked also Cameron, who was still in Cape Town, to join them. There was some confusion in the instructions, which did not deter Cameron to play an important project, especially for Ambatonakanga and Faravohitra churches. - Cameron has undertaken a wide variety of lay and missionaries activities after his return from South Africa. The work of Cameron ( ) dominates Tananarive. He built several buildings on the Rova whose "Manampisoa" translated as "extra beauty" (1866), the Royal Tomb (1868), the stone shell of the Palace of the Queen "the Manjakamiadana" (1869). He was the first to identify and map the Imerina and the region of Fianarantsoa. Another important job was digging the lake Anosy and its inlet channel water, part of a major project for a powder magazine, designed by Cameron and Chick. These constructions have given a boost to the Malagasy culture. «ITantara 29:3 Ary koa, noho ny fitiavako ny tranon'andriamanitro dia omeko ho an'ny tranon'andriamanitra, ho fanampin'ny zavatra rehetra novoriko hanaovana ny tempoly masina, izay volamena sy volafotsy ananako» ou De plus, dans mon attachement pour la maison de mon Dieu, je donne à la maison de mon Dieu l'or et l'argent que je possède en propre, outre tout ce que j'ai préparé pour la maison du sanctuaire - Cameron était un artisan menuisier- missionnaire et c'est en tant que tel qu'il fut recruté par la London Missionary Society (LMS, Société missionnaire de Londres). Comme il était capable de faire autres choses, on l'envoya étudier la filature et le tissage du coton à Manchester, afin qu'il puisse aider un collègue que la LMS devait envoyer à Madagascar pour un projet de cet ordre. Cameron débarqua à Madagascar en 1826, avec un groupe de jeunes missionnaires. Il aida donc son collègue filateur, mais ce projet fut très rapidement abandonné. Le génie de Cameron était d'utiliser les ressources locales. - A la mort de Ranavalona en 1861 et sa succession par Radama II, Cameron retourna dans l île. De sa résidence à Ambatonakanga, il a construit le premier temple chrétien et la première école de style occidental à Madagascar. Il éduqua les malgaches dans la construction de machines et d'autres projets de travaux publics. Il a introduit la

20 fabrication de briques en 1826, une technologie qui devait plus tard être utilisé dans un style malgache, une nouvelle architecture qui a été adoptée dans les hautes terres centrales. Six cents apprentis se mirent à l œuvre pour les quatre édifices Ambatonakanga, Ampamarinana, Ambohipotsy et Faravohitra. Les ouvriers apprirent en maçonnerie, menuiserie, fabrication de tuiles et travail de fer, comment ils pourraient utiliser leurs propres richesses en pierres, bois et métaux. Grâce à l intelligence et à la vivacité naturelle de la population, les constructions marquèrent le développement religieux et matériel de Madagascar - L ingéniosité de Cameron était inestimable quand il a contribué à l assemblage et à la mise en route de la première presse d'imprimerie sur l'île, qui a servi à l impression de la traduction de la Bible en malgache. L'artisan-imprimeur envoyé par la LMS était mort dès son arrivée et n'avait même pas pu déballer sa machine. - Cameron avait d autres talents, à partir de la presse à imprimerie, il avait sorti un opuscule de 32 pages sur les principes de la gravitation (1832), d'autres brochures en malgache sur la géométrie, les poids et mesures. Il s'intéressait à l'astronomie. Quand un passage de la planète Vénus était visible de Tananarive, il faisait des observations et des calculs qu'il communiquait à l'astronome de l'observatoire royal du Cap. Il aurait mis également son talent de géomètre-arpenteur au premier plan de Tananarive, publié dans l'histoire, (History) d'ellis en 1838, plan revu pour le Madagascar revisited du même auteur en Quand une délégation de la LMS vint en 1875 visiter Madagascar, Cameron fut de ceux qui l'accompagnèrent à Fianarantsoa. Mais il avait alors 75 ans et ce voyage l'épuisa. Il mourut à Tananarive le 3 octobre Wébographie J. T. Hardyman, L. Molet. Cameron, James- Dibica- De 1800 à 1875, Protestant, Madagascar/Afrique du Sud. < Bibliographie Daniel Keck. Histoire des origines du Christianisme à Madagascar. Thèse présentée à la faculté de théologie Protestante de Paris pour obtenir le grade de bachelier en théologie. Imprimerie et Librairie Centrales des Chemins de Fer- Imprimerie Chaix. Société anonyme au capîtal de trois millions. Rue Bergère, 20, Paris pages English traduction "IChronicles 29:3 Besides, in my devotion to the temple of my God I now give my personal treasures of gold and silver for the temple of my God, over and above everything I have provided for this holy temple - Cameron was a carpenter, missionary, and as such, he was recruited by the London Missionary Society (LMS London Missionary Society). As he was capable of doing other things, he was sent to study spinning and weaving of cotton in Manchester, so he can help a colleague that the LMS would sent to Madagascar for a project of this nature. Cameron arrived in Madagascar in 1826, with a group of young missionaries.

21 So he helped his fellow spinner, but that plan was quickly abandoned. Cameron's genius was to use local resources. - On the death of Ranavalona in 1861 and her succession by Radama II, Cameron returned to the island. From Ambatonakanga, his residence, he built the first Christian church and the first western style school in Madagascar. He educated the Malagasy in construction machinery and other public works projects. He introduced the manufacture of bricks in 1826, a technology that was later used in a Malagasy style, a new architecture that was adopted in the central highlands. Six hundred apprentices set to work for four buildings Ambatonakanga, Ampamarinana, and Ambohipotsy Faravohitra. The workers learned masonry, carpentry, tile making and iron work, how they could use their own wealth of stone, wood and metals. With intelligence and population natural vivacity, buildings marked the religious development and equipment of Madagascar. - The ingenuity of Cameron was priceless when he helped assemble and start up the first printing press on the island, which was used for printing the translation of the Bible in Malagasy. The artisan-printer sent by the LMS was dead on arrival and could not even unpack his machine. - Cameron had other talents, from the printing press, he released a 32-page booklet on the principles of gravitation (1832), others brochures in Malagasy on geometry, weights and measures. He was interested in astronomy. When a portion of the planet Venus was visible in Antananarivo, he made observations and calculations that he communicated to the Royal Observatory Astronomer in Cape Town. He would also put his talent surveyor for the plan of Antananarivo, published in history (History) Ellis in 1838, revised plan for Madagascar revisited by the same author in When a delegation of the LMS in 1875 came to visit Madagascar, Cameron was among those who accompanied him to Fianarantsoa. But he was then 75 years and this trip exhausted him. He died in Tananarive in October 3, «Hitako ny lalantsara ka hizoraka» ou «j ai trouvé le bon chemin et je le suis»: l expression célèbre de la martyre Rasalama avant qu elle ne reçoit le coup de lance - Rasalama était probablement parmi les premiers élèves dans les écoles de village ouvertes par la London Missionary Society en Quand sa famille s'installa à Manjakaray dans les faubourgs de la capitale, elle était devenue membre de la première communauté chrétienne à Ambodin'Andohalo, près du palais royal. - Elle était parmi les premiers Malgaches à être baptisés (mai 1831) et à communier à Ambatonakanga en juin En 1835, quand la nouvelle reine Ranavalona I ère déclara le christianisme illégal, Rasalama se cacha dans une grotte, près de sa maison. Elle a été condamnée à mort, pour cause de rébellion contre la volonté de la reine. - Le 14 août 1835, après une nuit de souffrances dans les fers, elle a été amenée à Ambohipotsy. La marche à pied qu'elle a faite, tout en prières et en cantiques, jusqu'au lieu de l'exécution, est devenue légendaire. Elle a été transpercée d'un coup de lance et son corps n'a pas été enseveli. Une église commémorative a été érigée sur le site. Son martyr a fait une grande impression sur ses compatriotes et sur les protestants anglais. Une plaque commémorative en son nom a été placée dans la chapelle de Brunswick, à Bristol, en Angleterre. La commémoration du 150 e anniversaire de sa mort en 1987 a été un événement historique pour Madagascar. English traduction

22 Where I found the right path, there I am : the famous phrase of the martyr Rasalama before she receives the spear - Rasalama was probably among the first students in village schools started by the London Missionary Society, in When her family moved to Manjakaray, the outskirts of the capital, she became a member of the first Christian community Ambodin'Andohalo, near the royal palace. - She was among the first to be baptized Madagascar (May 1831) and to share in Ambatonakanga in June In 1835, when the new Queen Ranavalona I declared Christianity illegal Rasalama hid in a cave near her house. She was sentenced to death for rebellion against the will of the queen. - August 14, 1835, after a night of suffering in chains, she was led to Ambohipotsy. The walking she made, in prayers and hymns, to the place of execution has become legendary. She was pierced by a spear and her body was not entombed. A memorial church was erected on the site. Her martyrdom made a deep impression on her compatriots and the english protestants. A plaque in her name was placed in the chapel of Brunswick, in Bristol, England. The commemoration of the 150th anniversary of her death in 1987 was an historic event for Madagascar. Wébographie Editorial- Liens protestants- Les protestants mai Mardi 11 mai 2010 < ITesaloniana 2:10 «Hianareo no vavolombelona ary Andriamanitra koa fa masina sy marina ary tsy nanan-tsiny tokoa ny fitondrantenanay teo imasonareo izay mino» ou Vous êtes témoins, et Dieu l'est aussi, que nous avons eu envers vous qui croyez une conduite sainte, juste et irréprochable. - Rafaravavy Marie ( ) était parmi les huit personnes baptisées par le missionnaire Griffiths à Ambatonakanga, le 5 juin 1831, lors de l'inauguration du temple en bois. Elle choisit Marie comme nom de baptême. La reine Ranavalona, qui succéda à Radama I, proclama l'interdiction du christianisme dans son royaume le 1er mars 1835.Peu après, tous les missionnaires durent quitter le pays et la persécution commença. Ceux qu'on dénonçait comme chrétiens devaient abjurer ou se désolidariser publiquement de la communauté chrétienne par d'abominables imprécations. - Rafaravavy fut dénoncée trois fois et on l amena à dénoncer d'autres chrétiens, lui faisant espérer la vie sauve si elle y consentait. Elle reconnut qu elle était chrétienne mais refusa de dénoncer qui que ce soit. D extraction noble, elle fut au début relâchée. - Une autre fois, on annonça publiquement qu'on livrait ses biens au peuple. Une ruée de gens s'empressait de s'emparer de ses biens et sa maison fut démolie. Elle devait être mise à mort à coups de sagaies le lendemain, mais la nuit qui précède, une incendie ravagea le quartier d'ambohimitsimbina jusque dans la cour du palais de la reine. Le premier ministre Rainiharo donna l'ordre de surseoir à toutes les affaires officielles y compris l'exécution de Rafaravavy. La reine païenne pieuse, craignait de se heurter à la puissance surnaturelle de la jeune femme, sa peine fut commuée en esclavage à perpétuité auprès d un noble. - Mais, elle continuait d organiser des réunions de prières clandestines où l'on lisait les Saintes Écritures et la traduction malgache du "Voyage du Pèlerin" de John Bunyan.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

Noely 2009 Taom-baovao 2010

Noely 2009 Taom-baovao 2010 FMM Fiombonana Miara-mivavaka eto Münich. Noely 2009 Taom-baovao 2010 Fa Zaza no teraka ho antsika, Zazalahy no omena antsika, ary ny anarany atao hoe Mahagaga, Mpanolon-tsaina, Andriamanitra Mahery, Rain

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg 0 UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. "Dieu qualifie ceux qui sont appelés", hoy Rakotolehibe Mamy, Talen ny FMMB

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. Dieu qualifie ceux qui sont appelés, hoy Rakotolehibe Mamy, Talen ny FMMB Taniketsa - Laharana faha 58 - Septambra 2014 1 Gazetin ny Sampana Sekoly Alahady FJKM Andrainarivo Taniketsa Miseho isan-telo volana. Laharana faha 58. Septambra 2014. Vidiny: 400 Ariary. Tranokala: www.sa-andrainarivo.mg

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

Ny Vaovao Mahafaly. La Bonne Nouvelle

Ny Vaovao Mahafaly. La Bonne Nouvelle Ny Vaovao Mahafaly La Bonne Nouvelle Ary tamin ny fahenim-bolana dia nirahin Andriamanitra ny anjely Gabriela ho any an-tanàna anankiray any Galilia atao hoe Nazareta, ho any amin ny virijina anankiray,

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

FINOANA SY FAHAZAVANA FOI ET LUMIERE

FINOANA SY FAHAZAVANA FOI ET LUMIERE FINOANA SY FAHAZAVANA FOI ET LUMIERE BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 Gazety avoakan ny Mpiaramivavaka Kristianina Malagasy eto Bénélux (M.K.M.B.) Bulletin de liaison et d information de la

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

LA PERSONNE SPÉCIALE

LA PERSONNE SPÉCIALE LA PERSONNE SPÉCIALE These first questions give us some basic information about you. They set the stage and help us to begin to get to know you. 1. Comment tu t appelles? What is your name? Je m appelle

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

MpANAMORY RAdO RABARILALA

MpANAMORY RAdO RABARILALA ENIM-BOLANA TSY TAFATSANGANA FANJAITRA MIISA 21 NO NESORINA TAO AN-KIBON i LALAINA P.06 N 3190 L u n d i 2 9 j u i n 2 0 1 5 PRIX : Ar 400 zatovolahy NANGALATRA volamena P.06 TENY AM-pASANA : NANONOFY

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

M o t d u P rov i n c i a l Temps de grâces

M o t d u P rov i n c i a l Temps de grâces Mot du Provincial Temps de grâces Plusieurs événements de la province et de l Église à Madagascar constituent nos sources d action de grâce à adresser au Seigneur. La visite fraternelle et édifiante du

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

The Skill of Reading French

The Skill of Reading French The Skill of Reading French By the end of this session... ALL of you will be able to recognise words A LOT of you will be able to recognise simple phrases SOME of you will be able to translate a longer

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

Février - mars 2016 n 47 TRAIT D UNION

Février - mars 2016 n 47 TRAIT D UNION Février - mars 2016 n 47 TRAIT D UNION Le journal en ligne de la RNS Train Manakara-Fianarantsoa Éditorial 2 Lyon et ses incontournables 3 La tribune du coordinateur 4 Itinéraire d un sportif gâté 5 Lalaina

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

Photo: Sgt Serge Gouin, Rideau Hall Her Majesty The Queen in Right of Canada represented by the Office of the Secretary to the Governor General

Photo: Sgt Serge Gouin, Rideau Hall Her Majesty The Queen in Right of Canada represented by the Office of the Secretary to the Governor General As the father of five children and the grandfather of ten grandchildren, family is especially important to me. I am therefore very pleased to mark National Foster Family Week. Families, whatever their

Plus en détail

Conversations en ligne : descriptions, perspectives. Louise Ouvrard

Conversations en ligne : descriptions, perspectives. Louise Ouvrard Conversations en ligne : descriptions, perspectives Eléments théoriques La variation Quelques caractéristiques du discours électronique La langue malgache Le corpus Présentation Analyse Quels apports à

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA TATITRA ANIVON NY ANTENIMIERAM- PIRENENA Praiminisitra Jean RAVELONARIVO 1 TATITRA MANOLOANA NY ANTENIMIERA I 21 MAY 2015 21 MAY 2015 Andininy 54.- Ny Filohan ny Repoblika no manendry ny Praiminisitra

Plus en détail

90558-CDT-06-L3French page 1 of 10. 90558: Listen to and understand complex spoken French in less familiar contexts

90558-CDT-06-L3French page 1 of 10. 90558: Listen to and understand complex spoken French in less familiar contexts 90558-CDT-06-L3French page 1 of 10 NCEA LEVEL 3: FRENCH CD TRANSCRIPT 2006 90558: Listen to and understand complex spoken French in less familiar contexts New Zealand Qualifications Authority: NCEA French

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

LANY TAMINGANA ETO AMINTSIKA

LANY TAMINGANA ETO AMINTSIKA cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

JEAN-MARC CHÂTAIGNIER Défenseur de Joaquim Chissano

JEAN-MARC CHÂTAIGNIER Défenseur de Joaquim Chissano cyan magenta jaune noir PROGRAMME P.7 QUOTIDIEN GRATUIT D INFORMATION N 0103 DU Vendredi 16 Juillet 2010 L accès sans peine à l information OIF SOATOAVINA TRAFIC Soutien de la médiation internationale

Plus en détail

Commemorating the Legacy of des pensionnats indiens

Commemorating the Legacy of des pensionnats indiens lorier o c à e Livr Colouring Book Vitrail au Parlement Stained Glass Window in Parliament commémorant les séquelles Commemorating the Legacy of des pensionnats indiens Indian Residential Schools Un vitrail

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

TUESDAY, 11 MAY 1.30 PM 2.30 PM. Date of birth Day Month Year Scottish candidate number

TUESDAY, 11 MAY 1.30 PM 2.30 PM. Date of birth Day Month Year Scottish candidate number FOR OFFICIAL USE C Total 000/403 NATIONAL QUALIFICATIONS 00 TUESDAY, MAY.30 PM.30 PM FRENCH STANDARD GRADE Credit Level Reading Fill in these boxes and read what is printed below. Full name of centre Town

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail