Recent developments of EU case law on radio spectrum management

Dimension: px
Commencer à balayer dès la page:

Download "Recent developments of EU case law on radio spectrum management"

Transcription

1 BROADBAND DEPLOYMENT & SPECTRUM MANAGEMENT IN THE DIGITAL SINGLE MARKET: FROM POLICY TO JUDICIAL CONTROL Recent developments of EU case law on radio spectrum management Ignacio ULLOA RUBIO Judge at EUGC Brussels, 2nd December

2 I. C-Lon broadband deployment related to Competition ECJ , Telia Sonera ECJ , Telefónica EGC , Colt Telecommunications France II. C-L on D. 2002/20/EC, Authorisation Directive ECJ , Vodafone Omnitel NV ECJ , Commission V. Cyprus ECJ , Vodafone Malta Ltd ECJ , Commission V. France ECJ , Belgacom ECJ , Vodafone España SA ECJ , Telefónica Móviles España ECJ , Telefónica de España SA III. C-L on D. 2002/21/EC, , Framework Directive, & D. 2002/22/EC, , on Universal Service Directive ECJ , Telekomunikacja Polska SawWarszawiek ECJ , Commission V. Belgium ECJ , Commission V. Poland IV. C-L on D. 95/46/CE, , on personal data-protection directive. ECJ , Joseph Probst ECJ , Bonnier Audio AB ECJ , Deutsche Telecom AG 2

3 Case Law on broadband deployment related to Competition : Art. 102 TFUE (abuse of a dominant position) EUCJ (1st Ch.) Judgment , preliminary ruling from the Stockholms tingsrätt (Sweden), in Konkurrensverket V Telia Sonera Sverige AB in the absence of any objective justification, the fact that a vertically integrated undertaking, enjoying a dominant position on the wholesale market for ADSL input services, applies a pricing practice of such a kind that the spread between the prices applied on that market and those applied in the retail market for broadband connection services to end users is not sufficient to cover the specific costs which that undertaking must incur in order to gain access to that retail market may constitute an abuse within the meaning of Art.102 TFEU. 113: all of the circumstances of each individual case should be taken into consideration. In particular: - as a general rule, primarily the prices and costs of the undertaking concerned on the retail services market should be taken into consideration. Only where it is not possible, in particular circumstances, to refer to those prices and costs should those of competitors on the same market be examined, and -it is necessary to demonstrate that, taking particular account of whether the wholesale product is indispensable, that practice produces an anti-competitive effect, at least potentially, on the retail market, and that the practice is not in any way economically justified. 114: The following factors are, as a general rule, not relevant to such an assessment: - the absence of any regulatory obligation on the undertaking concerned to supply ADSL input services on the wholesale market in which it holds a dominant position; - the degree of dominance held by that undertaking in that market; - the fact that that undertaking does not also hold a dominant position in the retail market for broadband connection services to end users; - whether the customers to whom such a pricing practice is applied are new or existing customers of the undertaking concerned; - the fact that the dominant undertaking is unable to recoup any losses which the establishment of such a pricing practice might cause, or - the extent to which the markets concerned are mature markets and whether they involve new technology, requiring high levels of investment. 3

4 EUGC (8th Ch.) Judgment , annulment of Commission Decision C (2007) 3196 final ( ): Telefónica, SA V Commission (T-336/07). General Advocate Wathelet Conclusions Relevant market 111: the possibilities of competition must be judged in the context of the market comprising the totality of the products which, with respect to their characteristics, are particularly suitable for satisfying constant needs and are only to a limited extent interchangeable with other products. Moreover, since the determination of the relevant market is useful in assessing whether the undertaking concerned is in a position to prevent effective competition from being maintained and to behave to an appreciable extent independently of its competitors, its customers and consumers, an examination to that end cannot be limited solely to the objective characteristics of the relevant products, but the competitive conditions and the structure of supplyanddemand onthemarketmustalsobetakenintoconsideration The concept of the relevant market implies that there can be effective competition between the products which form part of it and this presupposes that there is a sufficient degree of interchangeability between all the products forming part of thesamemarketinsofarasaspecificuseof suchproductsisconcerned [a] relevant product market comprises all those products and/or services which are regarded as interchangeable or substitutable by the consumer, by reason of the products characteristics, their prices and their intended use. [From an economic POV, definition of the relevant market, demand-side substitution Supply-side substitutability ]. That means that suppliers are able to switch production to the relevant products and market them in the short term without incurring significant additional costs or risks in response to small and permanent changes in relative prices(p.20 of that notice) the Court must reject the applicants argument that there is sufficient substitutability between the regional wholesale product, the national wholesale product and local loop unbundling, owing to the fact that in each of Telefónica s exchanges a sufficient number of alternative operators use a combination of different wholesale products that best meet their needs and that that substitutability on the margin is sufficient in the present case for those products to be considered to belong to the same relevant product market. 4

5 Dominat position 146 the question whether a pricing practice introduced by a vertically integrated dominant undertaking in a wholesale market and resulting in the margin squeeze of competitors of that undertaking in the retail market does not depend on whether that undertaking is dominant in that retail market. 162 The possible existence of competition on the market is indeed a relevant factor for the purposes of determining the existence of a dominant position. However, even the existence of lively competition on a particular market does not rule out the possibility that there is a dominant position on that market, since the predominant feature of such a position is the ability of the undertaking concerned to act without having to take account of this competition in its market strategy and without for that reason suffering detrimental effects from such behaviour. 166 Although the ability to impose regular price-increases unquestionably constitutes a factor capable of pointing to the existence of a dominant position, it is by no means an indispensable factor, as the independence which a dominant undertaking enjoys in pricing matters has more to do with the ability to set prices without having to take account of the reaction of competitors, customers and suppliers than with the ability to increase prices However, since all the competing wholesale access products are based on Telefónica s local loops or on its regional wholesale product, the availability of competing products depends not only on the actual availability of unbundled local loops and/or the regional wholesale product, but also on the economic conditions under which they are provided. Pricing 187 itmustbeborneinmindthatitisthemarginsqueezethat,intheabsenceofanyobjectivejustification,isin itself capable of constituting an abuse within the meaning of Art. 82 EC. A margin squeeze is the result of the spread between the prices for wholesale services and those for retail services and not of the level of those prices as such. In particular, that squeeze may be the result not only of an abnormally low price on the retail market, but also of an abnormally high price on the wholesale market (see, to that effect, TeliaSonera, p. 146). Accordingly, the Commission was not required to demonstrate in the contested decision that Telefónica charged excessive prices for its wholesale indirect access products or predatory prices for its retail products. 5

6 190. In order to assess the lawfulness of the pricing policy applied by a dominant undertaking, reference should be made, in principle, to pricing criteria based on the costs incurred by the dominant undertaking itself and on its strategy In particular, as regards a pricing practice which causes a margin squeeze, the use of such analytical criteria can establish whether that undertaking would have been sufficiently efficient to offer its retail services to endusers otherwise than at a loss if it had first been obliged to pay its own wholesale prices for the intermediary services The validity of such an approach is reinforced by the fact that it also conforms to the general principle of legal certainty, since taking into account the costs and prices of the dominant undertaking enables that undertaking, in the light of its special responsibility under Art. 82 EC, to assess the lawfulness of its own conduct. While a dominant undertaking knows its own costs and prices, it does not as a general rule know those of its competitors. Furthermore, an exclusionary abuse also affects potential competitors of the dominant undertaking, which might be deterred from entering the market by the prospect of a lack of profitability Admittedly, it also follows from the case-law that it cannot be ruled out that the costs and prices of competitors may be relevant to the examination of the pricing practice at issue. However, it is only where it is not possible, in the light of the particular circumstances indicated by the Court of Justice, to refer to the prices and costs of the dominant undertaking that the prices and costs of competitors on the same market should be examined(teliasonera, ), and the applicants have not maintained that this is the case here. 201 that Art. 82 EC prohibits, in particular, an undertaking in a dominant position on a specific market from adopting pricing practices which have an exclusionary effect on its equally efficient actual or potential competitors (see p. 189). In that regard, examination of such a position calls for an assessment of the possibilities of competition in the context of the market consisting of all the products which, according to their characteristics, are particularly appropriate for satisfying consistent needs and are not readily interchangeable with other products, the determination of the relevant market serving to evaluate whether the undertaking concerned is able to hinder effective competition on that market (see p. 111). In fact, it has been held, first, that the Commission was correct to take the view that local loop unbundling, the national wholesale product and the regional wholesale product did not belong to the same market and, second,, that a margin squeeze onarelevantmarketwasinitselflikelytoconstituteanabusewithinthemeaning ofart.82ec. 202 Those wholesale products are not part of the same product market. 6

7 Distortion of competition 204. According to the case-law, a system of undistorted competition, as laid down in the Treaty, can be guaranteed only if equality of opportunity is secured as between the various economic operators. Equality of opportunity means that Telefónica and its at least equally efficient competitors are placed on an equal footing on the retail market. That is not the case, 1 st, if the prices of national and regional wholesale products paid to Telefónica by the alternative operators could not be reflected in their retail prices and, 2 nd, if the alternative operators, given the prices of Telefónica s national and regional wholesale products, could offer those products onlyataloss,whichtheywouldhavetooffsetbyrevenuescoming from othermarkets Furthermore, the applicants argument based on the use by the alternative operators during the infringement period, in each exchange, of an optimal combination of wholesale products, which would include local loop unbundling, is inconsistent, Telefónica had maintained the possible existence of a margin squeeze must be carried out solely on the basis of the regional wholesale product For the purposes of establishing an infringement of Art. 82 EC, it is sufficient to show that the abusive conduct of the undertaking in a dominant position tends to restrict competition or, in other words, that the conduct is capable of having, or likely to have, that effect The pricing practice concerned must have an anticompetitive effect on the market, but the effect does not necessarily have to be concrete, and it is sufficient to demonstrate that there is a potential anti-competitive effect that may exclude competitors who are at least as efficient as the dominant undertaking(teliasonera, p.146 above, p.64) the competition rules laid down in the EC Treaty supplement, by ex-post review, the regulatory framework adopted by the EU legislature for ex-ante regulation of the telecommunications markets. Relevance of National Law 328. It must be borne in mind that Art. 82 EC applies only to anti-competitive conduct engaged in by undertakings on their own initiative. If anti-competitive conduct is required of undertakings by national legislation or if the latter creates a legal framework which itself eliminates any possibility of competitive activity on their part, Art. 82 EC does not apply. In such a situation, the restriction of competition is not attributable, as that provision implicitly requires, to the autonomous conduct of the undertakings. 7

8 Intetion: Due diligence 319. In the first place, as regards the question whether an infringement was committed intentionally or negligentlyand is thereforeliabletobepenalised byafineunder Art.23(2)of Regulation No 1/2003, it follows from the case-law that that condition is satisfied where the undertaking concerned could not have been unaware that its conduct was anti-competitive, whether or not it was aware that it was infringing the competition rules of the Treaty According to the case-law, an undertaking is aware of the anti-competitive nature of its conduct where it is aware of the essential facts justifying both the finding of a dominant position on the relevant market and the finding bythecommission ofanabuseofthatposition As a diligent economic operator, Telefónica ought to have been familiar with the principles governing market definition in competition cases and, where necessary, taken appropriate legal advice to assess, to a degree that is reasonable in the circumstances, the consequences that a given act may entail. That is particularly true in relation to persons carrying on a professional activity, who are used to having to proceed with a high degree of caution when pursuing their occupation. They can on that account be expected to take special care in assessing the risks that such an activity entails Furthermore, there can be no doubt, for a prudent economic operator, that, although the possession of large market shares is not necessarily and in every case the only factor determining the existence of a dominant position, it has however a considerable significance which must of necessity be taken into consideration by him in relation to his possible conduct on the market Telefónica, the historical operator and owner of the only significant infrastructure for the supply of the regional and national wholesale products, could not be unaware that it held a dominant position on the relevant markets. Accordingly, the significance of the market shares held by Telefónica on the national and regional wholesale markets means that Telefonicas belief that it did not occupy a dominant position on those markets could only be the outcome of an inadequate study of the structure of the markets on which it operated or a refusal to take those structures into consideration. The argument that Telefónica could not have foreseen that the Commission would adopt a different definition of the market from that adopted by the Spanish authorities cannot therefore succeed. 8

9 EUGC Judgment , annulation de la compensation (59m ) de charges de service public [no-aide-d état] dans un projet de réseau de communications électroniques à très-haut-débit dans Hauts-de-Seine) Colt Telecommunications V Comission, France & Sequalum. 33 il appartient à la Commission de déterminer, en fonction des circonstances de fait et de droit propres à l affaire, si les difficultés rencontrées dans l examen de la mesure notifiée nécessitent l ouverture de la procédure formelle d examen. Cette appréciation doit respecter trois exigences ère) l article 88 CE circonscrit le pouvoir de la Commission de se prononcer sur l existence d une aide au terme de la procédure d examen préliminaire aux seules mesures ne soulevant pas de difficultés sérieuses, de telle sorte que ce critère revêt un caractère exclusif. Ainsi, la Commission ne saurait refuser d ouvrir la procédure formelle d examen en se prévalant d autres circonstances, telles que l intérêt de tiers, des considérations d économie de procédure ou tout autre motif de convenance administrative ou politique ème), lorsqu elle se heurte à des difficultés sérieuses, la Commission est tenue d ouvrir la procédure formelle et ne dispose, à cet égard, d aucun pouvoir discrétionnaire ème), la notion de difficultés sérieuses revêt un caractère objectif. L existence de telles difficultés doit être recherchée tant dans les circonstances d adoption de l acte attaqué que dans son contenu, d une manière objective, en mettant en rapport les motifs de la décision avec les éléments dont la Commission pouvait disposer lorsqu elle s est prononcée sur la qualification d aide de la mesure litigieuse. Il en découle que le contrôle de légalité effectué par le Tribunal sur l existence de difficultés sérieuses, par nature, ne peut se limiter à la recherche de l erreur manifeste d appréciation. 37. il convient de relever que la partie requérante supporte la charge de la preuve de l existence de difficultés sérieuses, preuve qu elle peut fournir à partir d un faisceau d indices concordants, relatifs, d une part, aux circonstances et à la durée de la phase préliminaire d examen et, d autre part, au contenu de la décision attaquée. 84. Il appartient, dès lors, au Tribunal d apprécier les indices tirés du contenu de la décision attaquée au regard de l existence d une difficulté sérieuse au sens de la jurisprudence citée aux points 34 à 37 ci-dessus. En revanche, il n appartient pas au Tribunal, à ce stade de la procédure d examen d une aide par la Commission, de se prononcer sur l existence d une aide ou sur sa compatibilité avec le marché commun. 9

10 87. Selon l arrêt Altmark, une intervention étatique ne tombe pas sous le coup de l art. 87, 1, CE(aide d état), dans la mesure où elle doit être considérée comme une compensation représentant la contrepartie des prestations effectuées par les entreprises bénéficiaires pour exécuter des obligations de service public, de sorte que ces entreprises ne profitent pas, en réalité, d un avantage financier et que ladite intervention n a donc pas pour effet de mettre ces entreprises dans une position concurrentielle plus favorable par rapport aux entreprises qui leur font concurrence En effet, il suffit de relever à cet égard que la requérante n a ni mis en évidence de doute quant à la méthode de détermination de la rentabilité du territoire départemental, ni fourni au Tribunal un minimum d éléments accréditant l utilité du document en cause (definition de zones de reference) pour les besoins de l instance l objectif visé étant la connectivité de l ensemble des établissements publics en cause, il suffit que certains d entre eux soient situés dans des zones non rentables pour que l intérêt général spécifique de l intervention publique soit reconnu. 138 la notion de «prise raccordable», qui est susceptible d être transformée et doit encore être transformée en prise raccordée, correspond précisément à l exigence d universalité telle que définie au considérant 8 de la directive 2002/22. En effet, en déployant des prises raccordables, le délégataire crée les conditions dans lesquelles il peut, à la demande des usagers, assurer à ceux-ci un raccordement au très haut débit en transformant lesdites prises en prises raccordées. Ainsi, le délégataire est obligé,...[convention de DSP], de procéder à une telle transformation, pour autant que le seuil pertinent est atteint. 166 Or, la défaillance du marché doit s apprécier en fonction des obligations de service public envisagées et, partant, en l espèce, être vérifiée à la fois dans les zones rentables et dans les zones non rentables compte tenu de l obligation de couverture universelle imposée au délégataire. 10

11 Case Law on Directive 2002/20/EC, , on authorisation of electronic communications networks and services (Authorisation Directive) EUCJ (8th Ch.) Judgment (Preliminary Ruling from Tribunale amministrativo regionale per il Lazio) Vodafone Omnitel NV & others V. Autorità per la garantie nelle Comunicazioni& others(c /12& C /12): 43 Article 12 of the Authorization Directive must be interpreted as meaning that it does not preclude legislation of a MS, such as that at issue in the main proceedings, pursuant to which undertakings providing electronic communications services or networks are liable to pay a charge intended to cover all the costs incurredbythenrawhicharenot financedbythestate,theamount ofwhichbeing determined according to the income received by those undertakings, provided that that charge is exclusively intended to cover the costs relating to the activities mentioned in Article 12(1)(a), that the totality of the income obtained in respect of that charge does not exceed the total costs relating to those activities and that that charge is imposed upon individual undertakings in an objective, transparent and proportionate manner, which is for the national court to ascertain. 11

12 EUCJ (5th Ch.) Judgment [failure to fulfill obligations of transposition of Directives 2002/20/CE (Authorization Directive) & 2002/21/CE(Frame Directive)], Commission V Cyprus (C-125/09). 42 Une transposition effective desdites dispositions suppose ainsi non seulement que l autorité compétente pour l octroi de tels droits soit clairement désignée, mais aussi que des procédures administratives transparentes soient établies pour la mise en œuvre de ceux-ci. 43. Or, le régime d autorisation en cause en matière de délivrance de droits de passage sur le domaine public manque de transparence. 44. D une part, il est constant que les autorités nationales compétentes ont procédé, lors du traitement des demandes de permis de construire ou d urbanisme, à une évaluation de l impact environnemental des champs électromagnétiques, bien qu une telle évaluation ne fût pas prévue par la législation nationale. 45. D autre part, force est de constater que la République de Chypre admet des retards relatifs à l octroi des droits de passages en ce qui concerne l installation de mâts et d antennes, ces retards résultant du chevauchement des compétences entre les autorités chargées de délivrer les permis de construire et d urbanisme. 46. Dans ces conditions, il y a lieu de constater que, en ne garantissant pas l octroi de droits de passage sur, au dessus ou au-dessous de propriétés publiques sur la base de procédures transparentes, appliquées sans discrimination et sans retard, conformément aux articles 11, paragraphe 1, de la directive «cadre», et de l article 4, paragraphe 1, de la directive «autorisation», la République de Chypre a manqué aux obligations qui lui incombent en vertu de ces directives. 12

13 EUCJ Judgment (3 rd Ch.) (preliminary ruling from Qorti Kostituzzjonali di Malta) Vodafone Malta Ltd. & others V Avukat Ġenerali& others (C-71/12): 25. On the other hand, a charge the trigger for which is linked not to a general authorisation procedure for access to the electronic telecommunications services market but to the use of mobile telephony services provided by operators and which is ultimately borne by the user of suchservicesdoesnotfallwithinthescopeofart.12ad. 27 thechargeatissueinthemainproceedingsisreferredtoas exciseduty, that it is not levied on all electronic telecommunications operators holding a general authorisation but only on operators proving mobile telephony services that charge is paid to the mobile telephony operators by their users on an individual basis, the sum in question subsequently being passed on to the Comptroller of Customs by all operators providing mobile telephony services and being payable only by those operators and not by other undertakings, including those providing electronic communications networks and other services. 28. In the light of those considerations, it would appear that the charge at issueinthemainproceedingsisakintoataxonconsumption,whichisamatter for the national court to verify. If that is indeed the case, that charge does not fallwithinthescopeofart.12ofad. 13

14 EUCJ (3rd Ch.) Judgment (failure to fulfill obligations of Directive 2002/20/CE) Commission V France (C- 485/11). 33. En l occurrence, il y a lieu de relever que, ainsi qu il ressort du libellé de l article 302 bis KH du CGI, le fait générateur de la taxe litigieuse prévue à cet article est lié à la fourniture d un service en France par tout opérateur de communications électroniques et. L article 302 bis KH du CGI prévoit qu un opérateur ne devient redevable de cette taxe litigieuse que lorsque ses revenus pour les services aux usagers finals excèdent 5 millions. Les opérateurs de communications électroniques qui fournissent des prestations d interconnexion, d accès, de diffusion ou de transport des services de communications audiovisuelles ne sont pas redevables de la taxe litigieuse. 34 Il en découle que la taxe litigieuse est imposée non pas à tous les opérateurs de communications électroniques titulaires d une autorisation générale ou d un droit d utilisation des radiofréquences ou des numéros, mais aux opérateurs titulaires d une autorisation générale qui fournissent déjà leurs services sur le marché des services de communications électroniques aux usagers finals. De plus, les conditions d imposition de cette taxe énoncées à l article 302 bis KH du CGI montrent qu elle n est pas imposée [que] à l activité de l opérateur consistant à fournir des prestations de communications électroniques aux usagers finals en France. Par conséquent, il y a lieu de considérer que le fait générateur de la taxe litigieuse n est pas lié à la procédure d autorisation générale ou à l octroi d un droit d utilisation des radiofréquences ou des numéros. Dès lors, elle ne relève pas du champ d application de l article 12 de la directive «autorisation». 14

15 EUCJ (4 th Ch.) Judgment (preliminary ruling from the Belgium Constitutional Court) Belgacom, Mobistar & KPN Group SA V Belgium (C-375/11). 54 Arts 12 and 13 of the Authorisation Directive must be interpreted as not precluding a MSfrom charging mobile telephone operators holding rights of use for radio-frequencies a oneofffeepayableforbothanewacquisitionof rights ofuseforradio frequenciesandforrenewals of those rights, in addition to an annual fee for making the frequencies available, intended to encourage optimal use of the resources while at the same time also covering the cost of managing the authorisation, provided that those fees genuinely are intended to ensure optimal use of the resource made up of those radio frequencies [promotion of competition] and are objectively justified, transparent, non-discriminatory and proportionate in relation to their intended purpose and take into account the objectives in Art. 8 of the Framework Directive, whichitisforthenational courttoassess. 55 the fixing of the amount of a one-off fee for rights of use for radio frequencies by reference either to the amount of the former one-off licence fee calculated on the basis of the number of frequencies and months to which the rights of use relate, or to the amounts raised through auction, may be an appropriate method for determining the value of the radio frequencies Art. 14(1) of the Authorisation Directive not precluding a MS from charging a mobile telephone operator a fee such as, provided that that amendment is objectively justified and effected in a proportionate manner and notice has been given to all interested parties in order toenablethemtoexpresstheirviews,whichitisforthenational courttoassess the fact of charging mobile telephone operators fees such as those at issue in the main proceedings is not liable to influence the content and scope of the rights of use for radio frequencies granted to the operators concerned. Consequently, the amendment to the fees scheme is not a restriction or withdrawal of the rights of use for radio frequencies for the purposes of Article 14(2) of the Authorisation Directive. 15

16 EUCJ (4th Ch.) Judgment preliminary ruling from the Tribunal Supremo(Spain) Vodafone Spn SA V Ayuntamiento de Staª Amalia y de Tudela// France Telecom Spn. SA V Ayuntamiento de Torremayor(C- 55/11, 57-58/11). 35 Article 13 of the Authorisation Directive must be interpreted as precluding the imposition of a fee for the right to install facilities on, over or under public or private property on operating undertakings which, without being proprietors of those facilities, use them to provide mobile telephony services. 38 Art. 13 of the Authorisation Directive satisfies those criteria (direct effect). That provision provides, in unconditional and precise terms, that MS may imposefees forrights in three specific cases, namely for the rights of use for radio frequencies or numbers or for the rights to install facilities on, over or under public or private property. 16

17 EUCJ (3rd Ch.) Judgment , preliminary ruling from the Tribunal Supremo(Spain) at Telefónica Móviles España SA V A.E. & SE de Telecomunicaciones(C- 85/10). 34 a charge imposed on operators of telecommunications services for the use of scarce resources must ensure an optimal use of those resources and must take account of the need to foster the development of innovative services and competition cannot, in light of the foregoing, preclude MS from establishing, for the purposes of determining the amount of that charge, a distinction even a significant one between, on the one hand, the digital or analogue technology used and, on the other, within each technology, the different uses which are made of it, so that equality of opportunity is secured as between the various economic operators. 35. In addition, those requirements cannot, in principle, prevent MS from increasing, even significantly, the charge payable for a particular technology in response to both technical and economic developments on the market for telecommunications services, but leaving unchanged the charge for another technology, provided that the different amounts imposed reflect the respective economic values of the uses made of the scarce resource at issue. 36. Lastly, the sole fact that such an increase in the amount of the charge is substantial does not in itself mean that this is incompatible with the purpose that a charge for the use of scarce resources must have under Art. 11(2) of Directive 97/13, provided that the charge is neither excessive nor too low. 38. the requirements laid down in Art. 11(2) of Directive 97/13, do indeed influence the level of that charge, but do not oblige MS to use that charge for a particular purpose or to use the income from that charge in a particular manner. 40 the answer to the questions referred is that the requirements laid down in Art. 11(2) of Directive 97/13 under which a charge imposed on operators of telecommunications services for the use of scarce resources.must be interpreted as not precluding national legislation which provides for a fee to be levied on operators of telecommunications services holding individual licences for the use of radio frequencies, but does not allocate a specific use to the income derived from that fee, and which significantly increases the fee for a particular technology but leaves it unchanged for another. 17

18 EUCJ (7th CH.) Judgment , preliminary ruling from the Tribunal Supremo (Spain) at Telefónica de España SA V AE. (C-284/10). 29 Directive 97/13 merely states, in Arts 6 and 11, that the fees imposed on holders of general authorisations and holders of individual licences may seek only to cover the administrative costs incurred respectively in the issue, management, control and enforcement of the applicable general authorisations scheme or the individual licences Art. 6 does not impose the requirement of a proportionate relationship between the fee applicable to general authorisations granted to a chargeable operator and the work involved in the issue, management, control and enforcement of those general authorisations for that operator. 30 Art. 12 of the Authorisation Directive provides that any administrative charges incurred in the enforcement of the general authorisation scheme are to be imposed upon the individual undertakings in a proportionate manner. It follows that the criterion of proportionality provided for in Art. 12 relates to the imposition of administrative costs upon chargeable persons and not to the relationship between the fee applicable to general authorisations and the work involved. 31. MS are entitled to determine the amount of that fee on the basis of the gross operating income of the chargeable persons, firstly, whether it is an objective, transparent and non-discriminatory criterion. Secondly, that criterion for determining the amount is not unconnected with the costs incurred by the competent national authority. 34. MS may impose on holders of general authorisations an annual fee aimed at defraying administrative costs, [and] may be made liable to pay a fee to cover, in addition to the costs of issuing the general authorisation, the administrative costs incurred in the management, control and enforcement of the authorisation during its period of validity. 35 legislation of a MS introducing a fee imposed on holders of general authorisations, to the extent that the combinedrevenuereceived bythatms bywayof suchafeedoesnotexceedallof thoseadministrativecosts. Ee 18

19 Case Law on Directive 2002/21/EC, , on a common regulatory framework for electronic communications networks and services (Framework Directive) & Directive 2002/22/EC, , on universal service and users rights relating to electronic communications networks and services (Universal Service Directive) EUCJ (3rd Ch.) Judgment (preliminary ruling from the Polska Naczelny Sąd Administracyjny) Telekomunikacja Polska SawWarszawie V Prezes Urzędu Komunikacji Elektronicznej PUKE(C-522/08) 30 the Framework Directive and the Universal Service Directive cannot preclude national legislation, such as that at issue in the main proceedings, which, for the purpose of protecting end-users, prohibits an undertaking from making the conclusion of a contract for the provision of telecommunications services contingent on the conclusion, by the end-user, of a contract for the provision of other services. 33 However, Directive 2005/29 must be interpreted as precluding national legislation which, with certain exceptions, and without taking account of the specific circumstances, imposes a general prohibition of combined offers made byavendortoaconsumer. EUTG(7 th Ch.)Order ; EUCJ(8 th Ch.)Judgment (Appeal) PUKE&Poland VCommission (rejects Cassation) 19

20 EUCJ (3rd Ch.) Judgment , failure to fulfill obligations of Directive 2002/22/CE: Comission V Belgium(C-134/10). 42. the designation of certain television channels as being subject to the must-carry obligation, under Art.13 of the Law of , constitutes a restriction of the freedom to provide services within the meaning ofart.56tfeu,asthecourthasalreadyheld. 44 a cultural policy may constitute an overriding requirement relating to the general interest which justifies a restriction of the freedom to provide services 54 Clearly, the mere statement of a general policy objective, which is not accompanied by any additional factor capable of enabling operators to determine in advance the nature and effect of the precise conditions and obligations to be fulfilled if they apply for the award of must-carry status, does not permit these requirements to be met. 55. Consequently, it must be held that the 2 nd indent of the 1 st paragraph of Art. 13 of the Law of does not clearly define the actual criteria relied upon by the national authorities to select the television broadcasters benefiting from the must-carry obligation and that that provision is not, therefore, sufficiently precise to ensure that the broadcasters thus selected are those whose content, in its entirety, is capable of meeting the general interest cultural objective pursued. 60 the criteria to be met for the award of must-carry status are unknown to the non-public television broadcasters capable of benefiting from the must-carry obligation. Consequently, such a procedure does not observe the principle of transparency, as provided for in Art. 31(1) of the Universal Service Directive. 64. a Royal Decrete designate, as benefiting from the must-carry obligation, non-public broadcasters coming under the powers of the French and Flemish Communities, so that all the programmes broadcast by those broadcasters would automatically benefit from that obligation irrespective of the overall content of those programmes and their ability to meet the legitimate general interest objectives 68 It is unclear from the 2 nd indent of the 1 st paragraph of Art. 13 of the Law of what the effect of the requirement is that non-public broadcasters must fall under the powers of the Belgian Community in order to benefit from must-carry status. 20

Loi sur le point de service principal du gouvernement du Canada en cas de décès

Loi sur le point de service principal du gouvernement du Canada en cas de décès CANADA CONSOLIDATION CODIFICATION Main Point of Contact with the Government of Canada in case of Death Act Loi sur le point de service principal du gouvernement du Canada en cas de décès S.C. 2015, c.

Plus en détail

First Nations Assessment Inspection Regulations. Règlement sur l inspection aux fins d évaluation foncière des premières nations CONSOLIDATION

First Nations Assessment Inspection Regulations. Règlement sur l inspection aux fins d évaluation foncière des premières nations CONSOLIDATION CANADA CONSOLIDATION CODIFICATION First Nations Assessment Inspection Regulations Règlement sur l inspection aux fins d évaluation foncière des premières nations SOR/2007-242 DORS/2007-242 Current to September

Plus en détail

Bill 234 Projet de loi 234

Bill 234 Projet de loi 234 1ST SESSION, 39TH LEGISLATURE, ONTARIO 58 ELIZABETH II, 2009 1 re SESSION, 39 e LÉGISLATURE, ONTARIO 58 ELIZABETH II, 2009 Bill 234 Projet de loi 234 An Act to amend the Taxation Act, 2007 to provide for

Plus en détail

Cheque Holding Policy Disclosure (Banks) Regulations. Règlement sur la communication de la politique de retenue de chèques (banques) CONSOLIDATION

Cheque Holding Policy Disclosure (Banks) Regulations. Règlement sur la communication de la politique de retenue de chèques (banques) CONSOLIDATION CANADA CONSOLIDATION CODIFICATION Cheque Holding Policy Disclosure (Banks) Regulations Règlement sur la communication de la politique de retenue de chèques (banques) SOR/2002-39 DORS/2002-39 Current to

Plus en détail

Minority Investment (Banks) Regulations. Règlement sur les placements minoritaires (banques) Current to January 25, 2016. À jour au 25 janvier 2016

Minority Investment (Banks) Regulations. Règlement sur les placements minoritaires (banques) Current to January 25, 2016. À jour au 25 janvier 2016 CANADA CONSOLIDATION CODIFICATION Minority Investment (Banks) Regulations Règlement sur les placements minoritaires (banques) SOR/2001-402 DORS/2001-402 À jour au 25 janvier 2016 Published by the Minister

Plus en détail

BILL 9 PROJET DE LOI 9

BILL 9 PROJET DE LOI 9 Bill 9 Government Bill Projet de loi 9 Projet de loi du gouvernement 1 st Session, 40 th Legislature, Manitoba, 61 Elizabeth II, 2012 1 re session, 40 e législature, Manitoba, 61 Elizabeth II, 2012 BILL

Plus en détail

Specialized Financing (Bank Holding Companies) Regulations. Règlement sur les activités de financement spécial (sociétés de portefeuille bancaires)

Specialized Financing (Bank Holding Companies) Regulations. Règlement sur les activités de financement spécial (sociétés de portefeuille bancaires) CANADA CONSOLIDATION CODIFICATION Specialized Financing (Bank Holding Companies) Regulations Règlement sur les activités de financement spécial (sociétés de portefeuille bancaires) SOR/2001-477 DORS/2001-477

Plus en détail

RULE 5 - SERVICE OF DOCUMENTS RÈGLE 5 SIGNIFICATION DE DOCUMENTS. Rule 5 / Règle 5

RULE 5 - SERVICE OF DOCUMENTS RÈGLE 5 SIGNIFICATION DE DOCUMENTS. Rule 5 / Règle 5 RULE 5 - SERVICE OF DOCUMENTS General Rules for Manner of Service Notices of Application and Other Documents 5.01 (1) A notice of application or other document may be served personally, or by an alternative

Plus en détail

Credit Note and Debit Note Information (GST/ HST) Regulations

Credit Note and Debit Note Information (GST/ HST) Regulations CANADA CONSOLIDATION CODIFICATION Credit Note and Debit Note Information (GST/ HST) Regulations Règlement sur les renseignements à inclure dans les notes de crédit et les notes de débit (TPS/ TVH) SOR/91-44

Plus en détail

RÈGLEMENT RELATIF AU CERTIFICAT D'ARRIÉRÉS D'IMPÔTS R.R.T.N.-O. 1990, ch. P-4. CERTIFICATE OF TAX ARREARS REGULATIONS R.R.N.W.T. 1990,c.

RÈGLEMENT RELATIF AU CERTIFICAT D'ARRIÉRÉS D'IMPÔTS R.R.T.N.-O. 1990, ch. P-4. CERTIFICATE OF TAX ARREARS REGULATIONS R.R.N.W.T. 1990,c. PROPERTY ASSESSMENT AND TAXATION ACT CERTIFICATE OF TAX ARREARS REGULATIONS R.R.N.W.T. 1990,c.P-4 LOI SUR L'ÉVALUATION ET L'IMPÔT FONCIERS RÈGLEMENT RELATIF AU CERTIFICAT D'ARRIÉRÉS D'IMPÔTS R.R.T.N.-O.

Plus en détail

Autres termes clés (Other key terms)

Autres termes clés (Other key terms) Autres termes clés (Other key terms) Norme Contrôle qualité des cabinets réalisant des missions d audit ou d examen d états financiers et d autres missions d assurance et de services connexes ( Quality

Plus en détail

Bill 133 Projet de loi 133

Bill 133 Projet de loi 133 2ND SESSION, 39TH LEGISLATURE, ONTARIO 59 ELIZABETH II, 2010 2 e SESSION, 39 e LÉGISLATURE, ONTARIO 59 ELIZABETH II, 2010 Bill 133 Projet de loi 133 An Act to provide transparency and protection for consumers

Plus en détail

C H A P T E R 28 C H A P I T R E 28. (Assented to June 12, 2014) (Date de sanction : 12 juin 2014)

C H A P T E R 28 C H A P I T R E 28. (Assented to June 12, 2014) (Date de sanction : 12 juin 2014) C H A P T E R 28 C H A P I T R E 28 THE CONSUMER PROTECTION AMENDMENT ACT (CONTRACTS FOR DISTANCE COMMUNICATION SERVICES) LOI MODIFIANT LA LOI SUR LA PROTECTION DU CONSOMMATEUR (CONTRATS DE SERVICES DE

Plus en détail

APPENDIX 2. Provisions to be included in the contract between the Provider and the. Holder

APPENDIX 2. Provisions to be included in the contract between the Provider and the. Holder Page 1 APPENDIX 2 Provisions to be included in the contract between the Provider and the Obligations and rights of the Applicant / Holder Holder 1. The Applicant or Licensee acknowledges that it has read

Plus en détail

CORGANISATION EUROPÉENNE POUR LA RECHERCHE NUCLÉAIRE

CORGANISATION EUROPÉENNE POUR LA RECHERCHE NUCLÉAIRE CORGANISATION EUROPÉENNE POUR LA RECHERCHE NUCLÉAIRE EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH L a b o r a t o i r e E u r o p é e n p o u r l a P h y s i q u e d e s P a r t i c u l e s E u r o p e a

Plus en détail

CODIFICATION ADMINISTRATIVE DU RÈGLEMENT RELATIF AU CERTIFICAT D'ARRIÉRÉS D'IMPÔTS R.R.T.N.-O. 1990, ch. P-4

CODIFICATION ADMINISTRATIVE DU RÈGLEMENT RELATIF AU CERTIFICAT D'ARRIÉRÉS D'IMPÔTS R.R.T.N.-O. 1990, ch. P-4 PROPERTY ASSESSMENT AND TAXATION ACT CONSOLIDATION OF CERTIFICATE OF TAX ARREARS REGULATIONS R.R.N.W.T. 1990,c.P-4 LOI SUR L'ÉVALUATION ET L'IMPÔT FONCIERS CODIFICATION ADMINISTRATIVE DU RÈGLEMENT RELATIF

Plus en détail

Bill 195 Projet de loi 195

Bill 195 Projet de loi 195 1ST SESSION, 39TH LEGISLATURE, ONTARIO 58 ELIZABETH II, 2009 1 re SESSION, 39 e LÉGISLATURE, ONTARIO 58 ELIZABETH II, 2009 Bill 195 Projet de loi 195 An Act to amend the Pension Benefits Act and other

Plus en détail

1. Subject 1. Objet. 2. Issue 2. Enjeu. 905-1-IPG-070 October 2014 octobre 2014

1. Subject 1. Objet. 2. Issue 2. Enjeu. 905-1-IPG-070 October 2014 octobre 2014 905-1-IPG-070 October 2014 octobre 2014 (New) Danger as a Normal Condition of Employment 905-1-IPG-070 (Nouveau) Danger constituant une Condition normale de l emploi 905-1-IPG-070 1. Subject 1. Objet Clarification

Plus en détail

Règlement sur les avances comptables pour frais de voyage et de déménagement (Forces canadiennes)

Règlement sur les avances comptables pour frais de voyage et de déménagement (Forces canadiennes) CANADA CONSOLIDATION CODIFICATION Accountable Travel and Moving Advance Regulations (Canadian Forces) Règlement sur les avances comptables pour frais de voyage et de déménagement (Forces canadiennes) C.R.C.,

Plus en détail

Remission Order in Respect of a Transfer of a Sahtu Dene and Metis Settlement Corporation s Assets under a Self-Government Agreement

Remission Order in Respect of a Transfer of a Sahtu Dene and Metis Settlement Corporation s Assets under a Self-Government Agreement CANADA CONSOLIDATION CODIFICATION Remission Order in Respect of a Transfer of a Sahtu Dene and Metis Settlement Corporation s Assets under a Self-Government Agreement Décret de remise relatif à un transfert

Plus en détail

Electronic Documents (Cooperative Credit Associations) Regulations. Règlement sur les documents électroniques (associations coopératives de crédit)

Electronic Documents (Cooperative Credit Associations) Regulations. Règlement sur les documents électroniques (associations coopératives de crédit) CANADA CONSOLIDATION CODIFICATION Electronic Documents (Cooperative Credit Associations) Regulations Règlement sur les documents électroniques (associations coopératives de crédit) SOR/2010-242 DORS/2010-242

Plus en détail

Electronic Documents (Insurance and Insurance Holding Companies) Regulations

Electronic Documents (Insurance and Insurance Holding Companies) Regulations CANADA CONSOLIDATION CODIFICATION Electronic Documents (Insurance and Insurance Holding Companies) Regulations Règlement sur les documents électroniques (sociétés d assurances et sociétés de portefeuille

Plus en détail

PROJET DE LOI C- BILL C- SECRET SECRET HOUSE OF COMMONS OF CANADA CHAMBRE DES COMMUNES DU CANADA

PROJET DE LOI C- BILL C- SECRET SECRET HOUSE OF COMMONS OF CANADA CHAMBRE DES COMMUNES DU CANADA SECRET C- SECRET C- First Session, Forty-first Parliament, Première session, quarante et unième législature, HOUSE OF COMMONS OF CANADA CHAMBRE DES COMMUNES DU CANADA BILL C- PROJET DE LOI C- An Act to

Plus en détail

Support Orders and Support Provisions (Banks and Authorized Foreign Banks) Regulations

Support Orders and Support Provisions (Banks and Authorized Foreign Banks) Regulations CANADA CONSOLIDATION CODIFICATION Support Orders and Support Provisions (Banks and Authorized Foreign Banks) Regulations Règlement sur les ordonnances alimentaires et les dispositions alimentaires (banques

Plus en détail

BILL 10 PROJET DE LOI N O 10 DISPOSITION

BILL 10 PROJET DE LOI N O 10 DISPOSITION SIXTH SESSION, SIXTEENTH LEGISLATIVE ASSEMBLY OF THE NORTHWEST TERRITORIES SIXIÈME SESSION, SEIZIÈME ASSEMBLÉE LÉGISLATIVE DES TERRITOIRES DU NORD-OUEST BILL 10 PROJET DE LOI N O 10 NORTHWEST TERRITORIES

Plus en détail

Minority Investment (Insurance Holding Companies) Regulations. Règlement sur les placements minoritaires (sociétés de portefeuille d assurances)

Minority Investment (Insurance Holding Companies) Regulations. Règlement sur les placements minoritaires (sociétés de portefeuille d assurances) CANADA CONSOLIDATION CODIFICATION Minority Investment (Insurance Holding Companies) Regulations Règlement sur les placements minoritaires (sociétés de portefeuille d assurances) SOR/2001-405 DORS/2001-405

Plus en détail

Bill 157 Projet de loi 157

Bill 157 Projet de loi 157 2ND SESSION, 39TH LEGISLATURE, ONTARIO 60 ELIZABETH II, 2011 2 e SESSION, 39 e LÉGISLATURE, ONTARIO 60 ELIZABETH II, 2011 Bill 157 Projet de loi 157 An Act to amend the Pesticides Act Loi modifiant la

Plus en détail

AINoE. Rapport sur l audition d AINoE Paris, 18 juin 2003

AINoE. Rapport sur l audition d AINoE Paris, 18 juin 2003 AINoE Abstract Interpretation Network of Excellence Patrick COUSOT (ENS, Coordinator) Rapport sur l audition d AINoE Paris, 18 juin 2003 Thématique Rapport sur l audition d AINoE Paris, 18 juin 2003 1

Plus en détail

APPENDIX 6 BONUS RING FORMAT

APPENDIX 6 BONUS RING FORMAT #4 EN FRANÇAIS CI-DESSOUS Preamble and Justification This motion is being presented to the membership as an alternative format for clubs to use to encourage increased entries, both in areas where the exhibitor

Plus en détail

BILL C-682 PROJET DE LOI C-682 C-682 C-682 HOUSE OF COMMONS OF CANADA CHAMBRE DES COMMUNES DU CANADA

BILL C-682 PROJET DE LOI C-682 C-682 C-682 HOUSE OF COMMONS OF CANADA CHAMBRE DES COMMUNES DU CANADA C-682 C-682 Second Session, Forty-first Parliament, 62-63-64 Elizabeth II, 2013-2014-201 Deuxième session, quarante et unième législature, 62-63-64 Elizabeth II, 2013-2014-201 HOUSE OF COMMONS OF CANADA

Plus en détail

Interest Rate for Customs Purposes Regulations. Règlement sur le taux d intérêt aux fins des douanes CONSOLIDATION CODIFICATION

Interest Rate for Customs Purposes Regulations. Règlement sur le taux d intérêt aux fins des douanes CONSOLIDATION CODIFICATION CANADA CONSOLIDATION CODIFICATION Interest Rate for Customs Purposes Regulations Règlement sur le taux d intérêt aux fins des douanes SOR/86-1121 DORS/86-1121 Current to August 4, 2015 À jour au 4 août

Plus en détail

BILL S-215 PROJET DE LOI S-215 S-215 S-215 SENATE OF CANADA SÉNAT DU CANADA

BILL S-215 PROJET DE LOI S-215 S-215 S-215 SENATE OF CANADA SÉNAT DU CANADA S-215 S-215 First Session, Forty-first Parliament, 60-61 Elizabeth II, 2011-2012 Première session, quarante et unième législature, 60-61 Elizabeth II, 2011-2012 SENATE OF CANADA SÉNAT DU CANADA BILL S-215

Plus en détail

Règlement sur les prestations de retraite supplémentaires. Supplementary Retirement Benefits Regulations

Règlement sur les prestations de retraite supplémentaires. Supplementary Retirement Benefits Regulations CANADA CONSOLIDATION CODIFICATION Supplementary Retirement Benefits Regulations Règlement sur les prestations de retraite supplémentaires C.R.C., c. 1511 C.R.C., ch. 1511 Current to December 10, 2015 À

Plus en détail

RESULTING FROM THE ANTI-SEMITIC LEGISLATION IN FORCE DURING THE OCCUPATION. (Decree 99-778 of September 10, 1999) QUESTIONNAIRE. Family Name...

RESULTING FROM THE ANTI-SEMITIC LEGISLATION IN FORCE DURING THE OCCUPATION. (Decree 99-778 of September 10, 1999) QUESTIONNAIRE. Family Name... COMMISSION FOR THE COMPENSATION OF VICTIMS OF SPOLIATION RESULTING FROM THE ANTI-SEMITIC LEGISLATION IN FORCE DURING THE OCCUPATION (Decree 99-778 of September 10, 1999) Case Number : (to remind in all

Plus en détail

General Export Permit No. Ex. 18 Portable Personal Computers and Associated Software

General Export Permit No. Ex. 18 Portable Personal Computers and Associated Software CANADA CONSOLIDATION CODIFICATION General Export Permit No. Ex. 18 Portable Personal Computers and Associated Software Licence générale d exportation n o Ex. 18 Ordinateurs personnels portatifs et logiciels

Plus en détail

AUX AGENTS IMMOBILIERS QUALIFICATIONS OF AGENTS AND SALESPERSONS REGULATIONS

AUX AGENTS IMMOBILIERS QUALIFICATIONS OF AGENTS AND SALESPERSONS REGULATIONS REAL ESTATE AGENTS LICENSING ACT QUALIFICATIONS OF AGENTS AND SALESPERSONS REGULATIONS R.R.N.W.T. 1990,c.15(Supp.) In force September 15, 1992; SI-013-92 LOI SUR LA DÉLIVRANCE DE LICENCES AUX AGENTS IMMOBILIERS

Plus en détail

Décret de remise pour l eau-de-vie détruite. Spirit Destruction Remission Order CODIFICATION CONSOLIDATION. C.R.C., c. 793 C.R.C., ch.

Décret de remise pour l eau-de-vie détruite. Spirit Destruction Remission Order CODIFICATION CONSOLIDATION. C.R.C., c. 793 C.R.C., ch. CANADA CONSOLIDATION CODIFICATION Spirit Destruction Remission Order Décret de remise pour l eau-de-vie détruite C.R.C., c. 793 C.R.C., ch. 793 Current to October 27, 2015 À jour au 27 octobre 2015 Published

Plus en détail

Safety Management Regulations. Règlement sur la gestion pour la sécurité de l'exploitation des bâtiments CODIFICATION CONSOLIDATION

Safety Management Regulations. Règlement sur la gestion pour la sécurité de l'exploitation des bâtiments CODIFICATION CONSOLIDATION CANADA CONSOLIDATION CODIFICATION Safety Management Regulations Règlement sur la gestion pour la sécurité de l'exploitation des bâtiments SOR/98-348 DORS/98-348 Current to May 11, 2015 À jour au 11 mai

Plus en détail

2007 CHAPTER 21 2007 CHAPITRE 21

2007 CHAPTER 21 2007 CHAPITRE 21 1 RECOURS COLLECTIFS 2007 ch. 21 2007 CHAPTER 21 An Act to amend The Class Actions Act 2007 CHAPITRE 21 Loi modifiant la Loi sur les recours collectifs 1 2 CLASS ACTIONS c. 21 2007 2007 CHAPTER 21 An Act

Plus en détail

Minority Investment (Trust and Loan Companies) Regulations. Règlement sur les placements minoritaires (sociétés de fiducie et de prêt) CODIFICATION

Minority Investment (Trust and Loan Companies) Regulations. Règlement sur les placements minoritaires (sociétés de fiducie et de prêt) CODIFICATION CANADA CONSOLIDATION CODIFICATION Minority Investment (Trust and Loan Companies) Regulations Règlement sur les placements minoritaires (sociétés de fiducie et de prêt) SOR/2001-406 DORS/2001-406 Current

Plus en détail

Calculation of Interest Regulations. Règlement sur le calcul des intérêts CONSOLIDATION CODIFICATION. Current to August 4, 2015 À jour au 4 août 2015

Calculation of Interest Regulations. Règlement sur le calcul des intérêts CONSOLIDATION CODIFICATION. Current to August 4, 2015 À jour au 4 août 2015 CANADA CONSOLIDATION CODIFICATION Calculation of Interest Regulations Règlement sur le calcul des intérêts SOR/87-631 DORS/87-631 Current to August 4, 2015 À jour au 4 août 2015 Published by the Minister

Plus en détail

Compliance Sheet. Super Range 71. Product Description

Compliance Sheet. Super Range 71. Product Description Super Range 71 Model SR71-15 SR71-A SR71-C SR71-E SR71-X SR71-USB Product Description 802.11a/n, Mini PCI, 2x2 MIMO 802.11a/b/g/n, Mini PCI, 3x3 MIMO 802.11a/b/g/n, CardBus, 2x2 MIMO 802.11a/b/g/n, PCI

Plus en détail

CHAPTER 51 CHAPITRE 51. (a) by adding after subsection (3) the following: a) par l adjonction de ce qui suit après le paragraphe

CHAPTER 51 CHAPITRE 51. (a) by adding after subsection (3) the following: a) par l adjonction de ce qui suit après le paragraphe 2009 CHAPTER 51 CHAPITRE 51 An Act Respecting Small Claims Loi concernant le recouvrement des petites créances Assented to December 18, 2009 Sanctionnée le 18 décembre 2009 Her Majesty, by and with the

Plus en détail

Bill 70 Projet de loi 70

Bill 70 Projet de loi 70 1ST SESSION, 41ST LEGISLATURE, ONTARIO 64 ELIZABETH II, 2015 1 re SESSION, 41 e LÉGISLATURE, ONTARIO 64 ELIZABETH II, 2015 Bill 70 Projet de loi 70 An Act respecting protection for registered retirement

Plus en détail

Subsidiaries Holding Association Shares (Cooperative Credit Associations) Regulations

Subsidiaries Holding Association Shares (Cooperative Credit Associations) Regulations CANADA CONSOLIDATION CODIFICATION Subsidiaries Holding Association Shares (Cooperative Credit Associations) Regulations Règlement sur la détention des actions de l association par ses filiales (associations

Plus en détail

Financial Consumer Agency of Canada Assessment of Financial Institutions Regulations

Financial Consumer Agency of Canada Assessment of Financial Institutions Regulations CANADA CONSOLIDATION CODIFICATION Financial Consumer Agency of Canada Assessment of Financial Institutions Regulations Règlement sur les cotisations des institutions financières (Agence de la consommation

Plus en détail

Règlement sur les licences relatives aux légumes de l Île-du- Prince-Édouard (marché interprovincial et commerce d exportation)

Règlement sur les licences relatives aux légumes de l Île-du- Prince-Édouard (marché interprovincial et commerce d exportation) CANADA CONSOLIDATION CODIFICATION P.E.I. Vegetable Licensing (Interprovincial and Export) Regulations Règlement sur les licences relatives aux légumes de l Île-du- Prince-Édouard (marché interprovincial

Plus en détail

Canadian Films and Video Tapes Certification Fees Order. Décret sur les droits d émission de visas de films et bandes magnétoscopiques canadiens

Canadian Films and Video Tapes Certification Fees Order. Décret sur les droits d émission de visas de films et bandes magnétoscopiques canadiens CANADA CONSOLIDATION CODIFICATION Canadian Films and Video Tapes Certification Fees Order Décret sur les droits d émission de visas de films et bandes magnétoscopiques canadiens SOR/82-550 DORS/82-550

Plus en détail

Disclosure on Account Opening by Telephone Request (Banks) Regulations

Disclosure on Account Opening by Telephone Request (Banks) Regulations CANADA CONSOLIDATION CODIFICATION Disclosure on Account Opening by Telephone Request (Banks) Regulations Règlement sur la communication en cas de demande téléphonique d ouverture de compte (banques) SOR/2001-472

Plus en détail

Regulatory Capital (Insurance Companies) Regulations. Règlement sur le capital réglementaire (sociétés d assurances) CONSOLIDATION CODIFICATION

Regulatory Capital (Insurance Companies) Regulations. Règlement sur le capital réglementaire (sociétés d assurances) CONSOLIDATION CODIFICATION CANADA CONSOLIDATION CODIFICATION Regulatory Capital (Insurance Companies) Regulations Règlement sur le capital réglementaire (sociétés d assurances) SOR/92-529 DORS/92-529 Current to September 30, 2015

Plus en détail

Bill 12 Projet de loi 12

Bill 12 Projet de loi 12 1ST SESSION, 41ST LEGISLATURE, ONTARIO 63 ELIZABETH II, 2014 1 re SESSION, 41 e LÉGISLATURE, ONTARIO 63 ELIZABETH II, 2014 Bill 12 Projet de loi 12 An Act to amend the Employment Standards Act, 2000 with

Plus en détail

AMENDMENT TO BILL 32 AMENDEMENT AU PROJET DE LOI 32

AMENDMENT TO BILL 32 AMENDEMENT AU PROJET DE LOI 32 THAT the proposed clause 6(1), as set out in Clause 6(1) of the Bill, be replaced with the following: Trustee to respond promptly 6(1) A trustee shall respond to a request as promptly as required in the

Plus en détail

Air Transportation Tax Order, 1995. Décret de 1995 sur la taxe de transport aérien CONSOLIDATION CODIFICATION

Air Transportation Tax Order, 1995. Décret de 1995 sur la taxe de transport aérien CONSOLIDATION CODIFICATION CANADA CONSOLIDATION CODIFICATION Air Transportation Tax Order, 1995 Décret de 1995 sur la taxe de transport aérien SOR/95-206 DORS/95-206 Current to August 30, 2015 À jour au 30 août 2015 Published by

Plus en détail

Natixis Asset Management Response to the European Commission Green Paper on shadow banking

Natixis Asset Management Response to the European Commission Green Paper on shadow banking European Commission DG MARKT Unit 02 Rue de Spa, 2 1049 Brussels Belgium markt-consultation-shadow-banking@ec.europa.eu 14 th June 2012 Natixis Asset Management Response to the European Commission Green

Plus en détail

Autres termes clés (Other key terms)

Autres termes clés (Other key terms) Carve-out method Autres termes clés (Other key terms) Norme Rapports d assurance sur les contrôles d une société de services extérieurs (, Assurance Reports on Controls at a Third Party Service Organization)

Plus en détail

Règlement relatif à l examen fait conformément à la Déclaration canadienne des droits. Canadian Bill of Rights Examination Regulations CODIFICATION

Règlement relatif à l examen fait conformément à la Déclaration canadienne des droits. Canadian Bill of Rights Examination Regulations CODIFICATION CANADA CONSOLIDATION CODIFICATION Canadian Bill of Rights Examination Regulations Règlement relatif à l examen fait conformément à la Déclaration canadienne des droits C.R.C., c. 394 C.R.C., ch. 394 Current

Plus en détail

Appendix C CRITERIA FOR A PROFESSIONAL GROWTH PLAN SUPERVISION OF PROFESSIONAL STAFF: TEACHER EVALUATION GCNA

Appendix C CRITERIA FOR A PROFESSIONAL GROWTH PLAN SUPERVISION OF PROFESSIONAL STAFF: TEACHER EVALUATION GCNA SUPERVISION OF PROFESSIONAL STAFF: TEACHER EVALUATION Appendix C CRITERIA FOR A PROFESSIONAL GROWTH PLAN A Professional Growth Plan is a written statement describing a teacher s intended focus for professional

Plus en détail

Bill 150 Projet de loi 150

Bill 150 Projet de loi 150 2ND SESSION, 40TH LEGISLATURE, ONTARIO 62 ELIZABETH II, 2013 2 e SESSION, 40 e LÉGISLATURE, ONTARIO 62 ELIZABETH II, 2013 Bill 150 Projet de loi 150 An Act to amend various statutes with respect to liquor

Plus en détail

Le nouveau référentiel Européen Eric Froment,

Le nouveau référentiel Européen Eric Froment, Le nouveau référentiel Européen Eric Froment, Président du Comité du Registre Européen des Agences d évaluation de l enseignement supérieur -EQAR Workshop on the development of the IEAQA Tunis, 13 June

Plus en détail

New Brunswick Translated Documents Regulations. Règlement du Nouveau- Brunswick sur les documents traduits CONSOLIDATION CODIFICATION

New Brunswick Translated Documents Regulations. Règlement du Nouveau- Brunswick sur les documents traduits CONSOLIDATION CODIFICATION CANADA CONSOLIDATION CODIFICATION New Brunswick Translated Documents Regulations Règlement du Nouveau- Brunswick sur les documents traduits SOR/93-9 DORS/93-9 Current to October 27, 2015 À jour au 27 octobre

Plus en détail

Loi sur le Bureau de la traduction. Translation Bureau Act CODIFICATION CONSOLIDATION. R.S.C., 1985, c. T-16 L.R.C. (1985), ch.

Loi sur le Bureau de la traduction. Translation Bureau Act CODIFICATION CONSOLIDATION. R.S.C., 1985, c. T-16 L.R.C. (1985), ch. CANADA CONSOLIDATION CODIFICATION Translation Bureau Act Loi sur le Bureau de la traduction R.S.C., 1985, c. T-16 L.R.C. (1985), ch. T-16 Current to September 30, 2015 À jour au 30 septembre 2015 Published

Plus en détail

General Import Permit No. 106 Apparel Goods or Other Textile Articles. Licence générale d importation n o 106 vêtements ou autres articles textiles

General Import Permit No. 106 Apparel Goods or Other Textile Articles. Licence générale d importation n o 106 vêtements ou autres articles textiles CANADA CONSOLIDATION CODIFICATION General Import Permit No. 106 Apparel Goods or Other Textile Articles Licence générale d importation n o 106 vêtements ou autres articles textiles SOR/97-170 DORS/97-170

Plus en détail

Les licences Creative Commons expliquées aux élèves

Les licences Creative Commons expliquées aux élèves Les licences Creative Commons expliquées aux élèves Source du document : http://framablog.org/index.php/post/2008/03/11/education-b2i-creative-commons Diapo 1 Creative Commons presents : Sharing Creative

Plus en détail

Loi sur l aide financière à la Banque Commerciale du Canada. Canadian Commercial Bank Financial Assistance Act CODIFICATION CONSOLIDATION

Loi sur l aide financière à la Banque Commerciale du Canada. Canadian Commercial Bank Financial Assistance Act CODIFICATION CONSOLIDATION CANADA CONSOLIDATION CODIFICATION Canadian Commercial Bank Financial Assistance Act Loi sur l aide financière à la Banque Commerciale du Canada S.C. 1985, c. 9 S.C. 1985, ch. 9 Current to September 10,

Plus en détail

Import Allocation Regulations. Règlement sur les autorisations d importation CONSOLIDATION CODIFICATION

Import Allocation Regulations. Règlement sur les autorisations d importation CONSOLIDATION CODIFICATION CANADA CONSOLIDATION CODIFICATION Import Allocation Regulations Règlement sur les autorisations d importation SOR/95-36 DORS/95-36 Current to May 17, 2011 À jour au 1 er 17 mai 2011 Published by the Minister

Plus en détail

Postal Imports Remission Order. Décret de remise visant les importations par la poste CONSOLIDATION CODIFICATION

Postal Imports Remission Order. Décret de remise visant les importations par la poste CONSOLIDATION CODIFICATION CANADA CONSOLIDATION CODIFICATION Postal Imports Remission Order Décret de remise visant les importations par la poste SI/85-181 TR/85-181 Current to September 27, 2015 À jour au 27 septembre 2015 Published

Plus en détail

Regulatory Capital (Cooperative Credit Associations) Regulations. Règlement sur le capital réglementaire (associations coopératives de crédit)

Regulatory Capital (Cooperative Credit Associations) Regulations. Règlement sur le capital réglementaire (associations coopératives de crédit) CANADA CONSOLIDATION CODIFICATION Regulatory Capital (Cooperative Credit Associations) Regulations Règlement sur le capital réglementaire (associations coopératives de crédit) SOR/92-528 DORS/92-528 Current

Plus en détail

Prescribed Deposits (Authorized Foreign Banks) Regulations. Règlement sur les dépôts (banques étrangères autorisées)

Prescribed Deposits (Authorized Foreign Banks) Regulations. Règlement sur les dépôts (banques étrangères autorisées) CANADA CONSOLIDATION CODIFICATION Prescribed Deposits (Authorized Foreign Banks) Regulations Règlement sur les dépôts (banques étrangères autorisées) SOR/2000-53 DORS/2000-53 Current to January 25, 2016

Plus en détail

Disclosure on Account Opening by Telephone Request (Trust and Loan Companies) Regulations

Disclosure on Account Opening by Telephone Request (Trust and Loan Companies) Regulations CANADA CONSOLIDATION CODIFICATION Disclosure on Account Opening by Telephone Request (Trust and Loan Companies) Regulations Règlement sur la communication en cas de demande téléphonique d ouverture de

Plus en détail

Exemption from Approval for Certain Investments in Intragroup Service Entities (Trust and Loan Companies) Regulations

Exemption from Approval for Certain Investments in Intragroup Service Entities (Trust and Loan Companies) Regulations CANADA CONSOLIDATION CODIFICATION Exemption from Approval for Certain Investments in Intragroup Service Entities (Trust and Loan Companies) Regulations Règlement sur la dispense d agrément pour certains

Plus en détail

S-9.05 Small Business Investor Tax Credit Act 2003-39 RÈGLEMENT DU NOUVEAU-BRUNSWICK 2003-39 NEW BRUNSWICK REGULATION 2003-39. établi en vertu de la

S-9.05 Small Business Investor Tax Credit Act 2003-39 RÈGLEMENT DU NOUVEAU-BRUNSWICK 2003-39 NEW BRUNSWICK REGULATION 2003-39. établi en vertu de la NEW BRUNSWICK REGULATION 2003-39 under the SMALL BUSINESS INVESTOR TAX CREDIT ACT (O.C. 2003-220) Regulation Outline Filed July 29, 2003 Citation........................................... 1 Definition

Plus en détail

Règlement sur le télémarketing et les centres d'appel. Call Centres Telemarketing Sales Regulation

Règlement sur le télémarketing et les centres d'appel. Call Centres Telemarketing Sales Regulation THE CONSUMER PROTECTION ACT (C.C.S.M. c. C200) Call Centres Telemarketing Sales Regulation LOI SUR LA PROTECTION DU CONSOMMATEUR (c. C200 de la C.P.L.M.) Règlement sur le télémarketing et les centres d'appel

Plus en détail

PHARMACY REGULATIONS R-018-2007 In force April 2, 2007. RÈGLEMENT SUR LA PHARMACIE R-018-2007 En vigueur le 2 avril 2007 INCLUDING AMENDMENTS MADE BY

PHARMACY REGULATIONS R-018-2007 In force April 2, 2007. RÈGLEMENT SUR LA PHARMACIE R-018-2007 En vigueur le 2 avril 2007 INCLUDING AMENDMENTS MADE BY PHARMACY ACT LOI SUR LA PHARMACIE PHARMACY REGULATIONS R-018-2007 In force April 2, 2007 RÈGLEMENT SUR LA PHARMACIE R-018-2007 En vigueur le 2 avril 2007 INCLUDING AMENDMENTS MADE BY MODIFIÉ PAR This consolidation

Plus en détail

BILL 233 PROJET DE LOI 233

BILL 233 PROJET DE LOI 233 Bill 233 Private Member's Bill Projet de loi 233 Projet de loi d'un député 3 rd Session, 39 th Legislature, Manitoba, 58 Elizabeth II, 2009 3 e session, 39 e législature, Manitoba, 58 Elizabeth II, 2009

Plus en détail

Borrowing (Property and Casualty Companies and Marine Companies) Regulations

Borrowing (Property and Casualty Companies and Marine Companies) Regulations CANADA CONSOLIDATION CODIFICATION Borrowing (Property and Casualty Companies and Marine Companies) Regulations Règlement sur les emprunts des sociétés d assurances multirisques et des sociétés SOR/92-281

Plus en détail

EN/FR. Europaudvalget 2013 Rådsmøde 3229 - transport, tele og energi Bilag 3 Offentligt COUNCIL OF THE EUROPEAN UNION. Brussels, 11 March 2013 7342/13

EN/FR. Europaudvalget 2013 Rådsmøde 3229 - transport, tele og energi Bilag 3 Offentligt COUNCIL OF THE EUROPEAN UNION. Brussels, 11 March 2013 7342/13 Europaudvalget 2013 Rådsmøde 3229 - transport, tele og energi Bilag 3 Offentligt COUNCIL OF THE EUROPEAN UNION Brussels, 11 March 2013 7342/13 TRANS 106 INFORMATION NOTE from: General Secretariat to: Council

Plus en détail

Public and European Business Law - Droit public et européen des affaires. Master I Law Level

Public and European Business Law - Droit public et européen des affaires. Master I Law Level Public and European Business Law - Droit public et européen des affaires Stéphane de La Rosa Master I Law Level Delivered Lectures Jean Monnet Chair «Droit de l Union Européenne et Mutations de l intégration

Plus en détail

LOI SUR LA GESTION DES FINANCES PUBLIQUES FINANCIAL ADMINISTRATION ACT DÉCRET 1984/208 O.I.C. 1984/208 FINANCIAL ADMINISTRATION ACT

LOI SUR LA GESTION DES FINANCES PUBLIQUES FINANCIAL ADMINISTRATION ACT DÉCRET 1984/208 O.I.C. 1984/208 FINANCIAL ADMINISTRATION ACT Pursuant to subsection 42(1) of the Financial Administration Act, the Commissioner in Executive Council is pleased to and doth hereby order as follows: 1. The annexed Public Property Regulations are made

Plus en détail

Corporate Interrelationships (Insurance Companies and Insurance Holding Companies) Regulations

Corporate Interrelationships (Insurance Companies and Insurance Holding Companies) Regulations CANADA CONSOLIDATION CODIFICATION Corporate Interrelationships (Insurance Companies and Insurance Holding Companies) Regulations Règlement sur les relations intersociétés (sociétés d assurances et sociétés

Plus en détail

MAINTENANCE PAYMENTS REMISSION ORDER R.R.N.W.T. 1990,c.F-8

MAINTENANCE PAYMENTS REMISSION ORDER R.R.N.W.T. 1990,c.F-8 FINANCIAL ADMINISTRATION ACT MAINTENANCE PAYMENTS REMISSION ORDER R.R.N.W.T. 1990,c.F-8 LOI SUR LA GESTION DES FINANCES PUBLIQUES DÉCRET SUR LA REMISE RELATIVE AU VERSEMENT DE PENSIONS ALIMENTAIRES R.R.T.N.-O.

Plus en détail

Home-Trade, Inland and Minor Waters Voyages Regulations. Règlement sur les voyages de cabotage, en eaux intérieures et en eaux secondaires

Home-Trade, Inland and Minor Waters Voyages Regulations. Règlement sur les voyages de cabotage, en eaux intérieures et en eaux secondaires CANADA CONSOLIDATION CODIFICATION Home-Trade, Inland and Minor Waters Voyages Regulations Règlement sur les voyages de cabotage, en eaux intérieures et en eaux secondaires C.R.C., c. 1430 C.R.C., ch. 1430

Plus en détail

Transmanche Accountancy Services Jeremy & Stephanie Godwin Comptabilité, Conseil et Communication. Contrat et Conditions Générales.

Transmanche Accountancy Services Jeremy & Stephanie Godwin Comptabilité, Conseil et Communication. Contrat et Conditions Générales. Transmanche Accountancy Services Jeremy & Stephanie Godwin Comptabilité, Conseil et Communication 131 avenue St Georges 44500 La Baule Escoublac Siret n 44242459400020 Siret n Conseil:- 53458533600025

Plus en détail

Offre contractuelle de rachat sur emprunt obligataire GDF SUEZ

Offre contractuelle de rachat sur emprunt obligataire GDF SUEZ CORPORATE EVENT NOTICE: Offre contractuelle de rachat sur emprunt obligataire GDF SUEZ PLACE: Paris AVIS N : PAR_20150603_04282_EUR DATE: 03/06/2015 MARCHE: EURONEXT PARIS GDF SUEZ (l' Initiateur de l'offre)

Plus en détail

Bill 201 Projet de loi 201

Bill 201 Projet de loi 201 1ST SESSION, 39TH LEGISLATURE, ONTARIO 58 ELIZABETH II, 2009 1 re SESSION, 39 e LÉGISLATURE, ONTARIO 58 ELIZABETH II, 2009 Bill 201 Projet de loi 201 (Chapter 20 Statutes of Ontario, 2009) (Chapitre 20

Plus en détail

Marketing Authorization for Gluten-free Oats and Foods Containing Glutenfree

Marketing Authorization for Gluten-free Oats and Foods Containing Glutenfree CANADA CONSOLIDATION CODIFICATION Marketing Authorization for Gluten-free Oats and Foods Containing Glutenfree Oats Autorisation de mise en marché d avoine sans gluten et d aliments contenant de l avoine

Plus en détail

FILES: 76(1)-2000-2, 76(1)-2003-1 DOSSIERS : 76(1)-2000-2, 76(1)-2003-1. Copyright Act, subsection 76(1) Loi sur le droit d'auteur, paragraphe 76(1)

FILES: 76(1)-2000-2, 76(1)-2003-1 DOSSIERS : 76(1)-2000-2, 76(1)-2003-1. Copyright Act, subsection 76(1) Loi sur le droit d'auteur, paragraphe 76(1) Copyright Board Commission du droit d auteur Canada Canada FILES: 76(1)-2000-2, 76(1)-2003-1 DOSSIERS : 76(1)-2000-2, 76(1)-2003-1 Copyright Act, subsection 76(1) Loi sur le droit d'auteur, paragraphe

Plus en détail

LOI SUR LE FONDS DU PATRIMOINE DES TERRITOIRES DU NORD-OUEST NORTHWEST TERRITORIES HERITAGE FUND ACT

LOI SUR LE FONDS DU PATRIMOINE DES TERRITOIRES DU NORD-OUEST NORTHWEST TERRITORIES HERITAGE FUND ACT NORTHWEST TERRITORIES HERITAGE FUND ACT NORTHWEST TERRITORIES HERITAGE FUND REGULATIONS R-008-2013 AMENDED BY LOI SUR LE FONDS DU PATRIMOINE DES TERRITOIRES DU NORD-OUEST RÈGLEMENT SUR LE FONDS DU PATRIMOINE

Plus en détail

2 players Ages 8+ Note: Please keep these instructions for future reference. WARNING. CHOKING HAZARD. Small parts. Not for children under 3 years.

2 players Ages 8+ Note: Please keep these instructions for future reference. WARNING. CHOKING HAZARD. Small parts. Not for children under 3 years. Linja Game Rules 2 players Ages 8+ Published under license from FoxMind Games NV, by: FoxMind Games BV Stadhouderskade 125hs Amsterdam, The Netherlands Distribution in North America: FoxMind USA 2710 Thomes

Plus en détail

Export Permit (Steel Monitoring) Regulations. Règlement sur les licences d exportation (surveillance de l acier) CONSOLIDATION CODIFICATION

Export Permit (Steel Monitoring) Regulations. Règlement sur les licences d exportation (surveillance de l acier) CONSOLIDATION CODIFICATION CANADA CONSOLIDATION CODIFICATION Export Permit (Steel Monitoring) Regulations Règlement sur les licences d exportation (surveillance de l acier) SOR/87-321 DORS/87-321 Current to August 4, 2015 À jour

Plus en détail

Public Inquiry (Authorized Foreign Banks) Rules. Règles sur les enquêtes publiques (banques étrangères autorisées) CONSOLIDATION CODIFICATION

Public Inquiry (Authorized Foreign Banks) Rules. Règles sur les enquêtes publiques (banques étrangères autorisées) CONSOLIDATION CODIFICATION CANADA CONSOLIDATION CODIFICATION Public Inquiry (Authorized Foreign Banks) Rules Règles sur les enquêtes publiques (banques étrangères autorisées) SOR/99-276 DORS/99-276 Current to October 15, 2015 À

Plus en détail

Ontario Flue-Cured Tobacco Licence Charges (Interprovincial and Export) Order

Ontario Flue-Cured Tobacco Licence Charges (Interprovincial and Export) Order CANADA CONSOLIDATION CODIFICATION Ontario Flue-Cured Tobacco Licence Charges (Interprovincial and Export) Order Ordonnance sur les droits de permis à payer sur le tabac jaune de l Ontario (marché interprovincial

Plus en détail

Appendix 1 Wording of Noumea Accord and 1999 Organic Law on Restricted Electorates

Appendix 1 Wording of Noumea Accord and 1999 Organic Law on Restricted Electorates Appendix 1 Wording of Noumea Accord and 1999 Organic Law on Restricted Electorates Relating to local (provincial and Congress) elections Article 2.2.1 of the Noumea Accord: le corps électoral aux assemblées

Plus en détail

INVESTMENT REGULATIONS R-090-2001 In force October 1, 2001. RÈGLEMENT SUR LES INVESTISSEMENTS R-090-2001 En vigueur le 1 er octobre 2001

INVESTMENT REGULATIONS R-090-2001 In force October 1, 2001. RÈGLEMENT SUR LES INVESTISSEMENTS R-090-2001 En vigueur le 1 er octobre 2001 FINANCIAL ADMINISTRATION ACT INVESTMENT REGULATIONS R-090-2001 In force October 1, 2001 LOI SUR LA GESTION DES FINANCES PUBLIQUES RÈGLEMENT SUR LES INVESTISSEMENTS R-090-2001 En vigueur le 1 er octobre

Plus en détail

PUBLIQUES. FINANCIAL AGREEMENTS AND TRANSACTIONS (PETROLEUM PRODUCT DERIVATIVES) REGULATIONS R-45-2008 In force August 1, 2008

PUBLIQUES. FINANCIAL AGREEMENTS AND TRANSACTIONS (PETROLEUM PRODUCT DERIVATIVES) REGULATIONS R-45-2008 In force August 1, 2008 FINANCIAL ADMINISTRATION ACT LOI SUR LA GESTION DES FINANCES PUBLIQUES FINANCIAL AGREEMENTS AND TRANSACTIONS (PETROLEUM PRODUCT DERIVATIVES) REGULATIONS R-45-2008 In force August 1, 2008 RÈGLEMENT SUR

Plus en détail

ARCHIVES REGULATIONS R-026-2008 In force May 1, 2008. RÈGLEMENT SUR LES ARCHIVES R-026-2008 En vigueur le 1 er mai 2008 INCLUDING AMENDMENTS MADE BY

ARCHIVES REGULATIONS R-026-2008 In force May 1, 2008. RÈGLEMENT SUR LES ARCHIVES R-026-2008 En vigueur le 1 er mai 2008 INCLUDING AMENDMENTS MADE BY ARCHIVES ACT LOI SUR LES ARCHIVES ARCHIVES REGULATIONS R-026-2008 In force May 1, 2008 RÈGLEMENT SUR LES ARCHIVES R-026-2008 En vigueur le 1 er mai 2008 INCLUDING AMENDMENTS MADE BY MODIFIÉ PAR This consolidation

Plus en détail

Pardon Services Fees Order. Arrêté sur le prix à payer pour des services en vue d une réhabilitation CODIFICATION CONSOLIDATION

Pardon Services Fees Order. Arrêté sur le prix à payer pour des services en vue d une réhabilitation CODIFICATION CONSOLIDATION CANADA CONSOLIDATION CODIFICATION Pardon Services Fees Order Arrêté sur le prix à payer pour des services en vue d une réhabilitation SOR/95-210 DORS/95-210 Current to November 24, 2015 À jour au 24 novembre

Plus en détail

Section B: Receiving and Reviewing the Technician Inspection Report & Claims Decision Process

Section B: Receiving and Reviewing the Technician Inspection Report & Claims Decision Process Phoenix A.M.D. International Inc. - Claim Procedures, Timelines & Expectations Timelines & Expectations 1. All telephone messages and e-mail correspondence is to be handled and responded back to you within

Plus en détail

MATERIAL COMMON TO ALL ADOPTION CASES

MATERIAL COMMON TO ALL ADOPTION CASES ONTARIO Court File Number at (Name of court) Court office address Form 34K: Certificate of Clerk (Adoption) Applicant(s) (The first letter of the applicant s surname may be used) Full legal name & address

Plus en détail

Public and European Business Law - Droit public et européen des affaires. Master I Law Level

Public and European Business Law - Droit public et européen des affaires. Master I Law Level Public and European Business Law - Droit public et européen des affaires Stéphane de La Rosa Master I Law Level Delivered Lectures Jean Monnet Chair «Droit de l Union Européenne et Mutations de l intégration

Plus en détail