Programmes de comparaison de banques de données

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "Programmes de comparaison de banques de données"

Transcription

1 Programmes decomparaison debanquesdedonnées FASTA

2 introduction Programmesdecomparaisonde2séquencestroplongs Méthodesheuristiques But:filtrerparétapessuccessiveslesséquences «intéressantes» Etablissementd'unscorepourclasserlesmeilleuressimilitudes locales. Les2plusutilisés:FASTAetBLAST.

3 FASTA FASTA(pronouncedFAST Aye)standsforFAST All,reflectingthefactthat itcanbeusedforafastproteincomparisonorafastnucleotidecomparison W.R.PearsonandD.J.Lipman(1988),"ImprovedToolsforBiological SequenceAnalysis",Proc.Natl.Acad.Sci.USA.85: , W.R.Pearson(1990)"RapidandSensitiveSequenceComparisonwith FASTPandFASTA"MethodsinEnzymology183:63 98

4 1èreétape k tuple protéine:k=2 ac.nucléique:k=4à 6

5 2èmeétape PAM250 init1 Scoreinitialinitn

6 3èmeétape

7 4èmeétape Scoreoptimalopt banded'insertion délétion

8 Résumédesétapesdecalcul Recherchedesrégionsàforteidentité(park tuple). Recalculeàl'aided'unematriceàscorespourles10 meilleuresrégionstrouvéesprécédemment(lesscores init1=régionsinitialesde1erordre) Joindrelesrégions.(obtentiond'unscoreinitn) Alignementoptimaldes2séquencesuniquementdans unerégiondélimitéeparlameilleurerégioninitialeinitn. Estréaliséavecunnombrelimitédeséquencesfixépar l'utilisateur.onobtientunscoreopt.

9 Avantages bonnesensibilitécarprendencomptelesinsertions délétions. minimisationdesexplorationsentrelesdeuxséquences étapedeprogrammationdynamique,enciblantdeplus,les régionsoùl'ondoiteffectuerlarecherched'alignement. étaped'alignementoptimalestréaliséeuniquementsurla meilleurerégiondehautesimilitude. éviteenpartielebruitdefonddûàdesmotifsnonsignificatifset intrinsèquesàlaséquencerecherchée Inconvénients nepaspouvoirconsidérerdegrandesinsertionsdurant l'alignementdesséquences. Fondésurméthodeheuristique.

10 Améliorations considèrelatotalitédesdiagonalespoureffectuerl'algorithme d'alignementlocaldesmithetwatermanplutôtqued'effectuer l'alignementglobaldeneedlemanetwunschuniquementsurdes portionsdeséquencesprotéiques. Editiondesrésultats enfonctiondesscoresopt. Evaluationdesrésultats L'estimationstatistiqueestfaiteàpartirdesscoresobtenusavec l'ensembledesséquencesdelabanque. programmesprdfetprss(méthodedemontecarlo)pourestimer lavaliditéd'unscoreoptparticulierentreuneséquencedelabanque etlaséquencerecherchée. PRDFproduitdessimulationsselonl'algorithmedeNeedlemanet Wunschappliquélocalementpourl'étaped'alignementoptimal. PRSSutilisel'algorithmecompletdeSmithetWatermanentredeux séquencesprotéiques.

11 FASTAversion3

12 2 1 FASTAversion2

13 3 3

14 4 5 6 fin

15 ProgramFunction fasta fastx/y tfastx/y scanaproteinordnasequence libraryforsimilarsequences compareadnasequencetoa proteinsequencedatabase, comparingthetranslateddna sequenceinforwardandreverse frames. comparesaproteintoa translateddnadatabank.

16 BasicLocalAlignmentSearch Tool KarlinS.andAltschulS.F.(1990).Methodsforassessingthestatistical significanceofmolecularsequencefeaturesbyusinggeneralscoring schemes.procnatlacadsciusa,87, KarlinS.andAltschulS.F.(1993).Applicationsandstatisticsformultiple high scoringsegmentsinmolecularsequences.proc.natl.acad.sci.usa, 90,

17 Conceptionfondéesurmodèlestatistique HSP:High scoringsegmentpair:unsegmentcommun,descoresignificatif etle+longpossibleentre2séquencescorrespondantàunesimilitudesans insertion délétion. MSP(Maximal scoringsegmentpair).lemeilleurscoreobtenuparmitous lescouplesdefragmentspossiblesquepeuventproduire2séquences. MéthodesstatistiquesdeBLASTpermettentladéterminationdela significationbiologiquedesmsps.

18 ProtéineW=3 Ac.nucléiquesW=11 Pourlesprotéines constructiond'unelistedemotssimilaires. Motsimilaire:motobtenantunscore>seuil parmatricedesubstitution

19 RecherchedeHigh scoringsegmentpair(hsp) «Hit»

20 Extensions'arrêtesi: lafind'unedes2séquencesestatteinte lescorecumulé 0 lescorecumulé<max x

21 Evaluationdesrésultats Score(bits)S'=(λS lnk)/ln2 λetk:constantesstatistiquesdusystèmedescores S:scorebrut m,n:longueursdes2séquences E value:e=mn2 S' 1E 1E I Mêmegène I Gènes#id mêmeespèce espècesvoisines Relations pluslointaines 0. E value 1 I inintéressants

22 Avantages Algorithmefondésurcritèresstatistiques Recherchedesfragmentsidentiquesmaisaussisimilaires(pourprotéines). Vialamatricedesubstitution,intègredescritèresbiologiques. Résultatstriésselonplusieurscritères(ex:significationstatistiqueetnonpas seulementvaleurdescore) Trèsrapide(optimisationduprogramme,précodificationdelabanque) Inconvénients bruitdefondimportantlorsdel'identificationdessegments.siséquence possèdedesrégionsrépétéesoudessegmentsdebassecomplexité(segments nonspécifiquesd'unecaractéristiquebiologiquemaiscommunsàplusieurs familles). Filtres:SEGouXNU

23 ProgramFunction BLASTn BLASTp BLASTX TBLASTN DNAsequencevsDNAsequence library proteinsequencevsprotein sequencelibrary compareadnasequencetoa proteinsequencedatabase, comparingthetranslateddna sequenceinforwardandreverse frames. compareaproteinsequencetoa nucleicsequencedatabase translatedinforwardand reverseframes.

24 BLAST2 3x+rapidequeBLAST1 phased'extensionn'alieuque si2hitssontsurlamême diagonale. PSI BLAST(PositionSpecificIterative) sensibilitéaccrue constructiond'unprofilà partird'un1erblastclassique utilepourrecherchermembres d'unemêmefamille. Déduirefonctionsdeprotéines hypothétiques BLAST2 Profil recherche résultats

25

26 nr Allnon redundantgenbankcdstranslations+refseqproteins+pdb+swissprot +PIR+PRF

27

28

29 Sequencesproducingsignificantalignments:ScoreE Value (bits) 1.sp Q57997 Y577_METJAPROTEINMJ0577>gi pir A e 85 2.pdb 1MJH Structure BasedAssignmentOfTheBiochemicalF e 72 3.dbj BAA29916 (AP000003)170aalonghypotheticalprotein[P e 23 4.sp Q57951 Y531_METJAHYPOTHETICALPROTEINMJ0531>gi e 18 5.gi (AE000872)conservedprotein[Methanobacteriumt...854e 16 6.gi (AE000865)conservedprotein[Methanobacteriumt...814e 15 7.gi (AE000803)conservedprotein[Methanobacteriumt...807e 15

30 sp Q57951 Y531_METJAHYPOTHETICALPROTEINMJ0531>gi pir C64366 hypothetical proteinhomologmj0531 Methanococcusjannaschii >gi (U67502)conservedhypotheticalprotein [Methanococcusjannaschii] Length=170 Score=91.3bits(223),Expect=4e 18 Identities=59/156(37%),Positives=88/156(55%),Gaps=14/156(8%) Query:4MYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLN63 +YKKI+PTDS++AKHEV++V+DS+G+ Sbjct:25LYKKIVIPTDGSDVSLEAAKHAINIAKEFDAEVYAIYVVD VSPFVGLPA 73 Query:64KSVEEFENELKNKLTEEAKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDI123 +E+ELLEE++++KKE+GK+++G+PEIV+AE+D+ Sbjct:74EGSWELISEL LKEEGQEALKKVKKMAEEWGVKIHTEMLEGVPANEIVEFAEKKKADL130 Query:124IIMGSHGKTNLKEILLGSVTENVIKKSNKPVLVVKR159 I+MG+GKTL+ILLGSVEVIK++PVLVVK+ Sbjct:131IVMGTTGKTGLERILLGSVAERVIKNAHCPVLVVKK166

31 Limitesdelarecherchedesimilarités pourdéterminerunefonction Gènesinconnus:casdesgènes«orphelins» Erreurs Gènesorthologuesetparalogues Évolution Épissagealternatif:éliminationdifférentedesintronsARNmdifférents Associationdefragmentsdegènesdifférentsfonctionsnouvelles Maturationpost traductionnelle Protéinecodéeparlegénomeprotéinemature Vérificationexpérimentale

Algorithmes pour la comparaison de séquences II

Algorithmes pour la comparaison de séquences II Algorithmes pour la comparaison de séquences II Hélène TOUZET touzet@lifl.fr Equipe Bioinfo Master recherche informatique www.lifl.fr/~touzet/masterrecherche.html Pourquoi comparer des séquences? Puisque

Plus en détail

Recherche par similarité dans les banques/bases de données La suite Blast (Basic Local Alignment Search Tool)

Recherche par similarité dans les banques/bases de données La suite Blast (Basic Local Alignment Search Tool) Recherche par similarité dans les banques/bases de données La suite Blast (Basic Local Alignment Search Tool) A A C T G G T A A C C G A G C T A C G G T C C G Algorithme de Blast (version 1) (Altschul et

Plus en détail

Introduction à l annotation de séquences

Introduction à l annotation de séquences Introduction à l annotation de séquences - Université de Lille 1-2 eme Semestre But de l annotation de séquences Les séquences nucléiques : Détecter la présence de gènes Trouver la structure des gènes

Plus en détail

Introduction à la bioinformatique

Introduction à la bioinformatique Faculté des Sciences - Rabat Laboratoire de Microbiologie et Biologie Moléculaire -------------------------------------- Université Mohamed V - Agdal Faculté des Sciences B.P. 1014 - Rabat - MAROC TD Biologie

Plus en détail

Plan. Comparaison de 2 séquences. Dotplot, alignement optimal Recherche de similarité. Alignement multiple. Phylogénie moléculaire

Plan. Comparaison de 2 séquences. Dotplot, alignement optimal Recherche de similarité. Alignement multiple. Phylogénie moléculaire Plan 1 Banques de données 2 Comparaison de 2 séquences Dotplot, alignement optimal Recherche de similarité 3 Alignement multiple l 4 Phylogénie moléculaire Recherche de similarité 1 séquence (Query) comparée

Plus en détail

Alignement d une séquence avec une banque. Thierry Lecroq Université de Rouen 1

Alignement d une séquence avec une banque. Thierry Lecroq Université de Rouen 1 Alignement d une séquence avec une banque 1 Problématique générale Localiser des alignements significatifs entre une séquence requête x dans une banque de p séquences Y = {y 0,y 1,,y p 1 }. La solution

Plus en détail

Comparaison et alignement. de séquences 2 LV348 -BI. sophie.pasek@upmc.fr. Sophie Pasek

Comparaison et alignement. de séquences 2 LV348 -BI. sophie.pasek@upmc.fr. Sophie Pasek Comparaison et alignement de séquences 2 LV348 -BI Sophie Pasek sophie.pasek@upmc.fr Comment comparer une séquence contre une banque? Comparaison séquence/banque Pourquoi? : Réunir un échantillon taxonomique

Plus en détail

Initiation à la Bioinformatique

Initiation à la Bioinformatique Université d Alexandrie Initiation à la Bioinformatique Basic Local Alignment Search Tool BLAST Université d Alexandrie AUF Auteur(s): Mohamed GAD 2009/2010 Auteur(s) : Mohamed GAD Professeur à l institut

Plus en détail

Bioinformatique appliquée. Cours 4 BLAST. idée. lire un résultat de Blast. la famille Blast

Bioinformatique appliquée. Cours 4 BLAST. idée. lire un résultat de Blast. la famille Blast Bioinformatique appliquée Cours 4 BLAST idée lire un résultat de Blast la famille Blast -1- "quelle est la similarité entre ces 2 séquences? et donc: est-ce que ces deux séquences sont homologues?" "existe-t-il

Plus en détail

Heuristiques pour l alignement et la recherche dans les banques de données biologiques

Heuristiques pour l alignement et la recherche dans les banques de données biologiques Heuristiques pour l alignement et la recherche dans les banques de données biologiques Plan I. Introduction II. Matrices de substitutions: PAM, BLOSUM III. Algorithmes de Filtrage Basés sur la recherche

Plus en détail

Lancer FASTA et BLAST en ligne de commande

Lancer FASTA et BLAST en ligne de commande Lancer FASTA et BLAST en ligne de commande V.2006.1 http://www.esil.univ-mrs.fr/~dgaut/cours Daniel Gautheret ESIL, Université de la Méditerranée Fasta Article original: Lipman and Pearson (1985) Science

Plus en détail

Prédiction de gènes. Cours de présentation des outils bio-informatiques pour la localisation puis l'étude des gènes. Equipe Bonsai (2014)

Prédiction de gènes. Cours de présentation des outils bio-informatiques pour la localisation puis l'étude des gènes. Equipe Bonsai (2014) Prédiction de gènes Cours de présentation des outils bio-informatiques pour la localisation puis l'étude des gènes Equipe Bonsai (2014) La localisation des gènes C'est la première étape pour interpréter

Plus en détail

Alignement de séquences (2/2)

Alignement de séquences (2/2) Alignement de séquences (2/2) Observation à l aide de l outil graphique : le dotplot. Simple, visuel, Très informatif : Permet de repérer une similarité globale Permet de repérer des similarités locales

Plus en détail

Recherche de similarités au moyen de BLAST

Recherche de similarités au moyen de BLAST Recherche de similarités au moyen de BLAST Guy Perrière Laboratoire de Biométrie et Biologie Évolutive UMR CNRS 5558 Université Claude Bernard Lyon 1 http://pbil.univ-lyon1.fr/members/perriere/cours/m1/

Plus en détail

ftp://ftp.ncbi.nih.gov/blast/executables/latest

ftp://ftp.ncbi.nih.gov/blast/executables/latest Jour 4: TP : application à la bibliographie et recherche d'information : recherche systématique d'articles scientifiques liés à des séquences sélectionnées d'une banque de séquence (wget). TP: recherche

Plus en détail

INTRODUCTION À LA BIO-INFORMATIQUE

INTRODUCTION À LA BIO-INFORMATIQUE Biologie moléculaire-2016 1 INTRODUCTION À LA BIO-INFORMATIQUE Dans cette section, on désire vous donner une introduction sur l utilisation du site web du National Center for Biotechnology Information

Plus en détail

Comparaison et alignement de séquences 2

Comparaison et alignement de séquences 2 Comparaison et alignement de séquences 2 LV348 -BI Sophie Pasek sophie.pasek@upmc.fr Comment comparer une séquence contre une banque? Comparaison séquence/banque Pourquoi? : Réunir un échantillon taxonomique

Plus en détail

Les bases de données biologiques. Sigrid Le Clerc Conservatoire Nationale des Arts et Métiers Chaire de Bioinformatique

Les bases de données biologiques. Sigrid Le Clerc Conservatoire Nationale des Arts et Métiers Chaire de Bioinformatique Les bases de données biologiques Sigrid Le Clerc Conservatoire Nationale des Arts et Métiers Chaire de Bioinformatique Sommaire 1. Introduction 2. Le système Entrez 2.1. Description du système Entrez 2.2.

Plus en détail

Références et héritage

Références et héritage Références et héritage Contraintes référentielles pour assurer la consistance d un schéma de données Utilisation (pervertie) de l héritage objets pour faire du polymorphisme et assurer la cohérence d un

Plus en détail

HMSN206 - Partie Alignement

HMSN206 - Partie Alignement M1 Bioinformatique, Connaissances et Données Master Sciences et Numérique pour la Santé Année 2016-2017 HMSN206 - Partie Alignement Partie I-2 : Matrices de scores, BLAST, FASTA Anne-Muriel Arigon Chifolleau

Plus en détail

Contenu du cours. Comparaisons locales et matrices de score. Matrice BLOSUM-62 pour les protéines. Exemples pour l ADN

Contenu du cours. Comparaisons locales et matrices de score. Matrice BLOSUM-62 pour les protéines. Exemples pour l ADN Contenu du cours Comparaisons locales et matrices de score Équipe Bonsai http://www.lifl.fr/bonsai Matrices de scores Recherches locales : BLAST et FastA année 2013 Équipe Bonsai Comparaisons locales et

Plus en détail

Bioinformatique: alignement de séquences

Bioinformatique: alignement de séquences Bioinformatique: alignement de séquences Céline Brochier-Armanet Université Claude Bernard, Lyon 1 Laboratoire de Biométrie et Biologie évolutive (UMR 5558) Celine.brochier-armanet@univ-lyon1.fr Problème

Plus en détail

Bioinformatique. Ressources et banques de données internationales

Bioinformatique. Ressources et banques de données internationales Bioinformatique Ressources et banques de données internationales Frédéric Lecerf frederic.lecerf@agrocampus-ouest.fr UMR PEGASE Equipe Génétique & Génomique Bioinformatique Plan du module 1. Présentation

Plus en détail

Annotation de séquences génomiques Exemple d une région du chromosome 1 de riz autour du gène qsh1 (Os_1:36429001..36558000)

Annotation de séquences génomiques Exemple d une région du chromosome 1 de riz autour du gène qsh1 (Os_1:36429001..36558000) Annotation de séquences génomiques Exemple d une région du chromosome 1 de riz autour du gène qsh1 (Os_1:36429001..36558000) II) Annotation de gènes codant des protéines 1) Objectif du TD L objectif du

Plus en détail

Annotation in silico de séquences biologiques

Annotation in silico de séquences biologiques Annotation in silico de séquences biologiques Carl Herrmann TAGC Inserm U928 Université de la Méditerranée carl.herrmann@univmed.fr Pourquoi Diana est-elle ce qu'elle est...? génotype = l'information génétique

Plus en détail

INTRODUCTION A LA BIOINFORMATIQUE

INTRODUCTION A LA BIOINFORMATIQUE INTRODUCTION A LA BIOINFORMATIQUE Yvan Le Bras @Yvan2935 Yvan.le_bras@irisa.fr CNRS IRISA INRIA Plateforme GenOuest 20 avril 2016 Olivier Collin (https://www.e-biogenouest.org/resources/527) BANQUES Bases

Plus en détail

Initiation à la Bioinformatique Daniel Gautheret ESIL, Université de la Méditerranée

Initiation à la Bioinformatique Daniel Gautheret ESIL, Université de la Méditerranée Initiation à la Bioinformatique Daniel Gautheret ESIL, Université de la Méditerranée V.2004.4 http://www.esil.univ-mrs.fr/~dgaut/cours Bioinformatique Deux définitions possibles Applications de l informatique

Plus en détail

makeblastdb in genome.fasta dbtype nucl title nom_genome out nom_genome_blastdb

makeblastdb in genome.fasta dbtype nucl title nom_genome out nom_genome_blastdb Note du 19 mai 2011 La version de BLAST utilisée dans ce document de mars 2010 est obsolète. Les nouveaux utilisateurs de BLAST devraient directement apprendre et utiliser les commandes BLAST+. L'intégralité

Plus en détail

AVL Liban La Bioinformatique. Bioinformatique

AVL Liban La Bioinformatique. Bioinformatique AVL Liban 2011 La Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu www.cs.sjsu.edu/faculty/khuri Sami Khuri sami.khuri@sjsu.edu Qu est-ce

Plus en détail

ITA GUIDE D UTILISATION

ITA GUIDE D UTILISATION ITA GUIDE D UTILISATION 1 ITA GUIDE D UTILISATION Introduction ITA (ISCAR Tool Advisor) associe vos paramètres d application aux conditions d usinage appropriées. Le logiciel sélectionne la meilleure solution

Plus en détail

Comparaison et! Alignement! de séquences

Comparaison et! Alignement! de séquences Comparaison et! Alignement! de séquences Frédérique Barloy-Hubler fhubler@univ-rennes1.fr CNRS-IGDR Rennes Responsable PF Amadeus Annotation des gènes et des génomes Biosit -UMS 3480 Un petit jeu pour

Plus en détail

Introduction Tableaux / Vecteurs Listes chaînées Un principe général Quelques algorithmes de tri À faire pour lundi prochain. Tableaux VS Listes

Introduction Tableaux / Vecteurs Listes chaînées Un principe général Quelques algorithmes de tri À faire pour lundi prochain. Tableaux VS Listes Tableaux VS Listes Tableaux VS Listes Petit chapitre. Plan Introduction Tableaux / Vecteurs Définition abstraite Qu a-t-on fait avec des vecteurs? Que peut-on faire avec des vecteurs? Listes chaînées Définition

Plus en détail

BIN 1002: INTÉGRATION BIOSCIENCES/INFORMATIQUE

BIN 1002: INTÉGRATION BIOSCIENCES/INFORMATIQUE BIN 1002: INTÉGRATION BIOSCIENCES/INFORMATIQUE Plan de Cours Automne 2015 Professeurs: Sylvie Hamel, Département d Informatique et de Recherche Opérationnelle Guillaume Lettre, Institut de Cardiologie

Plus en détail

TD2 : Histoire évolutive de la famille GH15 des glucosides hydrolases

TD2 : Histoire évolutive de la famille GH15 des glucosides hydrolases Master 1 :: module BBSG1.2.1 "Bioinformatique" :: année 2006/2007 TD2 : Histoire évolutive de la famille GH15 des glucosides hydrolases Encadrants: Emmanuel Talla (talla@ibsm.cnrs-mrs.fr) & Céline Brochier-Armanet

Plus en détail

TD5 : Prédiction de la structure tridimensionnelle d une protéine Modélisation moléculaire

TD5 : Prédiction de la structure tridimensionnelle d une protéine Modélisation moléculaire TD5 : Prédiction de la structure tridimensionnelle d une protéine Modélisation moléculaire Vous aurez besoin des programmes suivant : d un éditeur de séquence d un visualiseur de structure 3D (PyMOL) Avant-propos

Plus en détail

TD5 : Prédiction de la structure tridimensionnelle d une protéine Modélisation moléculaire

TD5 : Prédiction de la structure tridimensionnelle d une protéine Modélisation moléculaire TD5 : Prédiction de la structure tridimensionnelle d une protéine Modélisation moléculaire Avant de commencer le TD, installer (ou vérifier qu ils le sont) sur la partition K: du poste de travail, les

Plus en détail

Le site du BTS-IRIS de Niort

Le site du BTS-IRIS de Niort Cours Modbus/TCP Soumis par DS 10-03-2006 Dernière mise à jour : 16-10-2006 Depuis l'introduction fulgurante des réseaux ethernet dans l'industrie, le protocole Modbus et notamment sa version Modbus/TCP

Plus en détail

Présentation du programme d informatique

Présentation du programme d informatique Présentation du programme d informatique UPS 31 mai 2015 Table des matières 1 Introduction 2 1.1 Présentation.................................. 2 1.2 Représentation des nombres.........................

Plus en détail

CAISSE CASE 655ZSC-300/ mm. 6 prs. 655ZSC-350/ mm. 6 prs. 655ZSC-400/ mm. 6 prs. 655ZSC-450/ mm. 6 prs.

CAISSE CASE 655ZSC-300/ mm. 6 prs. 655ZSC-350/ mm. 6 prs. 655ZSC-400/ mm. 6 prs. 655ZSC-450/ mm. 6 prs. C 0 Par/By COULISSE DE TIROIR INVISIBLE, PEINE EXTENSION ET AMORTISSEUR INTÉGRÉ - «BB» UNDERMOUNT FULL EXTENSION WITH SOFT-CLOSING SLIDE SYSTEM - BB NON DISPONIBLE AUX ÉTAS-UNIS / NOT AVAILABLE IN THE

Plus en détail

Sommaire. A) Méthode de contrôle manuel des résultats produits par GLADX

Sommaire. A) Méthode de contrôle manuel des résultats produits par GLADX Sommaire Définitions et abréviations Résumé Introduction I. Matériel II. Méthode A) Méthode de contrôle manuel des résultats produits par GLADX B) Comparaison des résultats de l outil GLADX avec les résultats

Plus en détail

2013-2014 N.EL FADDOULI 1 2013-2014 N.EL FADDOULI 67. Page 1

2013-2014 N.EL FADDOULI 1 2013-2014 N.EL FADDOULI 67. Page 1 Introduction Bloc PLSQL Déclaration des variable Structure de contrôle Curseurs Les exceptions PL SQL Les fonctions et procédures Les packages Les triggers 1 Définition Utilité Triggers ( déclencheurs

Plus en détail

LFI 2015 - EXTRAIT DE LA MISSION : AIDE PUBLIQUE AU DÉVELOPPEMENT

LFI 2015 - EXTRAIT DE LA MISSION : AIDE PUBLIQUE AU DÉVELOPPEMENT LFI 2015 - EXTRAIT DE LA MISSION : AIDE PUBLIQUE AU DÉVELOPPEMENT Version du 05/01/2015 à 12:05:59 PROGRAMME 110 : AIDE ÉCONOMIQUE ET FINANCIÈRE AU DÉVELOPPEMENT TABLE DES MATIÈRES Présentation des crédits

Plus en détail

LFI 2015 - EXTRAIT DE LA MISSION : PARTICIPATIONS FINANCIÈRES DE L ÉTAT

LFI 2015 - EXTRAIT DE LA MISSION : PARTICIPATIONS FINANCIÈRES DE L ÉTAT LFI 2015 - EXTRAIT DE LA MISSION : PARTICIPATIONS FINANCIÈRES DE L ÉTAT Version du 05/01/2015 à 12:08:01 PROGRAMME 731 : OPÉRATIONS EN CAPITAL INTÉRESSANT LES PARTICIPATIONS FINANCIÈRES DE L ÉTAT TABLE

Plus en détail

BASES DE DONNÉES AVANCÉES

BASES DE DONNÉES AVANCÉES L3 Informatique Option : ISIL BASES DE DONNÉES AVANCÉES RAMDANI MED U-BOUIRA M. R A M D A N I @ U N I V - B O U I R A. D Z P E R S O. L I V E H O S T. F R Cours 5 : Evaluation et optimisation des requêtes

Plus en détail

Initiation à la Bioinformatique

Initiation à la Bioinformatique U n i v e r s i t é d A l e x a n d r i e - A U F Université d Alexandrie Auteur(s): Mohamed GAD 2009/2010 U n i v e r s i t é d A l e x a n d r i e - A U F Auteur(s) : Mohamed GAD Professeur à l institut

Plus en détail

Scores d alignement Matrices de substitution. J.S. Bernardes/H. Richard

Scores d alignement Matrices de substitution. J.S. Bernardes/H. Richard Scores d alignement Matrices de substitution J.S. Bernardes/H. Richard Score d'un alignement Score alignement = Σ scores événements élémentaires (Match, Mismatch, Indel) Amélioration du modèle : pénalité

Plus en détail

PPOOGL. Florent de Dinechin. Python pour les nuls

PPOOGL. Florent de Dinechin. Python pour les nuls PPOOGL Florent de Dinechin Python pour les nuls Python en 30 minutes Introduction Grands principes Python en diagonale Le reste est dans le manuel PPOOGL 1 Introduction Introduction Grands principes Python

Plus en détail

Faculté de droit, de sciences politiques et de gestion. Année universitaire 2015/2016. Semaine d accueil

Faculté de droit, de sciences politiques et de gestion. Année universitaire 2015/2016. Semaine d accueil Faculté de droit, de sciences politiques et de gestion Année universitaire 2015/2016 Semaine d accueil Mardi, 1er septembre 2015 L1 DROIT A-F (étudiants dont le nom de famille commence par une lettre située

Plus en détail

COURS : ENJEUX DE LA DOCUMENTATION ET PRATIQUES DOCUMENTAIRES EC 3 : N 3

COURS : ENJEUX DE LA DOCUMENTATION ET PRATIQUES DOCUMENTAIRES EC 3 : N 3 COURS : ENJEUX DE LA DOCUMENTATION ET PRATIQUES DOCUMENTAIRES EC 3 : N 3 Logiciels documentaires Par : Sahbi SIDHOM MCF.Université de Lorraine & Lab. LORIA / KIWI Cours en ligne : www.loria.fr/~ssidhom/

Plus en détail

La galaxie BLAST 20 ans d'utilisation de la méthode BLAST

La galaxie BLAST 20 ans d'utilisation de la méthode BLAST megablast rpstblastn LEGACY BLAST blastp tblastn BLAST+ BLAST2 PHI BLAST bl2seq tblastx GAPPED BLAST formatdb blastall GAPPED BLAST PSI BLAST PHI PSI BLAST BLAST+ blastdbcmd PSI BLAST blastn GAPPED BLAST

Plus en détail

Objectifs du cours d aujourd hui. Informatique I : Cours d introduction à l informatique et à la programmation Structures de Données Abstraites & Tris

Objectifs du cours d aujourd hui. Informatique I : Cours d introduction à l informatique et à la programmation Structures de Données Abstraites & Tris Objectifs du cours d aujourd hui Informatique I : Cours d introduction à l informatique et à la programmation Structures de Données Abstraites & Tris Continuer l approfondissement de la programmation de

Plus en détail

BIOINFORMATIQUE APPLIQUÉE - CHMI 3206 F. Professeur : Eric R. Gauthier. Test de mi-session. 31 octobre Votre nom :

BIOINFORMATIQUE APPLIQUÉE - CHMI 3206 F. Professeur : Eric R. Gauthier. Test de mi-session. 31 octobre Votre nom : BIOINFORMATIQUE APPLIQUÉE - CHMI 3206 F Professeur : Eric R. Gauthier Test de mi-session 31 octobre 2006 Votre nom : Consignes : 1) Durée : 85 min 2) 5 questions sur 5 pages, pour 80 points. Compte pour

Plus en détail

Bioinformatique Appliquée Recherche de similitudes

Bioinformatique Appliquée Recherche de similitudes Besoin d'accélérer la recherche de similitude dans une banque Bioinformatique Appliquée Recherche de similitudes La recherche de similitude permet de comparer une séquence appelée requête (query) à une

Plus en détail

1. Génomes complets 2. Architecture des génomes 3. Annotation des génomes. Annotation Fonctionnelle

1. Génomes complets 2. Architecture des génomes 3. Annotation des génomes. Annotation Fonctionnelle Plan 1. Génomes complets 2. Architecture des génomes 3. Annotation des génomes a) Annotation structurale : localisation des éléments génétiques b) Annotation fonctionnelle c) Intégrations Annotation Fonctionnelle

Plus en détail

Définition de contraintes. c Olivier Caron

Définition de contraintes. c Olivier Caron Définition de contraintes 1 Normalisation SQL-92 Les types de contraintes 1 Les types de contraintes Normalisation SQL-92 Les contraintes de domaine définissent les valeurs prises par un attribut. 1 Les

Plus en détail

Fida KHATER & Abdoulaziz MOUSSA 03 mars 2012 - Journée Portes Ouvertes à l'um2

Fida KHATER & Abdoulaziz MOUSSA 03 mars 2012 - Journée Portes Ouvertes à l'um2 DEVELOPPEMENT D UNE INTERFACE GRAPHIQUE : LOCAL WEB GUI FOR BLAST (LWBG), POUR LES TRAITEMENTS DE DONNEES BIOLOGIQUES Fida KHATER & Abdoulaziz MOUSSA 03 mars 2012 - Journée Portes Ouvertes à l'um2 Plan

Plus en détail

Méthodes et algorithmes pour le séquençage

Méthodes et algorithmes pour le séquençage Méthodes et algorithmes pour le séquençage Jérémie MARY http://www.lri.fr/~mary La comparaison de séquences Distance d'édition Selon ce concept, le bon alignement est celui qui minimise les opérations

Plus en détail

PHP 6. www.fenetresurtoile.com PHP 6. Jean-François Ramiara. FAD Réseau Pyramide 14/01/2013 Toulouse. Copyright J.F. Ramiara Tous droits réservés

PHP 6. www.fenetresurtoile.com PHP 6. Jean-François Ramiara. FAD Réseau Pyramide 14/01/2013 Toulouse. Copyright J.F. Ramiara Tous droits réservés www.fenetresurtoile.com Jean-François Ramiara FAD Réseau Pyramide 14/01/2013 Toulouse 1 www.fenetresurtoile.com Sommaire Introduction Ajout avec SQL Modification avec SQL Suppression avec SQL Mises à jour

Plus en détail

Informatique CM5 Synthèse :

Informatique CM5 Synthèse : Informatique CM5 Synthèse : 1. Tuples et enregistrements : Un enregistrement a une étiquette, des champs et des noms de champs - L étiquette et les noms des champs sont des atomes ou des entiers - L opération

Plus en détail

Qualité des séquences produites par 454 : exemple de traitement

Qualité des séquences produites par 454 : exemple de traitement Qualité des séquences produites par 454 : exemple de traitement Eric PEYRETAILLADE Equipe d accueil CIDAM Faculté de Pharmacie, Université d Auvergne 1 La Technologie 454 (Roche) Etape 1 : Préparation

Plus en détail

LFI 2015 - EXTRAIT DE LA MISSION : ENGAGEMENTS FINANCIERS DE L ÉTAT

LFI 2015 - EXTRAIT DE LA MISSION : ENGAGEMENTS FINANCIERS DE L ÉTAT LFI 2015 - EXTRAIT DE LA MISSION : ENGAGEMENTS FINANCIERS DE L ÉTAT Version du 05/01/2015 à 12:06:44 PROGRAMME 114 : APPELS EN GARANTIE DE L ÉTAT (CRÉDITS ÉVALUATIFS) TABLE DES MATIÈRES Présentation des

Plus en détail

GMIN206 TD Banques de données biologiques Interrogation des banques via GQuerry et Formats de fichiers de séquences

GMIN206 TD Banques de données biologiques Interrogation des banques via GQuerry et Formats de fichiers de séquences GMIN206 TD Banques de données biologiques Interrogation des banques via GQuerry et Formats de fichiers de séquences 1. Interrogation des banques via GQuerry 1.1 Rappel De manière concrère, l interrogation

Plus en détail

BIO6: Bioinformatique appliquée Correction du TD3

BIO6: Bioinformatique appliquée Correction du TD3 BIO6: Bioinformatique appliquée Correction du TD3 Exercice 1 : programmation dynamique voir le site web indiqué dans le TD pour corriger l'exercice Exercice 2 : similarité de séquence et distance évolutive

Plus en détail

18 h CM (F. Maurel) + 16 h TD/TP (F. Maurel / T. Roy)

18 h CM (F. Maurel) + 16 h TD/TP (F. Maurel / T. Roy) Présentation cours 18 h CM (F. Maurel) + 16 h TD/TP (F. Maurel / T. Roy) 5/6 h Python 2,5/2 h Introduction à l'ihm (démarche participative centrée utilisateur) + Mise en place des groupes 2,5/2 h : Méthodes

Plus en détail

Guide Utilisateur du PX20 2015. Guide Utilisateur du PX20. Thusjan Ketheeswaran 24 Juin 2015

Guide Utilisateur du PX20 2015. Guide Utilisateur du PX20. Thusjan Ketheeswaran 24 Juin 2015 Guide Utilisateur du PX20 1 Thusjan Ketheeswaran 24 Juin 2015 I) Introduction Le lecteur PX-20 est un lecteur de codes à barres programmable offrant une grande capacité de stockage, et qui est capable

Plus en détail

Joint de dilatation / Vertical sismique Seismic wall expansion joint

Joint de dilatation / Vertical sismique Seismic wall expansion joint Joint de dilatation / Vertical sismique eismic wall expansion joint erie AEO Joint de dilatation tout métal de murs extérieurs pour gares, aéroports, centres commerciaux... Existe en version plat et angle.

Plus en détail

Les évolutions en cours

Les évolutions en cours Les évolutions en cours version 1.0 Plan Back-end / Front-end ASIC / FPGA 2 Le problème des longs fils Relative delay Temps de propagation dans les longs fils Temps de propagation dans les portes (fanout

Plus en détail

Module Com231A - Web et Bases de Données Notion 3 : SQL

Module Com231A - Web et Bases de Données Notion 3 : SQL Module Com231A - Web et Bases de Données Notion 3 : SQL Qu est ce qu une base de données? Introduction Une base de données est un ensemble d au moins un tableau contenant des données. Exemple : une base

Plus en détail

Équipement Emplacement de JAWS sur le poste désigné

Équipement Emplacement de JAWS sur le poste désigné Dragon Naturally Speaking PRÉSENTATION Équipement Emplacement de JAWS sur le poste désigné Dragon Naturally Speaking (DNS) est un logiciel de reconnaissance vocale permettant de dicter du texte à l ordinateur.

Plus en détail

Introduction à la bioinformatique

Introduction à la bioinformatique Introduction à la bioinformatique Céline Brochier-Armanet Université Claude Bernard, Lyon 1 Laboratoire de Biométrie et Biologie Evolutive (UMR 5558) celine.brochier-armanet@univ-lyon1.fr Lectures recommandées

Plus en détail

Projet MVC-CD. Des modèles intelligents pour accroître la productivité du développement des logiciels de gestion

Projet MVC-CD. Des modèles intelligents pour accroître la productivité du développement des logiciels de gestion Projet MVC-CD Des modèles intelligents pour accroître la productivité du développement des logiciels de gestion Les APIs de tables (TAPIs) du modèle physique relationnel Sommaire. Préambule... 2 2. Que

Plus en détail

PRÉSENTATION DE LA BIOINFORMATIQUE

PRÉSENTATION DE LA BIOINFORMATIQUE PRÉSENTATION DE LA BIOINFORMATIQUE O. Collin CNRS IRISA GenOuest 7 octobre 2013 Warming session Poser le décor pour les 3 jours Mise en évidence et mise en relation des éléments clés Réflexions sur quelques

Plus en détail

ALGORITHMES POUR LA VISUALISATION SCIENTIFIQUE

ALGORITHMES POUR LA VISUALISATION SCIENTIFIQUE BAZEILLE Stéphane MOUGEL Baptiste IUP3 ALGORITHMES POUR LA VISUALISATION SCIENTIFIQUE EN Année 2003/2004 1 TABLE DES MATIERES Home... 3 Introduction.... 3 Marching Square... 4 Algorithme....4 Programmation...4

Plus en détail

Cours 10 Formulaires Web pour saisie de données dans une base de données relationnelle avec PHP (partie 2 de 2)

Cours 10 Formulaires Web pour saisie de données dans une base de données relationnelle avec PHP (partie 2 de 2) École de bibliothéconomie et des sciences de l information SCI6306 Bases de données documentaires Cours 10 Formulaires Web pour saisie de données dans une base de données relationnelle avec PHP (partie

Plus en détail

Introduc)on à Ensembl/ Biomart : Par)e pra)que

Introduc)on à Ensembl/ Biomart : Par)e pra)que Introduc)on à Ensembl/ Biomart : Par)e pra)que Stéphanie Le Gras Jean Muller NAVIGUER DANS ENSEMBL : PARTIE PRATIQUE 2 Naviga)on dans Ensembl : Pra)que Exercice 1 1.a. Quelle est la version de l assemblage

Plus en détail

Examen de bioinformatique Février 2009

Examen de bioinformatique Février 2009 Examen de bioinformatique Février 2009 Durée : 2h (ou 2h30) - Documents interdits Première partie (4 points) 1) La séquence ci-dessous est-elle au format fasta (justifiez votre réponse)? 1 pt Is the sequence

Plus en détail

LFI 2016 - EXTRAIT DE LA MISSION : ENGAGEMENTS FINANCIERS DE L'ÉTAT

LFI 2016 - EXTRAIT DE LA MISSION : ENGAGEMENTS FINANCIERS DE L'ÉTAT LFI 2016 - EXTRAIT DE LA MISSION : ENGAGEMENTS FINANCIERS DE L'ÉTAT Version du 04/01/2016 à 14:19:43 PROGRAMME 114 : APPELS EN GARANTIE DE L'ÉTAT (CRÉDITS ÉVALUATIFS) 2 LFI 2016 Programme n 114 PRÉSENTATION

Plus en détail

Formation au langage SQL

Formation au langage SQL Objectif SQL est un langage informatique normalisé qui sert à effectuer des opérations sur des bases de données. Il permet de rechercher, d'ajouter, de modifier ou de supprimer des données dans les bases

Plus en détail

Analyse in-silico de séquences biologiques

Analyse in-silico de séquences biologiques Analyse in-silico de séquences biologiques Carl Herrmann IBDML Université de la Méditerranée herrmann@ibdm.univ-mrs.fr année 2006-2007 1 Génomique "traditionnelle" organisme à séquencer séquençage "contigs"

Plus en détail

Cours Web n o 7 MySQL et PHP

Cours Web n o 7 MySQL et PHP Introduction aux bases de données Cours Web n o 7 MySQL et PHP Sandrine-Dominique Gouraud (gouraud@lri.fr) Pierre Senellart (pierre@senellart.com) Semaine du 7 novembre 2005 S.-D. Gouraud, P. Senellart

Plus en détail

A BIOINFORMATIQUE FONCTIONNELLE

A BIOINFORMATIQUE FONCTIONNELLE Biologie moléculaire-2017 1 A BIOINFORMATIQUE FONCTIONNELLE PRÉDIRE LA FONCTION D UNE PROTÉINE INCONNUE Supposons que vous avez trouvé la séquence d'acides aminés d'une protéine inconnue et que vous souhaitez

Plus en détail

Bases de Données relationnelles et leurs systèmes de Gestion

Bases de Données relationnelles et leurs systèmes de Gestion III.1- Définition de schémas Bases de Données relationnelles et leurs systèmes de Gestion RAPPELS Contraintes d intégrité sous Oracle Notion de vue Typage des attributs Contrainte d intégrité Intra-relation

Plus en détail

INTRODUCTION À LA BIO-INFORMATIQUE

INTRODUCTION À LA BIO-INFORMATIQUE Biologie moléculaire-2017 1 INTRODUCTION À LA BIO-INFORMATIQUE Dans cette section, on désire vous donner une introduction sur l utilisation du site web du National Center for Biotechnology Information

Plus en détail

Chapitre 3 La manipulation des données (LMD)

Chapitre 3 La manipulation des données (LMD) 75 Chapitre 3 La manipulation des données (LMD) 1. Introduction La manipulation des données (LMD) Le langage de manipulation de données permet aux utilisateurs et aux développeurs d'accéder aux données

Plus en détail

15/05/2014. Initiation. Le Corguillé Monsoor V1.01 16 / 05 / 2014. Le Corguillé et al. 1

15/05/2014. Initiation. Le Corguillé Monsoor V1.01 16 / 05 / 2014. Le Corguillé et al. 1 15/05/2014 Initiation Le Corguillé Monsoor V1.01 16 / 05 / 2014 Le Corguillé et al. 1 INTRODUCTION / PROBLÉMATIQUE 16 / 05 / 2014 Le Corguillé et al. 2 Introduction Setup TP http://galaxy.sb-roscoff.fr

Plus en détail

Objecteering/UML Version 5.3.0 P07280. Objecteering/UML : Readme

Objecteering/UML Version 5.3.0 P07280. Objecteering/UML : Readme Objecteering/UML Version 5.3.0 P07280 Objecteering/UML : Readme 1. INTRODUCTION...3 2. INSTALLATION DU PATCH P07280 POUR OBJECTEERING/UML 5.30 SP3...4 2.1. CONFIGURATION NECESSAIRE... 4 2.2. PROCEDURE

Plus en détail

AMV Convert Tool (Outil de conversion AMV)

AMV Convert Tool (Outil de conversion AMV) Aide pour AMV Convert Tool (Outil de conversion AMV) 1. Introduction Cet outil est utilisé pour convertir des fichiers multimédia vidéo en format AMV qui peut être lu sur le lecteur MP3/MP4. Les types

Plus en détail

Un fonctionnement optimum ainsi qu une augmentation de la durée de vie des tubes et des composants est assurée.

Un fonctionnement optimum ainsi qu une augmentation de la durée de vie des tubes et des composants est assurée. TRON a u d i o carte de monitoring & contrôle 0. Revison du document Rev 1- novembre 2007 Document initial 1. Introduction Cette carte compacte gère le fonctionnement de l appareil. La mise sous tension

Plus en détail

P R O G R AM M E E T I N S T R U C T I O N S O F F I C I E L L E S L INFORMATIQUE

P R O G R AM M E E T I N S T R U C T I O N S O F F I C I E L L E S L INFORMATIQUE P R O G R AM M E E T I N S T R U C T I O N S O F F I C I E L L E S POUR L ENSEIGNEMENT DE L INFORMATIQUE Première et deuxième années des classes préparatoires filières : MP, PSI et TSI PREAMBULE Les technologies

Plus en détail

Principes des Méthodes Agile L impact sur la relation client-fournisseur

Principes des Méthodes Agile L impact sur la relation client-fournisseur Principes des Méthodes Agile L impact sur la relation client-fournisseur Sébastien DELAYRE 06/12/2013 CGI Business Consulting. CONFIDENTIEL Principes des méthodes agiles Introduction Des Méthodes de pilotage

Plus en détail

1/28. I Utiliser à bon escient les types de données proposés par SQL, ou. Introduction 3/28

1/28. I Utiliser à bon escient les types de données proposés par SQL, ou. Introduction 3/28 Introduction 1/28 2/28 Anne-Cécile Caron Licence MIAGE - BDD 2015-2016 Objectifs Après ce cours, les TD et TP correspondants, vous devez être capables de I Créer des tables à partir d un modèle I Utiliser

Plus en détail

12.6 Correction d'outil tridimensionnelle (option de logiciel 2) 12.6 Correction d'outil. Introduction

12.6 Correction d'outil tridimensionnelle (option de logiciel 2) 12.6 Correction d'outil. Introduction 12.6 Correction d'outil tridimensionnelle (option de logiciel 2) Introduction La TNC peut exécuter une correction d'outil tridimensionnelle (correction 3D) pour des séquences linéaires. En plus des coordonnées,

Plus en détail

Réunion GDS 13 octobre 2006

Réunion GDS 13 octobre 2006 École normale supérieure de Lyon Réunion GDS 13 octobre 2006 Plan Introduction 1 Introduction 2 3 4 5 6 Les workflows Ensemble de tâches connectées La structure du workflow représente la relation temporelle

Plus en détail

La Couche Liaison. Modèle OSI : couche 2

La Couche Liaison. Modèle OSI : couche 2 La Couche Liaison Modèle OSI : couche 2 La Couche Liaison Objectif : assurer une communication fiable et efficace entre deux machines adjacentes, ie les données échangées par la couche réseau r doivent

Plus en détail

Biologie «in silico» Adapté de Pierre Vincens

Biologie «in silico» Adapté de Pierre Vincens Biologie «in silico» Adapté de Pierre Vincens Bioinformatique Association de la biologie et de l'informatique Objectifs : Analyser, modéliser ou prédire les informations issues de données biologiques expérimentales

Plus en détail

Débarrassez gratuitement votre PC des virus, trojans, spywares...

Débarrassez gratuitement votre PC des virus, trojans, spywares... Kaspersky est connu comme l'un des principaux éditeurs d'outils de sécurité, et sa suite de sécurité comme son antivirus sont unanimement salués par les spécialistes. C'est tout le savoir-faire de l'éditeur

Plus en détail

Connecteur Zimbra pour Outlook 2007 et 2010 (ZCO) w

Connecteur Zimbra pour Outlook 2007 et 2010 (ZCO) w w Procédure Messagerie Outlook 2007 et 2010 Solutions informatiques Connecteur Zimbra pour Microsoft Outlook 2007 et 2010 (ZCO) 1/46 SOMMAIRE 1 Introduction... 3 2 Compatibilité... 3 2.1 Versions supportées

Plus en détail

ANNEXE "1" GÉNIE DE LA CONSTRUCTION MATHÉMATIQUES SCIENCES FONDAMENTALES

ANNEXE 1 GÉNIE DE LA CONSTRUCTION MATHÉMATIQUES SCIENCES FONDAMENTALES GÉNIE DE LA CONSTRUCTION CTN103 ÉLÉMENTS DE CONSTRUCTION DE BÂTIMENT CTN600 GESTION DES CONTRATS DE CONSTRUCTION INF130 ORDINATEURS ET PROGRAMMATION CTN426 HYDRAULIQUE ET HYDROLOGIE CTN404 SCIENCES ET

Plus en détail

Connecteur Zimbra pour Outlook 2003 (ZCO)

Connecteur Zimbra pour Outlook 2003 (ZCO) Solutions informatiques w Procédure Messagerie Outlook 2003 Connecteur Zimbra pour Microsoft Outlook 2003 (ZCO) 1/49 SOMMAIRE 1 Introduction... 3 2 Compatibilité... 3 2.1 Versions supportées des systèmes

Plus en détail

Analyse in silico de génomes, protéomes et transcriptomes. «Génomique comparative» V.2012.1. Protocole TD

Analyse in silico de génomes, protéomes et transcriptomes. «Génomique comparative» V.2012.1. Protocole TD Magistère Biotechnologies Analyse in silico de génomes, protéomes et transcriptomes «Génomique comparative» V.2012.1 Protocole TD Notes : Scripts et données sur : http://rna.igmors.u-psud.fr/gautheret/cours/analinsilico

Plus en détail