FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo"

Transcription

1

2 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora sy 20 minitra, hariva. FANDAHARAM-POTOANA: - Fandraisana fanapahan-kevitra mikasika ny fitsipaham-pitokisana ny Governemanta tarihin ny Général de Brigade ao amin ny Tafika an habakabaka, RAVELONARIVO Jean; Praiminisitra, Lehiben ny Governemanta. - Famaranana amin ny fomba ofisialy ny fotoam-pivoriana ara-potoana voalohan ny Antenimierampirenena, taona Nitohy ny Zoma 3 Jolay 2015, tamin ny 5 ora sy 20 minitra, hariva, ny fivorian ny Antenimierampirenena. Andriamatoa RAKOTOMAMONJY Jean Max, Filohan ny Antenimierampirenena no nitarika ny fivoriana. Rehefa avy niarahaba ny mpivory, Andriamatoa Filoha dia niangavy ny Mpitantsoratra hanao ny fiantsoana anarana. Nanatanteraka izany, Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo, Filoha Lefitra avy amin ny Faritanin i Fianarantsoa. Rehefa izany, nilaza ny fandaharam-potoana, Andriamatoa Filoha dia ny fitsipahampitokisana ny Governemanta tarihin Andriamatoa RAVELONARIVO Jean, Praiminisitra, Lehiben ny Governemanta sy ny famaranana amin ny fomba ofisialy ny fotoam-pivoriana voalohan ny Antenimierampirenena, taona Nambarany taorian izay fa voapetraka tao amin ny Birao Maharitry ny Antenimierampirenena ny Alarobia 1 Jolay 2015 ity fitsipaham-pitokisana ity ary nampitaina tany amin ny Governemanta ny Alakamisy 2 Jolay Dimy no loham-piampangana amin izany raha fehezina ka ireto avy izany: - Ny fitantanana tsy mahomby amin ny vonjy voina (De la gestion approximative des urgencies humanitaires). - Ny firongatry ny tsy fandriampahalemana (De la resurgence des problèmes de sécurité). - Ny fikasan ny mpanatanteraka hisalovana ny asan ny mpanao lalàna (De la tentative de substitution du Gouvernement à l Assemblée Nationale). - Ny tsy fahaizan ny mpanatanteraka izay miteraka tsy fahombiazana amin ny ankapobeny (De l incompétence globale du Gouvernement) - Ny fandikana miharihary ny Lalàmpanorenana sy ny didy aman-dalàna (De la violation flagrante des dispositions Constitutionnelles et règlementaires)

3 2 Rehefa izany, mbola niangavy ny Mpitantsoratra hamaky ny andinin-dalàna mifehy ny Fitsipaham-pitokisana, Andriamatoa Filoha. Ireto avy izany: ny andininy faha-103 ao amin ny Lalàmpanorenana; ny andininy faha-199, faha-200, faha-87, faha-88 ary ny andininy faha-192, andalana faha-2 ao amin ny Fitsipika Anaty mifehy ny Antenimierampirenena. Nanatontosa izany, Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo. Lalàmpanorenana: Andininy faha-103: Azon ny Antenimierampirenena atao ny maneho tsy fankasitrahana ny andraikitry ny Governemanta amin ny alàlan ny latsabato fitsipaham-pitokisana. Tsy azo raisina anefa ny tolo-kevitra toy izany raha tsy ny antsasaky ny mpikambana ao amin ny Antenimierampirenena no manao sonia azy. Valo amby efapolo ora aorian ny fametrahana ny tolo-kevitra hotapahina vao azo atao ny latsabato. Tsy lany ny fitsipaham-pitokisana raha tsy ny roa ampahatelon ny mpikambana ao amin ny Antenimierampirenena no mankato azy. Raha lany izany fitsipaham-pitokisana izany dia mametraka ny fialany amin ny Filohan ny Repoblika ny Governemanta. Didim-pitondrana laharana faha-67-an/p anaovana ny Fitsipika Anaty Mifehy ny Antenimierampirenena tamin ny 4 Jona Andininy faha-199: Ny fametrahana ny fitsipaham-pitokisana araka ny fepetra voatsinjo amin ny andininy faha-103 ao amin ny Lalàmpanorenana dia hita fototra amin ny alàlan ny fametrahana ao amin ny Filohan ny Antenimierampirenena ny antontan-taratasy mitondra ny lohateny hoe Fitsipaham-pitokisana arahina ny lisitry ny sonian ny antsasaky ny mpikambana mandrafitra ny Antenimierampirenena. Tsy maintsy omban antony ny fitsipaham-pitokisana. Manomboka amin ny fametrahana izany, dia tsy misy sonia azo esorina na ampiana intsony. Mampahafantatra ny Governemanta ny fitsipaham-pitokisana ny Filoha, mampahalala izany ny Antenimierampirenena ka manao peta-drindrina izany ary mampahafantatra izany ny Antenimiera mandritra ny fivoriana akaiky indrindra ataony. Avoaka amin ny tatitry ny fivoriana ny lisitra tsy azo ovana intsony mirakitra sonia. Andininy faha-200: Ny Diniky ny Filoha no mandraikitra ny vaninandro anaovana ny adihevitra momba ny fitsipaham-pitokisana, mifandray amin ny fahataperan ny fe-potoana araka ny Lalàmpanorenana valo amby efapolo ora manaraka ny fametrahana izany. Ny adihevitra dia alamina araka ny fepetra voalazan ny andininy faha-171, andalana 3 hatramin ny 5. Raha maro ny fitsipaham-pitokisana, ny diniky ny Filoha dia afaka manapaka

4 3 hoe ireto dia hiadian-kevitra miaraka na dia efa nanaovana latsabato misaraka aza ny tsirairay. Tsy misy fisintonana ny fitsipaham-pitokisana intsony aorian ny fiadian-kevitra izany. Rehefa natao ny adihevitra, dia tsy maintsy tanterahina hatramin ny latsabato izany. Aorian ny adihevitra ankapobeny, ny anjara fitenenana dia azo omena ny mpandaha-teny notendren ny vondrona tsirairay mandritra ny dimy ambin ny folo minitra ho fanazavana ny latsabato ary dimy minitra ho an ny mpandaha-teny hafa. Ampiharina amin ireto farany ny fepetra mikasika ny famaranana. Tsy azo anolorana fanitsiana amin ny fitsipaham-pitokisana. Ny Solombavambahoaka dia mandray anjara amin ny latsabato andraisan ny rehetra anjara eny amin ny sehatra anoloana, izay atao araka ny fepetra voalazan ny andininy faha-92, 2. Tsy azo atao ny latsabato raha tsy valo amby efapolo ora aorian ny fametrahana ny fitsipaham-pitokisana. Raha voailiky ny roa ampahatelon ny mpikambana mandrafitra ny Antenimierampirenena izany, dia mametraka ny fialany amin ny Filohan ny Repoblika ny Governemanta. Andininy faha-87: Azy manokana ny latsabato ataon ny Solombavambahoaka. Na izany aza, ny zony handatsa-bato amin ny fifidianana ampahibemaso dia azon izy ireo ampanaovina olon-kafa araka ny fepetra faritan ny hitsivolana laharana faha tamin ny 18 Aprily 2014 anaovana ny Lalàna Fehizoro mandraikitra ny fitsipika mikasika ny fampandehanana ny Antenimierampirenena. Ny fanomezana fahefana handatsa-bato dia azy manokana foana, natao amin ny anaran ny Solombavambahoaka iray notondroina anarana ihany. Ny fanomezam-pahefana dia azo afindra miaraka amin ny fifanekena mialoha ataon ilay mpanome fahefana amin ny nomena fahefana iray hafa notendreny ihany koa. Ampahafantarina ny Filoha izany alohan ny fisokafan ny latsabato na ny latsabato voalohany izay ampiharana azy. Andininy faha-88: Tsy mihoatra ny iray volana ny fanomezam-pahefana. Raha toa ka tsy voafaritra ny faharetan ny fanomezam-pahefana dia tapitra avy hatrany izany aorian ny fepotoana 8 andro katroka manomboka amin ny fandraisana azy. Andininy faha-92, andalana faha-2: Ho an ny latsabato eny amin ny sehatra eny anoloana ho an ny rehetra, ny Solombavambahoaka rehetra dia antsoin ny vadin-tany amin ny anarany avy. Ireo izay mitondra ny anarana manomboka amin ny litera natao an-tsapaka mialoha no antsoina voalohany. Atao ny fanaovan-tsonia ny anaran ny mpifidy. Atao amin ny alalan ny taratasin-datsabato ny latsabato. Ny Solombavambahoaka tsirairay dia mametraka ny taratasin-datsabatony ao amin ny iray amin ireo mpitantsoratra, izay handrotsaka izany ao anaty vata fandatsaham-bato napetraka ery amin ny sehatra eny anoloana.

5 4 Misokatra mandritra ny ora iray ny latsabato. Ny vokatry ny latsabato dia zahan ny mpitantsoratra fototra ary ambaran ny Filoha. Ny fombafomba fanaovana ny fanomezam-pahefana handatsa-bato dia alamina amin ny alàlan ny torolàlana ataon ny Birao. Nambaran Andriamatoa Filoha, taorian izay ny tokony hanarahana an-tsakany sy an-davany ireo andinin-dalàna ireo. Rehefa izany, mbola nanome fitenenana ny Mpitantsoratra hamaky ny votoatin ny fitsipaham-pitokisana indray, Andriamatoa Filoha. Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo, hatrany no nanatanteraka izany. «Motion de censure» Nous, Députés de Madagascar ; Vu les articles 103 de la Constitution, 199, 200, et 201 et l Arrêté 67-AN/P portant Règlement Intérieur de l Assemblée nationale ; Déposons la présente motion de censure contre le Gouvernement dirigé par Son Excellence, le Général de Brigade aérienne Jean RAVELONARIVO, Premier Ministre, Chef du Gouvernement, pour les motifs suivants: 1. De la gestion approximative des urgences humanitaire : Suite au passage de deux cyclones, Chedza et Fundi, et des pluies torrentielles de janvier à mars, qui ont dévasté l Ile d Ouest en Est et du Nord au Sud, faisant plusieurs victimes, dont plusieurs centaines de milliers de sinistrés parmi la population Malagasy, un nombre de morts indéterminés et des milliards d ariary de dégâts, le Gouvernement a fait preuve d une certaine incompétence dans l apport d une solution rapide et efficace pour gérer la situation de crise. Ainsi, une partie de nos compatriotes les plus défavorisés, habitant les zones inondables de la capitale et des provinces pour la plupart, vivement dans des conditions humaines indignes et font face chaque jour, en plus des difficultés quotidiennes se survie, à des problèmes graves de santé publique. Le Premier Ministre a, par deux fois, appelé à l aide d urgence internationale mais n a reçu aucune réponse favorable en phase avec le niveau des dégâts constatés de la part de la Communauté Internationale. On ne peut alors, en conclure que soit la Communauté Internationale ne fait pas confiance à ce Gouvernement, soit que ce dernier n a pas été capable de fournir le dossier technique nécessaire au déclenchement du dispositif d aides internationales en cas de catastrophe naturelle. Or, comme nous le savons tous, Madagascar bénéficie d un dispositif régional qui permet aux pays partenaires de coopérer d une manière efficace en cas de crise: la PIROI, Plateforme d Intervention Régionale de l Océan Indien. La PIROI, créée en 2000, est composée, outre la FICR et le CICR, des sociétés de la Croix Rouge et du Croissant Rouge des Comores, de la France (Réunion et Mayotte), de Madagascar, de Maurice, du Mozambique, des Seychelles et de la Tanzanie. Récemment, en avril 2012, la PIROI a signé avec la COI (Commission de l Océan Indien) un accord régional de partenariat, afin de mettre en commun les compétences, les connaissances et les expériences respectives dans la perspective d une meilleur prévention et d une réponse plus efficace aux catastrophes naturelles dans l Océan Indien. Le dispositif est basé à la Réunion; en tant que de besoin logistique, il peut solliciter la mobilisation des moyens des FAZSOI

6 5 (Forces Armées Françaises sur Zone Sud Océan Indien) pour bénéficier notamment de vecteurs transports aériens et maritimes. Nous tenons à souligner qu un tel dispositif existe dans chaque région du Globe: le cas de l archipel du Vanuatu en est l illustration parfaite avec la mobilisation des pays riverains dans les 24 heures qui ont suivi le passage du cyclone PAM. 2. De la résurgence des problèmes de sécurité : Après les opérations de pacification des «dahalo» dans le sud, pour lesquelles le précédent Gouvernement a engagé une campagne de communication sans précédent, les problèmes de sécurité n ont, en réalité, jamais connu ne serait-ce qu un début de dénouement. Et cela est amplement prouvé par l incapacité actuelle du Gouvernement à contenir la persistance de la circulation illicite des armes de guerre en tous genres qui favorisent les attaques à main armée, souvent assorti de morts d hommes, dont la presse et les médias font leur une presque chaque jour. D ailleurs, nous croyons fortement que cet état des choses crée une défiance de la population envers le Gouvernement en général, et le système judiciaire en particulier, d où la recrudescence des actes de justice populaire. De plus, lorsqu il s agit de mobiliser en masse les forces de l ordre pour empêcher le citoyen d exercer son droit constitutionnel d expression sur la place publique, le Gouvernement fait d une promptitude sans failles, mais pour protéger le citoyen malagasy et ses biens, il n y a, ni moyen humain, ni moyen matériel, ni moyen financier. 3. De la tentative de substitution du Gouvernement à l Assemblée Nationale : Le 24 février 2015, le Conseil de Gouvernement approuve une communication relative aux modalités de rattachement des sociétés commerciales à participation publique au Ministère d Etat chargé des Projets Présidentiels, de l Aménagement du Territoire et de l Equipement. Or, il se trouve que la loi n du 04 septembre 2014 relative aux sociétés commerciales à participation publique, votée par l Assemblée Nationale, et promulguée par le Président de la République, prévoit déjà ces modalités. Il y a en l espèce une tentative manifeste du Gouvernement de se substituer au pouvoir législatif de changer les dispositions d une loi par une simple communication. Ce qui constitue une violation grave des principes de la séparation des pouvoirs et en conséquence, de la Constitution qui agence et détermine les champs d application des pouvoirs et des attributions de chaque institution de la République. 4. De l incompétence globale du Gouvernement : Lors du passage de la Délégation du Fonds Monétaire International à Madagascar du 18 février au 04 mars 2015, le Gouvernement n a pas réussi à obtenir un accord de principe pour le déblocage des fonds de la FEC (Facilité Elargie de Crédit) qui est l outil principal du FMI pour apporter un soutien à moyen terme aux pays à faible revenu. Cet état des choses traduit un climat de suspicion quant à la capacité du Gouvernement Jean RAVELONARIVO à donner des garanties nécessaires pour mener à bien une politique de gestion saine des finances publiques, qui est l une des conditionnalités pour le déblocage de la FEC. D ailleurs, nous sommes pessimistes quant à la capacité de ce Gouvernement à rétablir la confiance des partenaires techniques et financiers, politico-économique de Madagascar et ses évolutions récentes.

7 6 En outre, la nomination des Chefs de Région lors du Conseil des Ministres en mars dernier prouve encore une fois l incompétence de ce Gouvernement. En effet, comment ces éminents dirigeants de notre pays ont-ils pu laisser nommer des Hauts Employés de l Etat sur la base d un texte caduc, en l occurrence la loi n relative aux Régions du 17 juin 2004? Il se trouve, en effet, que cette loi a été abrogée par la loi du 27 septembre 2014 relative aux ressources des Collectivités Territoriales Décentralisées, aux modalités d élections, ainsi qu à l organisation, au fonctionnement et aux attributions de leurs organes en son article 326 alinéa 6 et qu elle précise en son article 311 que les Chefs de Région sont élus au suffrage universel indirect. Ainsi, la nomination de ces nouveaux Chefs de Région constituent en tous points soit une incompétence avérée de tous les membres de Gouvernement car ignorants des dispositions législatives en vigueur, soit un abus de pouvoir de leur part en faisant des dispositions Constitutionnelles qui limitent effectivement leurs pouvoirs. Par ailleurs, malgré les promesses faites ainsi que le changement du Ministre et de tous les responsables en charge, les délestages de la production en électricité demeurent quotidiens dans plusieurs parties de la Grande Ile. Des audits de la JIRAMA ont été promis par ce Gouvernement mais il n y a aucune transparence quant au déroulement de ceux-ci. Nous pouvons alors en déduire que le Gouvernement est dans l incapacité de trouver les solutions durables à ce problème qui touche la majorité de la population Malagasy. De plus, le Gouvernement peine à trouver les justifications de la hausse constante des prix du carburant, entraînant une hausse généralisée des prix des denrées courantes en premier lieu desquels se trouvent les PPN, alors que les prix du baril du pétrole sur le marché mondial n ont jamais atteint un niveau aussi bas depuis une dizaine d années et maintiennent un niveau en dessous de USD 60 depuis le début de l année De la violation flagrante des dispositions constitutionnelles et règlementaires : En application des dispositions de l article 199 alinéas 1 et 2 du Règlement intérieur sus énuméré, Constatant la violation manifeste des dispositions constitutionnelles perpétrées par les membres du Gouvernement notamment en ce qui concerne les droits à l information de tout citoyen prévus par les articles 10 et 11 de la Constitution ; Constatant, par ailleurs, la violation flagrante des dispositions de l article 172 du Règlement Intérieur en référence, relatif aux questions orales notamment le refus par le Gouvernement de transmettre en direct par les médias publics le déroulement des séances s y rapportant ; Conscient que les foyers de tensions dues aux grèves du personnel affectant différents secteurs tels que la Compagnie AIR MADAGASCAR, le service des domaines depuis quelques temps, sans que des mesures de redressement adéquates aient été prises par le Gouvernement, sont de nature à porter fortement préjudice au pays sur le plan socioéconomique ; De tout ce qui précède, il est alors très difficile de croire que le Gouvernement sera capable d assurer les missions qui lui ont été attribuées : sortir le pays de la pauvreté, etc.

8 7 Qu il y a lieu d engager la responsabilité du Gouvernement, par le vote d une motion de censure, en appliquant les dispositions de l article 103 de la Constitution et celles des articles 199, 200 et 201 de l arrêté portant Règlement Intérieur de l Assemblée nationale. Fait à Antananarivo, le 01 Juillet 2015» Nambaran Andriamatoa Filoha, taorian izay fa hiroso amin ny adihevitra ankapobeny ny mpivory ary nilaza ny fandaminana izany izy. Mandray fitenenana voalohany ireo nanaiky ny fitsipaham-pitokisana, rehefa tapitra izay vao ireo mitsipaka izany. Rehefa vita izany, omena fitenenana, Andriamatoa Praiminisitra, hamaliany ny fanankianana voarakitra ao anatin ny fitsipaham-pitokisana. Marihina, fa araka ny Fitsipika Anaty mifehy ny Antenimierampirenena, andininy faha-200, andalana faha-4, dimy (05) minitra no faharetan ny fitenenana omena ny Solombavambahoaka tsirairay ary nohamafisin Andriamatoa Filoha, fa tokony hiompana amin ireo lohahevitra dimy voalaza teo ambony ny fandraisam-pitenenana. Mialoha ny fandraisam-pitenenana anefa, maro ireo Solombavambahoaka nanao satroka, ka Solombavambahoaka miisa folo (10) avy amin ny mpitsipaka ny fitsipaham-pitokisana no nangataka ny isan ny Solombavambahoaka tonga manatrika ny fivoriana, ny tokony hanatrehan ny Praiminisitra ny anton ny fitsipaham-pitokisana, ny tokony hamakiana ny fitsipaham-pitokisana amin ny teny malagasy, noho ity farany tenim-pirenentsika; nangataka ny tokony mbola tsy hanaovana ity «motion de censure» ity satria rehefa tsy nahomby tamin ny fiampangana ny Filohan ny Repoblika amin ny hampiatoana azy amin ny asany dia miroso amin ity zavatra ity indray. Niangavy ihany koa ny fampitana mivantana amin ny TVM sy RNM mba ho hitan ny vahoaka Malagasy marina izay zava-miseho eto amin ny Antenimierampirenena. Solombavambahoaka miisa fito ambin ny folo (17) avy amin ny mpanaiky ny fitsipahampitokisana kosa no nilaza fa malalaka amin ny fanehoan-kevitra ny olona rehetra ary anisan izany ny Solombavambahoaka; ato amin ny Lapan ny Demokrasia no iray amin ireo toerana azo anaovana izany; ho fanampiana ny Filohan ny Repoblika koa no anton ity «motion de censure» ity, fa tsy midika ho fihemorana amin ny raharaham-pirenena. Tao anatin ny fandraisam-pitenenana koa no nisongadinan ny tsy fanekena ny fampitana mivantana amin ny TVM sy RNM ny fivoriana satria tamin ny fotoana rehetra nilana izany, tsy nanao ny asa tokony hataony ny haino aman-jerim-panjakana. Noho izany, niangavy ny hialan ny TVM sy ny RNM ny efitrano amin ny alalan ny fanaovana tsangan-tànana ireo Solombavambahoaka ireo. Namaly ny fandraisam-pitenenana tamin ny alalan ny satroka, Andriamatoa Filoha, taorian izay, ka toy izao izany: Araka ny voalazan ny Lalàmpanorenana sy ny Fitsipika Anaty mifehy ny Antenimierampirenena, andininy faha-199, andalana faha-4, fa efa nampahafantarina tamin ny alalan ny taratasy laharana faha an/p ny fisian ny «motion de censure» ny Governemanta ary nisy solotenan ny Praiminisitra sy ny Governemanta ihany koa nanatrika ny «Conférence des Présidents» sy ny «Séance Plénière» nandaniana ny «ordre du jour» tato amin ny Antenimierampirenena. Nahatanteraka ny adidiny izany ny

9 8 Antenimierampirenena. Noho izany, miangavy an Andriamatoa Praiminisitra, ho tonga eto raha ny marina. Momba ny isan ny Solombavambahoaka: miditra sy mivoaka izy ireo, ny sasany aza vao teo no tonga. Hatao ny fanomezana ny isan ny Solombavambahoaka mialohan ny latsabato ary hovakiana ny pitsopitsony mikasika ny modalité de vote. Mangarahara tanteraka ny fifidianana hatao. Momba ny atontan-taratasy amin ny teny Malagasy: efa misy izany ka tokony hozaraina amin ny Solombavambahoaka izay mbola tsy nahazo. Mikasika ny Solombavambahoaka nanao sonia, tokony hatao petadrindrina ny fitsipahampitokisana ary feno ny fepetra matoa tonga amin izao dingana izao. Taorian izay dia niangavy ny haneken ny Solombavambahoaka rehetra ny handefasan ny TVM sy RNM ny fizotran ny fivoriana, Andriamatoa Filoha, satria fanao amin ny fihaonan ny Governemanta sy ny Antenimierampirenena, fanao amin ny fanokafana ary famaranana ny fivoriana izany. Fanampin izay, te-hahita ny fandehan-javatra eto amin ny Lapa koa ny vahoaka. - Tabataba - Teo dia nisy hevitra nifanipaka ka niroso tamin ny tsangan-tànana ny mpivory. Rehefa natao ny tsangan-tànana amin ny hijanonan ny TVM sy ny RNM ato amin ny efitrano fivoriana: - Solombavambahoaka miisa 9 no nanangan-tànana - - Solombavambahoaka miisa 63 no nanangan-tànana - Lanin ny maro an isa fa tsy hampita mivantana ny zava-miseho eto amin ny Antenimierampirenena ny TVM sy ny RNM. Marihana fa nandritr ireo fandraisam-pitenenana ireo dia nampita mivantana izany ny haino aman-jerim-panjakana. Nanomboka teo kosa, notapahana izany fampitana mivantana izany. Nisaotra ny TVM sy RNM, tamin ny fahatongavany teto amin ny Antenimierampirenena, Andriamatoa Filoha, sady niangavy azy ireo ho tonga amin ny fotoana manaraka. Rehefa izany, nambaran Andriamatoa Filoha, fa hiroso amin ny adihevitra ankapobeny ny mpivory. Nomarihiny fa manana dimy (05) minitra isaky ny Solombavambahoaka eo amin ny fandraisam-pitenenana araka ny andininy faha-200, andalana faha-4 ao amin ny Fitsipika Anaty mifehy ny Antenimierampirenena. Nomeny fitenenana ireo Solombavambahoaka nahatonga fisoratana anarana, taorian izay. Nanamafy ny maha zava-dehibe ny motion de censure, Ramatoa NAHARIMAMY Lucien Irmah, satria fanampiana ny Filohampirenena amin ny fanaovana ny pacte de resposabilité

10 9 araka didy navoakan ny HCC ao amin ny article-5 izany kanefa hatramin izao, mbola tsy miroso amin izay foana na efa ho iray volana aza no nivoahan ny didy. Andriamatoa AROSY Namiandrazana François dia naneho ny hagagany raha naheno fa ireo Solombavambahoaka nanongana ny Filohampirenena indray no milaza fa hanampy azy amin ny alalan ny fanaovana an ity zavatra ity. Teo anatrehan izay, nanentana amin ny tsy hanekena ny fitsipaham-pitokisana ny tenany. Nanambara, Ramatoa RAHELIHANTA Jocelyne, fa misy lainga ny zavatra notenenin Andriamatoa Solombavambahoaka teo satria tsy mandeha intsony ny rano notokanana tany aminy farany teo ary zava-bitan ny Tetezamita no notokanan ny Filohampirenena fa tsy ny zava-bitany. Aza mandainga amin ny vahoakanay tahaka izany fa tsy mety. Rehefa tsy mahomby ny fitondrana, aleo esorina. - Tabataba - Andriamatoa TSABOTOKAY Honoré kosa rehefa nandray fitenenana dia mankasitraka ny motion de censure. Nambarany fa tena nanohana ny Filohampirenena sy ny Governemanta i Vohipeno kanefa na indray mandeha aza tsy mbola tany ny Filohampirenena sy ny fitondrana tarihiny. Tsy mbola nisy zavatra vita tany aminy. Noho izany, manova no mety satria tsy mandeha ny asan ny Governemanta any aminay; ny fanaovana an io HIMO io dia taratry ny fahantrana. Manohana ny fitsipaham-pitokisana kosa Ramatoa RALINJANAHARY Valimandresy Tsitohaina satria manjaka any amin ny Distrikany ny tsy fandriampahalemana. Nomarihany fa tsy ampy ny fandraisana andraikitra ataon ity Governemanta ity. Efa mba nangataka fanazavana tamin ny Governemanta ihany izy tao anatin ny iray taona mahery, fa tsy nisy valin-teny mazava azo hatramin izao. Nambaran Andriamatoa RAKOTOMANJATO Rodin Georges fa ny vy tsy mikitrana irery. Ny Solombavambahoaka tsy hoe tezitezi-poana, tsy hoe tsy fitiavana olona, fa hiasa no nifidianana ny Solombavambahoaka, tsy taratra ny fahavononan ny Governemanta. Maro ny Solombavambahoaka nanao sonia ity fitsipaham-pitokisana ity. Nomarihany fa miisa 130 izany. Miangavy ny handaniana an ity raharaha manga ity izahay, hoy izy. Raha nandray fitenenana, Andriamatoa RAHAROARILALA Tinoka Roberto Michael dia nanazava ny antony ankasitrahany ny motion de censure : voalohany, raha nanao évaluation ny Governemanta tarihiny ny Praiminisitra, 94% no réalisation vita; any aminy anefa raha misy dia 4% no vita; ohatra tamin ny kabarin ny Filohampirenena, ny mikasika an i Sakaraha. Projet momba ny rano io ary efa tamin ny andron ny Tetezamita. Aiza anefa amin izao fotoana izao, izay lazaina fa hanaovana «réalisation» lehibe eo. Manaraka, voaroba ny harena; mandry tsy lavo loha ny mponina noho ny tsy fandriampahalemana.

11 10 Maninona no téléguider -na avy any lavitra any ny Solombavambahoaka. Izay no antony tsy anekenay ny TVM. Tsy mety raha avy any amin ny Carlton no hibaiko ny asan ny Solombavambahoaka ato; mbola fanitsakitsahana Lalàmpanorenana izany. Andriamatoa RAZAFIMILY Constance kosa nanamarika fa afaka mi- imposer ny Filohan ny Antenimierampirenena raha misy zavatra tokony hatao na tsy tokony hatao, fa tsy hanao tsangan-tànana amin ny alalan ny démocratie sauvage. Resaka TVM no tiana lazaina amin izany. Manara-maso ny zava-mitranga eto ny any aminay, efa tsy mivantana amin ny fahitalavitra intsony izao resaka atao izao. Tokony hampandeferina ny hambompo satria adihevitra momba ny firenena no atao, izay no itsaran ny vahaoka antsika hoe iza no marina sy tsy marina. Efa niditra tamin ny pacte de responsabilité isika. Tokony hotohizana hatramin ny farany iny vao miditra amin ny fitsipaham-pitokisana isika satria tsy misy afa-po amin ity Governemanta ity. Tokony hisy «remaniement» io Governemanta io noho ny fahamaroan ny tsy mahay miasa ao kanefa mbola tsy tody amin ny «pacte» izay didy navoakan ny HCC isika, izao hiditra amin ny «motion» izay hiteraka krizy indray. Tsy «éthique politique» izany aminay. Tamin ny «déchéance» teo, tsy afeniko fa nifidy an iny aho ary nolazaiko tamin ny Filohampirenena tamin ny fihaonanay taminy izany. Raha hitady krizy hafa, tsy namana amin izay izahay; koa manainga antsika, aza miditra amin ity zavatra ity ny «LEADER FANILO». Nangataka ny mangarahara, Ramatoa KHATY, tamin ny teny nataony voalohany, amin ny hanaovana ny motion de censure amin ny teny malagasy. Aiza ny lisitry ny Solombavambahoaka nanao ny motion de censure, mbola tsy hitanay izany hatramin izao. Iray volana lasa izay, nilokaloka ianareo fa nahafapo ny tatitra nataon ny Praiminisitra. Androany indray, mivadika ianareo hoe tsy ekenay. Voavidim-bola ve ianareo sa ahoana. Tsy ekenay raha tsy misy antony mitombina iampangana ny Governemanta, aleo tohizana ny ezaka efa natomboka. Namaly, Andriamatoa Filoha, fa homena ny dika amin ny teny malagasy izay mbola tsy nahazo izany, ny fandraharahana no hizara azy rehefa avy eo. Ny motion de censure efa mipetraka ao amin ny tabilao raha tsy diso aho, fa ny sonia tsy azo ovaina intsony, any amin ny compte rendu de la séance no hahitana azy. Tsy misy miafina ny momba izany fa eto aminay eto. Taorian izay, nitohy tamin ny fanomezam-pitenenana indray, Andriamatoa Filoha. Ramatoa RATSIVALAKA née RAHERIARIVO Marie Michelle, nanamarika fa matoa matetika mankany Nosy-Be ny Filohampirenena, misy fananany mipetraka any; ohatra ny «Hôtel Ravinala». Rariny raha tsy mankany Sakaraha sy Vohipeno izy. Aoka isika samy hieritreritra hoy Andriamatoa RANDRIARIMALALA Harijaona satria misy kajikajy hafahafa ao ambadik izao zavatra izao. Tsy nandaitra ny déchéance, andao hanao motion de censure indray. Tsy misy fitiavan-tanindrazana intsony fa hanongana foana. Miandrasa amin ny taona 2018 vao manao izany.

12 11 Milaza ianareo fa misy an izao sy izao, rehefa tsy hitan ny maso, aza resahina satria mba fantatray koa ny ataonareo. Efa nisy fantatra anie hoe Ranona no hatao Praiminisitra; misy miady seza. Tsy izay no nifidianana antsika fa hanao lalàna. Aoka izay ny fitiavan-tena. Mamporisika aho ny tsy handaniana an ity motion de censure ity. Nanao satroka Andriamatoa TODY Arnaud, ka nomena fitenenana. Nambarany fa misy zava-miseho hafahafa ao ambadika ao koa ilazao ny EMMOREG fa misy Minisitra mizara vola amin ny 4x4 Prado ; efa lasa any ny mpanao gazety. Fefeo ny barrière sao mitsoaka ireo Minisitra ireo. Misy mizara vola ao antokotany ao, amintsika miteny izao. - Tabataba - Raha nomena satroka, Andriamatoa RANDRIARIMALALA Harijaona, nanambara fa tonga dia tonony ny anaran ny Minisitra manao izany zavatra izany. «Manœuvre dilatoire» izany. Anisan ny hisambotra azy izahay ary hamoaka an-gazety koa raha ilaina izany. Tohizo ny adihevitra, miroso amin ny fifidianana aorian izay, fa aza asiana «manœuvre dilatoire» tahaka izao. Andriamatoa RAZAHA Tondraha, kosa niteny fa tsy mety ny milaza zavatra tsy hitan ny maso tahaka izany; aza manendrikendrika olona. Aleo sorohina ny tsy hisian ny loza. Niangavy ny tompon andraikitra ao amin ny Direction de la Sécurité kosa Andriamatoa Filoha, mba hijery ny resaka fandriampahalemana eto amin ny Lapa. Nanambara, Andriamatoa FAMINDRA Justin, fa sao mbola tsy tapa-kevitra amin ny latsabato tokony hatao ny mpivory. Aleo milaza rehefa tsy tapakevitra satria zavatra roa izay no niseho teo: resaka TVM sy RNM no voalohany, izao indray lazaina fa misy Minisitra mizara vola. Izay no faharoa. Fahotana mahafaty ho azy ireo ve no tonga eto hanatrika ny lanonam-pamaranana. Nilaza, Ramatoa KHATY, fa tsy tokony hisy ity latsabato ity satria efa tsy nety hatrany amboalohany izany. Manœuvre dilatoire izao atao izao. Oviana no hidiana lakile ny «porte principale»? Maro no tsy mety amin izao zavatra hatao izao. Vote no hatao, firy no isan ny mpifidy? Inona no modalité de vote? Namaly ny fanontaniana, Andriamatoa Filoha, ka nilaza fa ny mangaraharaha no hatao. Misy lisitra eto, ka lisitra misy ny anarantsika no lisi-pifidianana. Alohan ny hirosoana amin ny vote, tsy maintsy lazaina ny pitsopitsony mikasika izany zavatra izany. Misy liste électorale homarihin ny Solombavambahoaka mifidy. Aleo hivoha ny trano satria azon ny besinimaro atrehina ny fifidianana hatao.

13 12 Nitohy indray ny fandraisam-pitenenana taorian izay. Naneho ny alahelony, Ramatoa RAZAFINDRAKOTO Harifanja Francette, rehefa nandray fitenenana. Nahazo messages maro be izy milaza fa te-hahita ny zava-mitranga ny vahoaka. Nanasa ny Governemanta hanatrika ny lanonam-pamaranana isika; olona tonga ato amin ny Lapa ve no endrikendrehina fa mizara vola? Raiamandreny ianao, Andriamatoa Filoha, ka mijoroa amin ny maha Raiamandreny anao. Rehefa fivoriambe, malalaka ny vavahady maninona no tsy avela hiditra ny «assistant». Aoka ianareo tsy hitanila. Inona no atahorana ny mangarahara, avelao hiditra ny olona, avelao handeha ny haino aman-jery hahitan ny vahoaka izay tena marina. Namaly, Andriamatoa Filoha, fa gaga amin izany hoe fitanilàna resahina izany. Fahapahankevitry ny besinimaro no natao teo fa tsy fijerena hoe Ranona sy Ranona. Manaja ny Solombavambahoaka rehetra aho hoy, Andriamatoa Filoha, omena fitenenana izay rehetra te-hilaza ny heviny. Noho izany, tsara raha mba asiana fandanjalanjana ny resaka atao. Nanazava, Andriamatoa Filoha, fa efa nanome toromarika ny Lehiben ny fandriampahalemana ato ary ireo manatrika ireo ny Minisitra fa tsy noroahina izany, izay mbola ho avy aza horaisina an-tànan-droa. Nakatona ny varavarana mba tsy ho voahitsaka ny «tapis rouge» satria ho tonga eo, hono, ny Praiminisitra ary ho fanajana azy izany. Andriamatoa MAMANGY Norbert, nanambara fa hirahira no mandeha amin ny TVM amin izao fotoana izao. Malahelo ny olona amin ny tsy fandefasana mivantana ny zava-misy eto. Mampalahelo ny zava-niseho teo, nisy fanenjehana amin ny tsy antony, tsy misy porofo. Tokony hahay handanjalanja ny Solombavambahoaka amin ny zavatra tahaka itony sao miteraka zava-doza. Miangavy anao hitarika amin ny maha Raiamandreny anao, Andriamatoa Filoha. Nanamarika Andriamatoa ANDRIANTSIZEHENA Benja Urbain, fa mampalahelo ny zava-nisy teo satria misy Solombavambahoaka manakorontana, mampiely tsaho fotsiny, fanasana no alehan ny Minisitra eto kanefa anaovana tahaka ireny. Raha tany ivelan ny Lapa no nisy an iny, fitsaram-bahoaka no niafarany. Ho modely no nifidianan ny vahoaka antsika ka tokony haseho izany. Nanamarika, Andriamatoa RABENIRINA Jean Jacques, fa nisy ny zava-niseho teo. Efa nisy baiko nomenao ho an ny mpiandraikitra ny filaminana, anjarany no mandamina an izay. Tokony hiompana amin ny mpomba na mpitsipaka ny motion de censure amin izay ny fandraisam-pitenenana manaraka eo.

14 13 Andriamatoa MARA Niarisy, nanambara indray tamin ny fandraisam-pitenenany, fa zon Andriamatoa Filoha no manapaka fitenenana rehefa mihoatra ny zavatra tokony hotenenina amin ity motion de censure ity ny resaka. Raha ny marina, efa débat général no atao amin izao. Rehefa izay no atao, misy ny mpanohana, misy ny mpitsipaka an ity «motion de censure» ity. Izay no tokony ho resaka atao. Miroso amin ny latsabato rehefa tapitra izay. Misy resaka diso momba ny TVM eto, aza ovaina hoe te-hahita anay ny vahoakanay; tsy mety izao. Tsy izay no nahatonga ny TVM nesorina teto; aza disoina ny resaka. Izahay aza efa nangataka hatry ny ela amin ny fandefasana mivantana ataon ny TVM sy RNM io nefa tsy nataony izany. Droit de réponse no marina fa tsy izay eritreretinareo izay. Tamin ireny «déchéance» ireny, efa tokony nisy «débat contradictoire» natao ho an ny mpanohana sy ny mpanohitra; teo no nisian ny «traitement inégalitaire» tamin izay fotoana izay. Aza disoina hoe tsy tia TVM sy RNM izahay. Raha izay no atao, hivaona isika; manjary tsy hifidy eto no iafarany, lasa misy manœuvre dilatoire amin izay fotoana izay. Rehefa avy eo, hiditra amin ny fanazavana aho hoe inona no antony anohananay ny motion de cesure eto. Ramatoa RASOANOROMALALA Marie Horace, kosa nanambara fa mitovy hevitra amin Andriamatoa MARA Niarisy teo; tokony tsy hiverina intsony ny resaka TVM satria tsangan-tànana no nanaovana izany ary lanin ny besinimaro. Ramatoa RAHERISOA VOLOLONA Victorine, rehefa nandray fitenenana, nilaza fa «affirmation gratuite» ny zavatra sahala amin ireny. Miala tsiny, Andriamatoa Minisitra MAHARANTE Jean de Dieu, fa voatonona tao ny anaranao hoe tonga hizara vola ato amin ny Antenimierampirenena. Tapitra ny fanaovana satroka manaraka ka niditra tamin ny adihevitra amin izay ny mpivory. Andriamatoa RATEFIARIVONY Jaona, nanamarika fa tsy gaga raha mandalo eto amin ny Antenimierampirenena ny motion de censure tahaka izao. Ny latsabato ihany no hamaritra azy, hoy izy. Anisan ny manohana ity motion de censure ity ny tenany. Rafotsibe leom-boan anana izahay ka tsy tia zava-boribory intsony. Ny antony: raha mbola misy Governemanta ka tsy mahavaha ny olana any aminay momba ny insécurité satria mijaly tanteraka izahay amin ny fahafatesan ny olona noho ny asan-dahalo, izany ve no hiandrasana 100 andro impiry indray. Raha misy Governemanta ka tsy manao ny lalana RN33, route de chrome, kanefa vola be no ampidirin ny orinasa momba izany; nahoana no tsy misy miverina any aminay akory. Mitady Governemanta hijery anay izahay; izay no antony. Hatramin ny taona 2013, tsy mbola nandray vola ny Sefom-pokontany. Iza no tompon andraikitra amin izany, nankaiza ny volan ireo olona ireo. Manentana anareo hifidy an ity motion de censure ity ny tenanay.

15 14 Andriamatoa MARA Niarisy, raha nandray fitenenana, nilaza fa ny fandrosoana any amin ny Faritra no andrefesana ny zava-bita. Mety hisy hamaly hoe ao anaty fotoana fohy ve no hahavitana izany, avelao hiasa ny Governemanta. Volonté politique ho an izay mitondra eo no tadiavina mba hihenan io asan-dahalo io any amin ny 80% any. Tsy hoe rehefa mirongatra ny halatra vao hanao opération. Antony iray andravana ny Governemanta izany. Angatahana ny namana mba hifidy an ity zavatra ity satria tsy mahavita azy ny Governemanta amin izao fotoana izao. Manaraka, resaka JIRAMA: saika tsy mandeha izany manerana an i Madagasikara; na inona fanazavana hoe ny teo aloha no nanao an io, aleo tsy ravana izy raha izay no teninareo, fa tokony hitondra fanovàna ianareo. Tsy misy ezaka ataon ny Fanjakana amin ny fanarenana ny JIRAMA. Tsy mety diso ny Fanjakana fa ny mpiasa ihany no diso raha miteny ny zavatra mahory azy. Nisy namana nilaza teo fa mbola tsy vita ny pacte de responsabilité, iza no diso tamin io ; ny fitokanana ataon ny Filohampirenena amin izao anie ka zava-bitan ny teo aloha daholo, fa fitohizan ny asam-panjakana no misy, izany no antony anaovany fitokanana. Avy hatrany, Andriamatoa MAMANGY Norbert dia nanambara fa manohitra ity «motion de censure» ity. Ny taratasy manazava ny fitsipaham-pitokisana ihany no anoherana izany. Momba ny vonjy voina: lazaina fa maro ny Malagasy maty, tsy hita ny fahombiazan ny Governemanta. Tamin ny fandalovan ny rivo-doza Kamisy sy Gafilo, maro ny zava-niseho; tsy nisy filazana hoe tsy nahomby ny mpitondra ka andao hesorina. Momba ny tsy fandriampahalemana: tsy ity Governemanta ity no nampisy ny dahalo, fa efa nisy hatry ny ela. Tsy nisy niteny hoe andao hesorina ny mpitondra. Karaman ny CT, voaroba tetsy akaikintsika tetsy aza tsy nisy nilaza hoe andao hesorina kanefa teto daholo ny CT. Nahoana no tsy nampadalovina tato izany raharaha izany satria nisy Praiminisitra koa tamin izany. Momba an-dremenabila: avy any aminay ny Praiminisitra tamin izay fotoana izay; nahoana no tsy nantsoina teto izy. Tsy ny Praiminisitra no nahatonga ny «insécurité» fa efa nisy ela io. Noho izany, misy zavatra tiana ahatongavana ao ambadik izao. Ny fahantrana: zavatra efa ela no nisian izany fa tsy vao ny mpitondra tamin izao no nahatonga azy. Eo anatrehan izany, mitaona ny Solombavambahoaka namana hitsipaka ny motion de censure fa tsy fotoanany izao. Rehefa nomena fitenenana, Andriamatoa REBENIRINA Jean Jacques, nanasongadina fa ny fihatsaran ny fiainam-bahoaka no mari-drefy andrefesana ny fahombiazan ny mpitondra eran-tany. Izay no indicateur de performance ho an ny fitondrana rehetra. Inona no zavatra nihatsara tamin ity Repoblika faha-iv ity.

16 15 Azafady, niteny daholo ianareo teo nihaino izahay. Milaza ianareo fa fitopolo no isanareo mitsipaka ny motion ; tsy ho lany izany izy ity raha izay no fandehany. Mbola hifidy isika, ka ho hita eo ny vokany. Momba ny Air Mad : iarahana mahita fa lava reny ny fitokonana ataon ny mpiasa ao ary hatramin izay, tsy nisy pilote nogadraina izany. Hitokona daholo ny rehetra vao hitady vahaolana ve ny mpitondra; tsy izany. Izay no indicateur de performance hitan ny olona. Tandindonin-doza ny Demokrasia eto amintsika satria tamin ny «Conseil des Ministres» farany teo, nisy ny vague d affectation ho an ireo Lehiben ny Distrika miisa 30 any ho any, anisan izany ny tany aminay. Ny antony: tsy nanaiky nametraka ny kandida HVM izy ireo ka tsy maintsy soloina. Manarak izay, nametraka ny statut de l Administrateur Civil fa tsy maintsy izy ireo no mitantana ny Distrika, tsy ampy ny isany ka olona hafa no napetraka amin izany toerana izany, hampandany ny kandida HVM amin ny fifidianana Ben ny Tanàna ho avy izao. Mikasika ny LFR natolotra: raha tsy diso izahay, «18 milliards d Ariary» no transfert ho an ny CTD; ny «15 milliards d Ariary», lany amin ny karaman ny Filohan ny Fokontany; «3 milliards d Ariary» sisa no subvention des Communes eran i Madagasikara. Mbola tohananareo ihany ny Governemanta amin izany satria vitan io mari-bola io ny zavatra rehetra any amintsika. Hifidy isika, raha lany ity: veloma ry Governemanta; raha tsy lany kosa mipetraka eo ihany ianareo. Mbola ho lany izahay amin ny manaraka ary hihoatra an iny 57% nahalany anay teo iny izany. Tokony haka lesona amin ny Père Pedro ny mpitondra satria tsy nisy zavatra niaingany kanefa afaka mamelona olona aman alina izy amin izao fotoana izao. Tsy misy Banque Mondiale na FMI izany ao aminy kanefa io no zava-bitany. Nilaza avy hatrany, Ramatoa RAZAFINDRAKOTO Harifanja Francette, fa manohitra tanteraka ity motion de censure ity satria tsy fotoanany izao, na dia ekena aza fa maro ny zavatra mbola tsy vitan ny fitondrana. Mbola tsy misy stabilité politique amin izao. Mora ny mandrodana fa sarotra ny manangana. Ekena fa maro no tsy vita, hoy izahay, kanefa misy koa ny fanakorontanana. Izay no antony tsy ahavitana zavatra eto amintsika. Misy ny tsy fandriampahalemana ary tena nirongatra izany tamin ny andron ny Tetezamita sy hatramin izao. Efa mandeha ny fifampiresahana, aleo andrasana ny vokatr izay; aorian io ho hita izay hatao. Momba ny resaka rivo-doza: niaraha-nahita fa nanao izay vonjy voina faran izay tratra ny fitondrana. Tsy misy zavatra vita indray mipi-maso izany. Noho izany, manainga antsika mba hitsipaka ity motion de censure ity satria mbola mijaly ny vahoaka ary efa nisy ny fihaonana momba ny hanaovana ny pacte de responsabilité amin ny Andrimpanjakana izay misy eto amintsika.

17 16 Ramatoa RAHANTANIRINA Lalao kosa nilaza avy hatrany, fa tsy ho lava resaka satria efa tehifidy. Any ivelany no tokony hanao tora-po ho an ny Minisitra izay te-hanao izany satria mandeha ny fotoana. Milaza fa mahavita zavatra ny Governemanta fa raha vao tsy HVM, tsy fantatra intsony atỳ aoriana na nifampitondra toy ny mpianadahy aza. Ny antony andravana ny Governemanta, raha aminay, tsy mahavita azy; maro koa ny Minisitra te-hanao fampielezan-kevitra mialoha sahady ary manaratsy ny Solombavambahoaka any amin ny faritra misy anay. Ny Governemanta mijery an izay neutralité izay no tokony hajoro raha ny fijerinay ny toe-javatra misy amin izao fotoana izao. Manoloana izany, manainga ny namana rehetra mba hifidy ny «eny» satria hita fa efa tsy mahavitazy intsony izao Governemanta izao. «Motion de censure» indray no malaza hoy, Ramatoa RAHARIMALALA Marie Lydia, raha vao nandray fitenenana. Tsy nahomby ny requête de mise en accusation natao tamin ny Filohampirenena; alefa indray ny motion de censure ho an ny Governemanta izay vao 15 volana no niasany. Ny zavatra nahagaga, rehefa nandalo teto ny Praiminisitra, tsy nisy nitsikera ny programa natolony fa fisaorana no natao azy. Dia gaga ianao, hoy izay olona izay. Aiza no tiana ahatongavana. Misy efa te-hitondra sahady ve isika ato. Andraso ny tour -nareo; tsy fahotana izany satria tany demokratika isika. Izay minia tsy mijery no tena jamba: taiza no nisy teto amin ny Firenena ka nampiditra mpampianatra FRAM miisa indroa miatoana. Izao fitondrana izao no nanao an izany. Maro ny filazana teo fa zava-bita tany aloha na tamin ny andron ny Tetezamita no tokanana amin izao fotoana izao; lainga izany ary raha momba ny Air Mad, efa tamin ny volana Aprily 2011 no efa nisedra an io olana io, fa nahoana rehefa handroso izy no atao tahaka an io satria tokony ho tonga ny mpizahatany amin izao fotoana izao. Malahelo izahay ary mahatsapa fa hisy hosoka ny zavatra hatao eto. Raha ny hevitry ny mpitondra no jerena, tokony efa niala isika raha izao no izy. Ambara eto fa nangataka fihaonana tamin ny Filohampirenena ny Filohantsika; noraisiny soa aman-tsara, avy eo anefa motion indray no eritreretina. Arosoy ny fifidianana, fa raha ny isantsika amin izao aloha, mbola tsy ampy 102. Tsy matahotra fifidianana izahay, sa hanao hosoka indray ve. - Tabataba - Nametraka fialan-tsiny, tamin Andriamatoa Filoha, Andriamatoa RAZAHA Tondraha, rehefa nandray fitenenana noho ny zava-niseho teo aloha ary nanindry amin ny tokony hisian ny fifanajana eto amin ny Lapa.

18 17 Rehefa misy tiana hatao, tsy maintsy hita ny kilemany. Izay no teninay manoloana izao motion de censure izao satria izay mitondra eo, tsy hisy ho tonga lafatra izany. Momba ny vonjy voina: aminay ao Toliara I, maro no vitan ny Governemanta tamin ny famonjena ny vahoaka. Tafarina ny sekoly rehetra ary vao notokanana izany. Tamin ny programa natolotry ny Praiminisitra teto, tsy nisy Solombavambahoaka nilaza fa tsy nety izany. Ny dikan izay, miandrandra ny fanatanterahana ny programa natolotra teto ny vahoaka Malagasy ary tafiditra amin izany ny PIC 2 izay azon i Toliara. Fampandrosoana no iheveranay an izany. Hatao ny fifidianana; mila mazava ny isantsika alohan ny hanaovana izany. Miangavy ny Huissier izahay hijery hoe manaraka procédure ve ny procuration nomena sa tsia. Miangavy ny andaniny sy ankilany koa samy hanana solotena eny aloha, mba hampisy ny mangarahara rehefa miroso amin ny fifidianana isika. Andriamatoa RAMAHERIJAONA Hajanirina Lanto, nanambara fa tsotra ny azy: efa samy nilaza ny heviny na ny mpanohana na ny mpitsipaka izao motion de censure izao. Kabary zato, teny arivo, fa ny marina tokana ihany. Raha nahay nanetry tena ny Governemanta hoe 30% no zava-bita tao anatin ny 100 andro, mety mba nanaiky izahay; nidoka tena hoe 94% anefa ry zareo. Inona ity laingalainga ity, lasa tsy matoky azy ny tenako. Noho izany, hanampy ny Filohampirenena ity motion de censure ity handravonany izay zavatra tsy mety. Ampio izahay hanohana ity zavatra ity satria Governemanta tsy mahavaha olana no misy amin izao. Tsara noho ny pacte de responsabilité ity, «coup de main» ho an ny Filohampirenena ny fanaovana azy. Manohana tsy misy fepetra ny «motion de censure», Ramatoa VOLAHAINGO Marie Thérèse ary hanao «eny» amin ny latsabato. Izay no voalohan-teniny. Ireto antony manaraka ireto no anaovana izany : nahazo «message» hoe tongava atỳ amin ny Solimotel ; tongava atỳ Tsiadana; tsy nandeha izahay. Faharesen-dahatra no anohanana ny «motion de censure» satria tsy misy fanjakana mitodika any aminay mihitsy. Fanaratsiana Solombavambahoaka no natao tany Bealanana fa tsy fampandrosoana. Izay no nataon ny Minisitra mpiahy ny Faritra Sofia rehefa nandalo tany taorian ny déchéance natao tamin ny Filohampirenena. Voarara tsy hiteny ny Solombavambahoaka tamin ny 26 Jona kanefa izaho no niantoka ny omby novonoina, ny fanamafisam-peo nanaovana kabary sy ny hafa koa. Izay no baiko avy amin ny Minisitry ny Atitany: tsy mahazo mikabary ny Solombavambahoaka. Tonga tany Antsohihy ny Filohampirenena nitokana ny zava-bitan ny teo aloha, nizara motos ho an ny délégués izay mpanararaotra fahefana amin ny alalan ny bokin omby na FIB. Noho izany manohana ny motion de censure ny tenanay ary mitaona ny namana satria nisy baiko nomena hoe: tsy maintsy mandany Maire avy amin ny HVM 50% ny Faritra Sofia ary izay Lehiben ny Distrika tsy mampandany dia hesorina. Izany no zava-misy.

19 18 Nanamarika, Andriamatoa FAMINDRA Jusitin, fa na amin ny firy na amin ny firy no hifandresy lahatra eto, efa samy manana izay zavatra eritreretiny ao an-dohany avy ny tsirairay. Koa mangataka izahay, ataovy ao anaty urne ny fanapahan-kevitra farany. Mangataka ny handaminanao an-tsakany sy an-davany ny raharaha hatao eto, Andriamatoa Filoha, satria tsapa ny fisian ny korontana. Amin ny maha Raiamandreny anao no iangavianay an izany. Manaraka, tsy resy lahatra loatra hoe tsy mahavita zavatra ny Governemanta. Vao 5 volana no nipetrahany teo ve no itsarana azy ho tompon andraikitra amin ny tsy fivahan ny asandahalo. Zavatra hita manerana izao tontolo izao ny tahaka an io. Marina fa andalovan ny rivo-doza eto Madagasikara ; maro ny fahafatesana aterak izany hatramin izay. Vao 5 volana ny Governemanta no teo; izany ve no itsarana azy hoe tsy nahavita zavatra, fa ireo teo aloha nanao ahoana. Aleo atao ny latsabato fa efa samy manana ny heviny ary izay ihany no tsotsori-mamba isarahana. Vao nandray fitenenana, Andriamatoa ANDRIANTSIZEHENA Benja Urbain dia nilaza fa tsy resy lahatra amin ity motion de censure ity ny tenany. Ny antony: vao iray volana mahery kely ny Praiminisitra no nandalo teto nanolotra ny programan asany; azo isaina amin ny ratsan-tànana no nanankiana ny fanolorany izany. Manaraka, amin ny maha Filohan ny Vondrona Parlemantera VPM-MMM II anay, tsy nisy fifampiresahana taminay ny famolavolana an ity motion de censure ity. Amin ny maha mpanao politika, tsy mpanara-drenirano na mpihinana amam-bolony izahay; izay no mahatonga anay tsy resy lahatra amin ny fanaovana ity motion de censure ity. Izay no mahatonga anay milaza, mitovy hevitra amin ny namana LEADER Fanilo hoe misintona ny saintsika handinika lalina ary mitaona antsika hitsipaka an ity fitsipaham-pitokisana ity. Iarahantsika mahalala ny didy navoakan ny HCC amin ny hisian ny tokony fifampiresahana mba hisian ny stabilité eto amintsika. Fanampin izay, mitondra ny tenin ny Solombavambahoaka avy amin ny grand Sud-Est izahay, fa mitsipaka ity motion de censure ity. Anisan ny masontsivana azo itsarana ny Governemanta, hoy Andriamatoa VELONTSARA Paul Bert, ny lafiny tsy fandriampahalemana. Mbola tsy nahita Governemanta tsy mahay mamaha olana izany izahay hatramin izay. Raha mitokona ny «Air Mad», ny «Trésor», ny «Université», ny «Inspecteurs de Travail» ary ny «Greffiers» ; ny vahaolana hitany, fanagadrana mpiasa, fandroahana mpiasa. Baomba no vahaolana omen ny Governemanta. Hita tany amin ny Distrikanay, hita teto Antananarivo tamin ny fiarovana ny Solombavambahoaka namanay ny fampiasana baomba. Hovonoina amin ny baomba ve ny vahoaka Malagasy. Tokony hisy fepetra horaisintsika Solombavambahoaka eo anatrehan izany.

20 19 Andriamatoa RAZAFINTSIANDRAOFA Jean Brunel, teo ampandraisana fitenenana dia nanamarika fa hizara roa ny teny hataony; ny voalohany amin ny maha Solombavambahoakan Ikongo azy, aorian izay amin ny maha Filohan ny Vondrona Parlemantera MAPAR azy. Nanamafy izany, Andriamatoa Filoha, fa mbola manana 15 minitra tokoa ny Filohan ny Vondrona Parlemantera tsirairay avy aorian ny fandraisam-pitenenan ny Solombavambahoaka. Nitohy tamin ny fandraisam-pitenenany, Andriamatoa RAZAFINTSIANDRAOFA Jean Brunel ary nanambara fa efa maro ny antso natao tamin ny fitondrana. Ren ny Malagasy rehetra fa mihady volamena ao Manapatrana ny Sinoa, tsy misy fandraisana andraikitra hatramin izao avy amin io fitondrana io. Mety miray petsapetsa matoa tsy mandray fepetra. Azo raisina ohatra koa ny fandalovan ny «cyclone» farany teo tao Ikongo, izay nahafatesana olona maro indrindra raha ny teto Madagasikara; tsy nisy ny fanarenana natao tamin io Distrika io hatramin izao. Nankasitrahana, hono, ny Praiminisitra tamin ny fandalovany teto; ho anareo izany fa tsy ho anay. Raha namaky ny programany aho, tsy tafiditra ao ny fanamboarana ny lalana RNT14-A mampitohy an Ifanadiana sy Ikongo, lasa mitoka-monina ny faritra maro noho izay antony izay. Tsy misy fandalovan ny mpitondra, na Filoha na Praiminisitra na ny mpikambana ao amin ny Governemanta mihitsy tany Ikongo hatramin izay, tahaka ny mahazo an i Bealanana. Vao telo herinandro teo angamba, nandalo tany ny Minisitry ny Fiompiana; tsy hitondra fampandrosoana fa fanolorana kandidan ny HVM no nataony ary nasainy nesorina ny akanjo misy ny sariko vao nety niteny tamin ny vahoakanay izy. Lasa niboridana ny ankabeazan ny olona nanatrika teo. Manamarika ny tenako, hoy izy, fa tena fady any aminay ny mampiboridana olona amin ny andro mazava. Tena tsy fanao any aminay ny zavatra tahaka izany. Tsindriako fa Antagnala aho vao lasa mpanao politika. Tsy mandefitra amin ny zavatra natao tamin ny havako aho na lany na tsia ity motion de censure ity. Asio fahendrena ihany ny zavatra ataonareo mpitondra fa tena tsy mety izany. Momba ny Lehiben ny Disitrikanay: efa ela no niasany tao, laniny ny volan ny Sefompokontany, laniny ny subvention -n ny Kaominina; ny karaman ny mpiasan ny Disitrika, alainy izay tiany alaina, ny Maire kasihiny tànana. Nangataka ny fanesorana azy izahay, nesorina tokoa izy; amin izao naverina indray. Inona no antony, ianareo nametraka azy no mahalala izay. Andriamatoa RANDRIANANDRAINA Théophile Christian kosa nilaza fa na mpinamana aza, ny raharaham-pirenena tsy ananan-kavana ary ifandimbiasana ny toerana. Mampalahelo fa anisan ny Solombavambahoaka niatrika fetim-pirenena ny tenako; tsy nahazo niteny aho tamin izany fa nisy «message» nandrara satria tsy mitovy firehana politika amiko ny «Préfet de Région». Izany ve no ifampitondrana amin ity tany ity. Hanova no nametrahana anareo eo fa tsy hanaraka ny tsy mety nisy teo aloha.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA TATITRA ANIVON NY ANTENIMIERAM- PIRENENA Praiminisitra Jean RAVELONARIVO 1 TATITRA MANOLOANA NY ANTENIMIERA I 21 MAY 2015 21 MAY 2015 Andininy 54.- Ny Filohan ny Repoblika no manendry ny Praiminisitra

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

Noely 2009 Taom-baovao 2010

Noely 2009 Taom-baovao 2010 FMM Fiombonana Miara-mivavaka eto Münich. Noely 2009 Taom-baovao 2010 Fa Zaza no teraka ho antsika, Zazalahy no omena antsika, ary ny anarany atao hoe Mahagaga, Mpanolon-tsaina, Andriamanitra Mahery, Rain

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

LANY TAMINGANA ETO AMINTSIKA

LANY TAMINGANA ETO AMINTSIKA cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar HUMBOLDT-UNIVERSITÄT ZU BERLIN Landwirtschaftlich-Gärtnerische Fakultät Schriftenreihe des Seminars für Ländliche Entwicklung VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE -----------------------

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- MINISTERE DES TRANSPORTS ET DE LA METEOROLOGIE -------------- RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- I. CONTEXTE Malgré

Plus en détail

JEAN-MARC CHÂTAIGNIER Défenseur de Joaquim Chissano

JEAN-MARC CHÂTAIGNIER Défenseur de Joaquim Chissano cyan magenta jaune noir PROGRAMME P.7 QUOTIDIEN GRATUIT D INFORMATION N 0103 DU Vendredi 16 Juillet 2010 L accès sans peine à l information OIF SOATOAVINA TRAFIC Soutien de la médiation internationale

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

MpANAMORY RAdO RABARILALA

MpANAMORY RAdO RABARILALA ENIM-BOLANA TSY TAFATSANGANA FANJAITRA MIISA 21 NO NESORINA TAO AN-KIBON i LALAINA P.06 N 3190 L u n d i 2 9 j u i n 2 0 1 5 PRIX : Ar 400 zatovolahy NANGALATRA volamena P.06 TENY AM-pASANA : NANONOFY

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

Ny Vaovao Mahafaly. La Bonne Nouvelle

Ny Vaovao Mahafaly. La Bonne Nouvelle Ny Vaovao Mahafaly La Bonne Nouvelle Ary tamin ny fahenim-bolana dia nirahin Andriamanitra ny anjely Gabriela ho any an-tanàna anankiray any Galilia atao hoe Nazareta, ho any amin ny virijina anankiray,

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

DISPOSITIONS COMMUNES

DISPOSITIONS COMMUNES ORDONNANCE N 62-074 du 29 SEPTEMBRE 19 62 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics. ( J.O. n 248 du 12.10.62 p. 2248 ) modifiée et complétée

Plus en détail

FANILO MIAMPITA. TÉLÉPHONIE FIXE La honte. Encore sous le monopole Après le drame libanais, voilà que resurgit

FANILO MIAMPITA. TÉLÉPHONIE FIXE La honte. Encore sous le monopole Après le drame libanais, voilà que resurgit cyan magenta jaune noir PROGRAMME P.7 L accès sans peine à l information QUOTIDIEN D INFORMATION GRATUIT N 080 DU Vendredi 18 Juin 2010 AFFAIRE LILA FANILO MIAMPITA TÉLÉPHONIE FIXE La honte TONGA NY ORA

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

d une solution malgachomalgache

d une solution malgachomalgache cyan magenta jaune noir PROGRAMME P.7 ECONOMIE TRANSITOIRE FANANAN-TANY DECHETS URBAINS Interventionnisme critiqué BIRAO FOTOTRA A VALORISER L inaccessibilité aux intrants notamment aux engrais induit

Plus en détail

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. "Dieu qualifie ceux qui sont appelés", hoy Rakotolehibe Mamy, Talen ny FMMB

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. Dieu qualifie ceux qui sont appelés, hoy Rakotolehibe Mamy, Talen ny FMMB Taniketsa - Laharana faha 58 - Septambra 2014 1 Gazetin ny Sampana Sekoly Alahady FJKM Andrainarivo Taniketsa Miseho isan-telo volana. Laharana faha 58. Septambra 2014. Vidiny: 400 Ariary. Tranokala: www.sa-andrainarivo.mg

Plus en détail

AMBATONAKANGA SY NY MISIONERA ;

AMBATONAKANGA SY NY MISIONERA ; AMBATONAKANGA SY NY MISIONERA ; Raha miteny hoe Ambatonakanga isika protestanta amin izao andro ankehitriny izao dia ny trano fiangonana vita amin ny vato no tonga ao an-tsaintsika voalohany ary vitsy

Plus en détail

Conversations en ligne : descriptions, perspectives. Louise Ouvrard

Conversations en ligne : descriptions, perspectives. Louise Ouvrard Conversations en ligne : descriptions, perspectives Eléments théoriques La variation Quelques caractéristiques du discours électronique La langue malgache Le corpus Présentation Analyse Quels apports à

Plus en détail

M o t d u P rov i n c i a l Temps de grâces

M o t d u P rov i n c i a l Temps de grâces Mot du Provincial Temps de grâces Plusieurs événements de la province et de l Église à Madagascar constituent nos sources d action de grâce à adresser au Seigneur. La visite fraternelle et édifiante du

Plus en détail

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES DEPARTEMENT INTERDISCIPLINAIRE DE FORMATION PROFESSIONNELLE COMMUNICATION ET DYNAMIQUE LOCALE RAPPORT

Plus en détail

N 015 DU 27 mars 2010 ceni Neutralité introuvable La CENI est chargée d une difficile

N 015 DU 27 mars 2010 ceni Neutralité introuvable La CENI est chargée d une difficile QUOTIDIEN D INFORMATION GRATUIT N 015 DU 27 mars 2010 ceni Neutralité introuvable La CENI est chargée d une difficile L accès sans peine à l information mission, celle de garantir la transparence BUSINESS

Plus en détail