De la ferme à l usine

Dimension: px
Commencer à balayer dès la page:

Download "De la ferme à l usine"

Transcription

1 ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme à l usine Le voyage du lait

2

3 L édito NY SOATOAVINA MAHA SOCOLAIT LES VALEURS DE SOCOLAIT N iresaka taminareo ny amin ny fiovana aho,ka anisan ny teboka tsy maintsy andalovan izany fiovana izany dia ny famoahana ity gazetintsika ity,izay nampitondraina ny anarana hoe SOCO SERA Manararaotra ity matoandahatsoratra ity aho mba ampitana aminareo ny soatovina maha SOCOLAIT izay natao ho fitaratra eo amin ny fitondrantena sy fomba fiasa amin ny andavanandro. Ireto avy izy ireo : Orinasa mitsinjo ny mahaolona Fanajana ny mahaenao anao Famoronana makany amin ny tsaratsara hatrany Ny orinasa mitsinjo ny mahaolona dia maneho amin ny fomba fiasany mazava isanandro fa ny tombontsoa ara toe-karena dia afaka miaradalana tsara amin ny tombontsoa ara tsosialy.ohatra amin izany ny fiarahantsika miasa amin ireo mpanangona ronono sy ny mpiompy.ao koa ny fepetra apetrantsika amin ireo mpamatsy fanomezantsiro natioraly,ny tsy maintsy ampiasan izy ireo ny lavanila avy eto Madagasikara.Hasehontsika foana fa tsy maintsy vitantsika izany fampiarahana tombontsoa sy ny fametrahana fepetra izany..ny fifampitokisana izay nosoniaviko ary natao peta-drindrina momban ny fanarahampenitra HACCP/9001,22000,14001 dia porofon izany fahavononana izany. Ny fanajana ny maha-ianao anao dia midika hoe fisafidianana hanana toetra mahay manaja tena sy ny manodidina amin ny fiainana andavanandro.izany fanajana izany dia fitambaran ny fametrahana fitsipika amin ny fomba fiasanao manokana na koa rehefa miaraka amin ny hafa mba hahamora ny fanatrarana izay tanjona napetraka. Raha tsorina izany dia io no endrika fanajana ny tena sy fifanajana amin ny samy mpiaramiasa ary indrindra ny fanajana ny orinasa iasanao. Raha iresaka momban ny famoronana indray isika dia mamela ahy ianareo hindrana ny tenin ity olona iray izay anisan ny olon ny fandrosoana tao anatin ny sehatr asa misy antsika ity dia tsy iza izany fa Ingahy Antoine Riboud,filoham-panorina ny orinasa DANONE : Ny famoronana makany amin ny tsaratsara hatrany indray dia anisany ary ho anisany lalana mankany amin ny fahombiazana satria io no fampiroboroboana ireo filamatra vaovao aterakin ny famaliana ny filana sy fitakiana vaovao.ireo filamatra vaovao ireo dia ho taratra eny amin ireo entam-barotra na lamin asa na sampan asa na teknolojia vaovao ary indrindra ho hita amin ny fandrosoana ara tsosialy izay fehezin ireo tsena sy orinasa misy. Raha hajaintsika ireo soatoavina voalaza ireo isanandro dia hiavaka amin ny maro isika ary tsy misy sakana intsony hahatongavantsika amin ny tonga lafatra,hanatrarantsika ireo tanjona iombonana ary koa ahafahantsika miaramiaina anaty sehatra mahafinaritra. Mirary anareo hanao fetim-pirenena am-pifaliana aho dia amin ny manaraka indray ary. Nosoratan i / Ecrit par Philippe Penouty (Tale Jeneraly / Directeur Général) C omme je m y étais engagé lors de nos différentes rencontres, je souhaitais vous associer de plus en plus à la vie de SOCOLAIT et à son évolution. Je vous avais parlé de changement, l un des points de passage pour parler des ces changements et la mise en place de ce journal interne, que nous avons décidé d appeler : SOCO SERA. Celui-ci devra nous permettre d échanger sur la vie de l entreprise et de transmettre nos/vos messages à l ensemble d entre vous. Je profite de cet éditorial pour aborder avec vous LES VALEURS de SOCOLAIT qui devront être au quotidien nos références dans nos comportements et actions ; Ces valeurs sont : Entreprise citoyenne, Ethique et Innovation. Etre une Entreprise Citoyenne, c est prendre en compte dans notre activité quotidienne et notre développement, des contraintes liées à l intérêt général (écologie, emploi, éthique, développement durable, commerce équitable,..). L'Entreprise citoyenne montre, par son fonctionnement concret et quotidien, que les finalités économiques et sociales ne sont pas incompatibles. Notre action journalière envers nos collecteurs et les éleveurs et l obligation de nos fournisseurs d arômes naturels de nous fournir exclusivement de la Vanille de Madagascar sont des exemples, nous nous efforcerons à chaque fois que nous serons en mesure de le faire, d imposer ces contraintes. Si j évoque aujourd'hui, entre autres, le souci de l'emploi et de la défense de l'environnement, cela induit que nous prenons en compte effectivement et concrètement pour ce faire les dimensions sociales et environnementales dans nos activités et dans nos relations avec nos partenaires (salariés, clients, fournisseurs et co-traitants, actionnaires ). Les engagements que nous avons signés et affichés, concernant les certifications (HACCP/9001, pour la sécurité alimentaire et pour les normes environnementales) sont une preuve de nos engagements. Avoir de l Ethique, c est faire le choix au quotidien d'un comportement dans le respect de soi-même et d'autrui, c est un ensemble de règles de travail individuel ou en équipe afin de faciliter l atteinte d objectifs. C est aussi une conformité de nos comportements, laissant une liberté des initiatives, pour l atteinte de performances et de résultats dans le respect des personnes, sans exclure la confiance et le contrôle. Plus simplement se respecter mutuellement ainsi que son entreprise. Pour vous parler d Innovation, permettez-moi de citer une personne qui fût un innovateur dans notre profession, au niveau mondial, M. Antoine RIBOUD. «L innovation est une alliance entre recherche, marketing, instinct, imagination, produit et courage industriel» L innovation est et sera une de nos clés de réussite, l innovation c est le développement pour la première fois de nouvelles valeurs grâce à des solutions qui répondent à des nouvelles exigences, des nouveaux besoins ou plus anciens, d'un marché ou d'une société. Ces nouvelles valeurs seront proposées à travers de nouveaux produits, processus, services, technologies ou évolutions sociales, qui seront mises à disposition des marchés et de la société. Comme vous le voyez tous les services sont concernés par l Innovation. Si nous respectons ces valeurs au quotidien, alors nous serons différents et rien ne pourra nous empêcher d aller vers l excellence, d atteindre nos objectifs communs et de vivre ensemble une belle aventure. Je vous souhaite une très bonne fête nationale. A très bientôt! SOMMAIRE EDITORIAL.P.3 DIRECTION COMMERCIALE..P.4 LA COLLECTE DU LAIT...P.5 RESSOURCES HUMANES.P.8 USINE..P.9 QUALITE....P.10 Edité par SOCOLAIT S.A Route Mandaniresaka Antsirabe 110 MADAGASCAR Directeur de publication: Philippe PENOUTY Rédacteur en chef: Doria GIZY Comité de rédaction: Bruno Landrier, Vincent Lucas, Rosa Andriamifidy, Hanitriniaina Raveloarimino, Emmanuelle Rasoarahona Ont collaboré à ce numéro: Hélène Pfeiffer, Jean De Dieu Rakotondranaivo, Bakoly Andrianasolo, Lianala Andrianjatovo, Martin Mahery Régie Publicitaire: SOCOLAIT 3ème étage Imm. DIGITAL Ivandry Antananarivo 101 Tel: Crédit photos: Socolait, Facto Saatchi & Saatchi Impression: Print Express Nombres d exemplaires: 350

4 SOCOLAIT DIA MANDRAY ANJARA NANDRITRA NY FOIRE INTERNATIONALE DE MADAGASCAR (F.I.M) SOCOLAIT ÉTAIT PRÉSENT À LA FOIRE INTERNATIONALE DE MADAGASCAR Ny FIM dia hetsika isantaona lehibe eto amin ny Nosintsika, izay nahafahan i Socolait nampiseho sy nanolotra fanandramana maimaimpoana ireo karazana entana vokariny.teo ihany koa ny fampafantarana ny fisian ny vokatra vaovao hivoaka ato ho ato dia tsy inona izany fa ireo Farilac karazany vaovao be.ankoatran io dia hivoaka ihany koa ny yaourt amin ny endriny vaovao. Ny tranohevan i SOCOLAIT dia nandray mpitsidika marobe, izay noraisiny tao amin ny toerana mahafinaritra namboarina manokana ho an ity hetsika ity. Ireo mpanjifa sy izay ho mpanjifa dia tena faly nahatsapa ny finiavan i Socolait hivelatra amin ny famokarana vokatra manana kalitao tena tsara ary indrindra koa vita sy amboarina eto Madagasikara! La FIM, évènement annuel majeur de la Grande Ile, a été l occasion pour Socolait de présenter et faire déguster l ensemble de la gamme de produits, ainsi que de parler des lancements à venir, à savoir notre nouvelle gamme de Farilac, ainsi que le futur pot de yaourt. Le stand a pu accueillir beaucoup de monde sur un magnifique stand préparé pour l occasion. Les consommateurs et futurs consommateurs sont tous contents de l implication de Socolait dans le développement d une gamme de produits de qualité, et bien sur fabriqués à Madagascar! NY FIARAHA-MIENTAN IREO MPIASA MISAHANA NY VAROTRA LES TEAM BUILDING DE L ÉQUIPE COMMERCIALE Isam-bolana ny ekipa ara-barotra dia midina eny amin ny toeram-pivarotana eny mba hampiroborobo ny varotra,hampitombo ny fampafahantarana ny orinasa,handamina sy handrindra ny fanaparitahana ny vokatra ary indrindra koa hanatsara ny fifandraisana amin ireo mpaninjara ny entana vokarintsika Ao anatin ny fiarahana mahafinaritra, mba ho valin ny ezaka natao dia niaraka nisakafo sy niala hetaheta. Chaque mois les équipes commerciales se réunissent sur le terrain afin de développer les ventes, augmenter la visibilité, organiser la distribution et bien sur être en contact avec nos revendeurs Dans une ambiance chaleureuse, le réconfort après l effort est de rigueur, autour d un petit plat et d un rafraichissement. NY GRANDE BRADERIE DE MADAGASCAR,SEHATRA MAHAZATRA ANKEHITRINY! LA GRANDE BRADERIE DE MADAGASCAR, UNE HABITUDE MAINTENANT! Socolait dia mandray anjara hatrany mandritra ny GBM,efa ho herintaona izao dia nanohana foana io hetsika io isika,anaty tranoheva malalaka no ampisehoana ireo vokatra rehetra SOCOLAIT amin ny vidiny mifanandrify amin io hetsika io. Amin io hetsika io dia mpiasa maro no miara mientana mba hanomezana fahafaham-po ny mpanjifa hajaina Ny fotoanantsika manaraka ary dia amin ny fidiran ny mpianatra indray! Socolait est également présent à la GBM, depuis maintenant 1 an nous soutenons l évènement avec un grand stand proposant les produits Socolait à un tarif préférentiel pour l événement. Cet évènement mobilise beaucoup de monde pour pouvoir satisfaire les besoins de nos chers clients Prochaine édition à la rentrée des classes début septembre! SOCOLAIT MAMORONA HATRANY: HIVOAKA TSY HO ELA NY VOKATRA VAOVAO SOCOLAIT INNOVE : DES NOUVEAUX PRODUITS ARRIVENT Ao anatin ny fihainoana hatrany ny fanirian ny olona sy ny fanomezana fahafaham-po ny mpanjifa : SOCOLAIT dia nanorona sy hivarotra FARILAC karazany vaovao be.ny zanantsika dia ho afaka homena tsiro 7 samihafa izay hanaitaitra ny fahafantarany tsiron-kanina.ny fanomezantsiro izay ampiasaina eto dia natioraly avokoa manaraka ilay hiaka vaovao famantarana antsika hoe :ny tsiro tena izy. Toujours dans une démarche d écoute et de satisfaction du consommateur, Socolait innove et lance une nouvelle gamme de Farilac. Nos bébés vont pouvoir déguster 7 parfums différents et éveiller leur sens du gout. Les aromes sont naturels, suivant notre nouveau slogan : Le gout du vrai. Nosoratan i / Ecrit par Vincent Lucas (Tale Ara-Barotra / Directeur Commercial & Marketing)

5 MIALA MIALA AMIN NY TOERAM-FIOMPINA MANKANY AMIN NY ORINASA : NY LALAN-KIZORAN NY RONONO DE LA FERME À L USINE : LE VOYAGE DU LAIT NY FAMOKARAN-DRONONO NY FANDRAISAN-DRONONO ANY AMIN NY ORINASA LA PRODUCTION DE LAIT LA LIVRAISON DU LAIT À L USINE y ronono raisin ny Socolait dia nanodidina ny 60 km an Antsirabe. Ny ankamaroan ny tantsaha mpiompy dia manana omby vavy iray na roa, be ronono na zafindraony. Omby vavy mihoatra ny no terena mba ahazoana ronono izay mankany amin ny Socolait fotsiny. Raha vantany vao tonga any amin ny Orinasa ny ronono dia mandalo fitiliana henjana ao amin ny Laboratoire mba hijerena ny kalitaony. Tsy raisina ny ronono tsy manarapenitra. Fa ireo ronono ara-dalana kosa dia hampangotrahina ary tehirizana ao anaty vata lehibe mialoha ny hanodinana azy. N Le lait est produit tout autour d Antsirabe dans un rayon de 60 kilomètres. La plupart des éleveurs possèdent une ou deux vaches de race laitière ou métisse zébu. Chaque jour plus de vaches sont traites rien que pour le lait allant à Socolait! NY FITANTERANA HO AMIN NY TOBY FANANGONAN-DRONONO LE TRANSPORT JUSQU AU CENTRE DE COLLECTE Misy fomba roa ny fitaterana ny ronono: na aterin ny mpiompy mivantana ; na aterin ireo mpanelanelana amin ny bisikileta na sarety. Amin ny bidao no itaterana ny ronono mankany amin ny toby fanangonana izay akaiky indrindra. Après la traite, le transport du lait se fait soit directement par l éleveur s il est proche, soit par un collecteur intermédiaire qui fait des tournées à pied, à vélo ou en charrette. Le lait est ensuite transporté dans des bidons jusqu au centre de collecte le plus proche. NY ANDRAIKITRY NY MPITANTANA NY TOBY LA PRISE EN CHARGE PAR LE CENTRE DE COLLECTE Raha vantany vao tonga any amin ny toby ny ronono dia tsaraina avy hatrany mba hijerena ny kalitaony. Rehefa avy eo dia sivanina ary aranaraka ao anaty sinibe fampangatsiahana. Rehefa vita ny fandraisana tamin iny andro iny dia araraka anaty bidao indray ny ronono mangatsiaka ary aterina amin ny fiara mankany amin ny Orinasa Socolait. Arrivé au centre de collecte, le lait est testé pour en vérifier la fraîcheur et la qualité. Il est ensuite filtré et transvasé dans le tank réfrigérant où il est conservé à 4 C. Lorsque la collecte du jour est terminée, le lait est à nouveau transvasé dans des bidons pour être transporté en camion jusqu à l usine. Une fois arrivé à l usine, le lait subit des contrôles rigoureux au laboratoire pour en vérifier la fraîcheur et la qualité. Les laits non conformes sont refusés, et les laits conformes sont pasteurisés et stockés au froid dans les grandes cuves de l usine avant d être affectés à telle ou telle production. ARY AHOANA KOSA IREO EKIPAN NY MPANANGONA RONONO IZANY? ET L ÉQUIPE COLLECTE DANS TOUT ÇA? Ny ekipan ny mpanangona ronono dia miantoka ny fandraisana ny ronono ao amin ny Orinasa, ary midina any antoerana koa izy mba manoro ireo mpiompy amin ny asa fanaon izy ireo andavanandro mba hanatsarana ny kalitao ny ronono vokarina. Tena ilaina ny mankeny an-toerana mba hampiroboroboana ny tena maha izy azy ny Socolait ary hisian ny fifanakalozana amin ny sehatra ny famokaran-dronono. Ireo rehetra ireo dia toy ny fananana harena sarobidy izay tsy inona fa ny ronono manarapenitra! L équipe collecte est présente dans l usine pour assurer la réception du lait, et se déplace aussi sur le terrain afin de renforcer les centres de collecte et les éleveurs dans leurs pratiques quotidiennes dans le but d améliorer la qualité du lait. La présence sur le terrain est indispensable pour promouvoir les valeurs Socolait et échanger avec notre réseau de production laitière. Tout cela pour s approprier le trésor tant convoité qu est le bon lait frais! Nosoratan i / Ecrit par Hélène Pfeiffer (Dokotera Veterinera Lehiben ny Sampana Fanangonana / Docteur Vétérinaire Resp Collecte)

6

7 Les présentations de vœux. D Antsirabe à Tana SOCOLAIT EN IMAGES Socolait a offert une rose à ses collaborateurs féminins à l occasion de la journée mondiale de la femme

8 FANOVANA HO AMIN NY TSARA KOKOA CHANGEMENTS POUR LE MEILLEUR T L oerana telo ankehitriny no ahitana ny rafitry ny SOCOLAIT : Ny Orinasa ao Mandaniresaka Antsirabe, ny Entrepôt ao Andranomena Antananarivo, ary ny biraon ny Tale Jeneraly ao Ivandry Antananarivo. es locaux de la SOCOLAIT sont désormais installés sur 3 sites : l Usine de Mandaniresaka Antsirabe, le nouvel Entrepôt d Andranomena et le bureau de la Direction Générale à Ivandry Antananarivo. Misy rafi-pitantanana vaovao napetraka mba ahafahan ny orinasa miatrika ireo fanamby vaovao. Arahabaina eto ireo Délégués vaovao, voafidy tamin ny volana aprily Ireo Délégués ireo dia homena toerana manokana eo amin ny fanatanterahana sy ny fanohizana ireo tetik asa mahakasika ny mpiasa. Un nouvel organigramme a été mis en place pour répondre aux nouveaux défis de la société. Voalohany amin ireo tetik asa ireo ny FAHADIOVANA. Tokony hiainantsika andavanandro ny BONNES PRATIQUES D HYGIENE. Efa nisy fiofanana nomena ny maro amintsika, ary nasiana fanatsarana ny fitaovana (toerana fidiovana, akanjo entina miasa, ). Asiana toerana manokana io FAHADIOVANA io ao anatin ny Fitsipika Anatiny vaovao. Le premier projet concerne l HYGIENE. Nous devons tous adopter et vivre les BONNES PRATIQUES D HYGIENE. Des formations ont été dispensées, et les équipements ont été améliorés (douches, tenues de travail, ). Par ailleurs, le thème de l HYGIENE aura une place particulière dans le nouveau Règlement Intérieur. Ny tetik asa faharoa dia mikasika ny fitandroana ara-tsosialy ny mpiasa. Ho jerena manokana ny fahasalaman ny mpiasa sy ny ankohonany. Ary hojerena ihany koa ny fampianarana ny zanaky ny mpiasa. Rehefa niato antaonany maro, dia notanterahina tamin ny voalohan ny taona ny fety fiarahabana tratry ny taona sy firariantsoa. Tao anatin ny firahalahina sy araka ny fomba malagasy no nanatanterahina izany fety izany. Fahatelo, nefa tsy ambany noho ny hafa : ny Gestion Prévisionnelle des Emplois et Compétences». Ireo fanovana natomboka dia hamokatra karazan asa vaovao. Tokony hanana olona afaka hanatanteraka izany karazan asa izany ny orinasa. Fomba roa no hahafahany manatanteraka izany: ny fanofanana ireo mpiasa ao aminy, na ny fampidirana mpiasa vaovao. FAHATERAHANA / NAISSANCES Faly isika rehetra mandray ato anatin ny fiankaviambe SOCOLAIT ireo ankizy 9 teraka nanomboka ny taona 2012 ka hatramin izao : Nous sommes heureux d accueillir dans la grande famille SOCOLAIT les 9 enfants nés depuis le début de l année 2012 : RAKOTOMAHANDRY Toy Jéa (RAKOTONIRINA Rindrasoa), RAVELOJAONA Kanto Ariane (RAMIARASOA Lalaina), ZARAMANANA Manambinintsoa Maelle (ANDRIAMAMPIONONA Mialy), ANDRIANIRINA Ny Aina Harrison Andritiana (RAVELOHARISON Njaratiana), RAVELOHARISON Miahy (RAJOSIARISAONA Seheno), LOVANIRINA Kaylan Sannyo (LOVANIRINA Aina Tahiry), ANDRIAMITANTSOA Sitrakiniaina Nathan (RAKOTOARIMANANA Guy Julien), TAHIANJANAHARY Nasandratriniaina Harinirina Fenohery (RASOLOFOHARISON Eric), RALAIVAO Fanirinjanahary Philip Soa Antoine (ANDRIANTIANA Philip Antoine) FAHAFATESANA / DECES Betsaka ihany koa ireo havana, tapaka sy namana, nafointsika nandritra izay fe -potoana izay. Tsarovana manokana eto Itompokolahy RAVALOMANANA Vonjisoa, mpiara-miasa sy namantsika. Handry ampiadanana anie ny fanahiny. Nous avons également perdu de la famille et des amis durant cette période. Nous regrettons particulièrement Feu RAVALOMANANA Vonjisoa, notre collègue et ami. Qu il repose en paix. Nous félicitions les nouveaux Délégués élus en avril Les Délégués seront associés dans la mise en œuvre ou la continuité des projets relatifs aux ressources humaines. Le deuxième projet concerne le système de couverture sociale du personnel. Nous étudierons la mise en place d une couverture médicale complémentaire pour les salariés et leurs ayants droits. Nous étudierons également la mise en œuvre d un mécanisme d aide scolaire pour les enfants. Après plusieurs années d interruption, nous avons organisé des fêtes de présentation de vœux en début d année. Les festivités se sont déroulées dans la cordialité et conformément à la culture malgache Le troisième projet, et non des moindres, concerne la Gestion Prévisionnelle des Emplois et Compétences. Les changements initiés impliquent la redéfinition des métiers. Il est important que la société dispose des compétences liées à ses métiers. L acquisition des ces compétences se fera soit par la formation soit par le recrutement. FANAMBADIANA / MARIAGE RAMAROMANDRAY Antsa (Chef comptable), RAKOTONAIVO Sitraka (Caisse Andranomena), PFEIFFER Hélène (Resp. Collecte et Développement) LISITRA NY SOLON-TENA NY MPIASA / LISTE DES DELEGUES DU PERSONNEL RADIMISON Olivier, RAFALIMANANTSOA Gilbert, RAKOTOARISOA Alain Didier, RAKOTONDRABARY Jean Noel, RALAIMAROMISA Jules, RAMINOARISON Nantenaina, RANDRIAMANARIVO Joseph Alain, RANDRIAMIHARISOA Fanjanirina, RANDRIANARISANDY Ernest Aimé, RANDRIANASOLO Benoît Joseph, RANIRISON Jean Simon, RAVELOHARISON Njaratiana Nosoratan i / Ecrit par Doria Gizy (Talen ny Fitantanana sy ny Ara-bola / Directeur Administratif et financier)

9 SOCOLAIT, MIROSO HO AMIN NY FANATSARANA MAHARITRA L USINE SOCOLAIT EN AMÉLIORATION CONSTANTE T sy ho ela dia hizaka ny fiantohana HACCP, Iso 9001, sy ny orinasa. Izany hoe tsy maintsy manaraka ireo fenitra iraisam-pirenena, hentitra sy vaovao hatrany mahakasika ny fandaminana, ny famokarana, sy ny fitaovam-piasana ary ny fanajana ny tontolo iainana. Ny fanajana ireo fenitra ireo dia ahafahana mahazo vokatra tsara sady aradalàna, mahatratra ny fe-potoana voatondro, ary indrindra ny fahabetsahan ny vokatra sy ny vidiny voafehy amin ny tokony ho izy. Toy izany koa ny ahafahana manatanteraka an-tsakany sy an-davany ny asa, ary ny fanajana tontolo iainana voaara-maso tanteraka. Tsapa fa ny orinasa, sy ny tao-trano ary ireo fitaovana enti-mamokatra, dia mila fanavaozana tanteraka. Nanapa-kevitra izahay fa hatomboka ny asa ary ao anatin ny roa taona no anatanterahana izany : , taom-panarenana goavana : Famindrana ny famokarana yaourtyao ao amin ny trano fanodinana vaovao. Ny fandaminana io toerana io mba handraisana ireo karazam-bokatra mitovy aminy. Ny fandaminana indray ny efitra Produits frais, izay havaozina mba hahafahana manaraka ireo fepetra rehetra ilaina amin ny fanamboarana fromazy («pâtes pressées», «camembert» ary «fondu») indrindra ho an ny fanamboarana dibera sy ny «crème fraîche». Ny fanavaozana ny toerana fanodinana Farilac sy Ronono Mandry Mamy, ary ny manodidina ny toerana rehetra. Noho izany dia efa novolavolaina ireo drafitra sy fikarakarana rehetra ho amin ny fandaminana ireo toeram-pamokarana voalaza ireo. Manaraka izany dia efa voafaritra koa ny toe-bola enti-manatanteraka. Ary farany dia efa tanteraka koa ny fifidianana ireo orinasa mpiara-dia na mpiantoka. Ankehitriny dia miisa 5 izy ireo no miantoka ny fanarenana ny tao-trano sy ireo karazam-pitaovana fanodinam-bokatra. Fotoana maromaro nifandimby no nitsidihan izy ireo ny toerana voakasiky ny fanamboarana, ka tamin izany indrindra no nanomezan izy ireo tolon-kevitra momba ny asa sy ny fandaminana rehetra. Ny faran ny taona 2013 dia ho vita tanteraka ny fanavaozana, sy ny famerenana amin ny laoniny ny fanodinam-bokatra ary ny fiantohana HACCP sy ISO 9001 dia ho mari-pototra tsara dia ho taom-pahavitan ny asa, izay hiverenan-tsika amin ny andro manaraka. Hatramin ny volana mey 2012, ny sampan asa manara-maso ny kalitao dia nametraka an-tanana ny HACCP, sy ireo fanaraha-maso maro samihafa, ary koa ireo antonta-taratasy rehetra ilaina momba ny fahatsaran ny vokatra vokarina. Nandritra ny roa volana, ny sampan asa miandraikitra ny fikojakojana arateknika dia nametraka ny fikojana fisorohana, sy ny fahaiza-manaon izy ireo manontolo amin ny fanavaozana ny kojakoja rehetra ilaina mahakasika ny «aéronautique», ary matetika izy ireo no mikarakara ireo fitaovana famerenana amin ny laoniny ny milina isan-karazany. Ny ankabeazan ireo milina fampiasa ireo dia manana ny kalitao tsara tokoa, vita avy any amin ireo firenena matanjaka ara-teknika : Danemark, Suisse, Allemagne, France, ohatra amin izany ireo fanodinana Ronono Mandry Mamy, Farilac na yaourt. Izany indrindra no hikojakojana azy ireo fatratra ka ampiasaina indray hanodinana vokatra rehefa voaverina amin ny laoniny. Efa ho iray volana izao, ireo orinasa mpiara-dia no nanomboka ny fanarenana ny toeram-panodinana vaovao. Ny iray amin izy ireo dia nanangana ny trano fiasan izy ireo eto amin ny orinasa mihitsy mba hahaingana sy hampahomby ny asa. Etsy ankilany kosa, ireo ekipan ny fanodinana vokatra (Farilac, Ronono Mandry Mamy, Collecte) dia nandamina izay ho firindran ny asa mba ahafahana manangona ireo tahirim-bokatra ho an ny 3 volana. Ny fananana ireo tahiry ireo dia ahafahana manana fiantohana ampahany na tanteraka amin ny fanodinana, amin izay dia malalaka tsara ireo orinasa mpiara-dia manao ny asa fanavaozana. Ny fandaminana ny toerana fanodinana vaovao dia hifarana ny volana Jolay. Ny fametrahana ny famokarana YAOURT sy YAO dia eo am-perin asa tanteraka. Ny fandaminam-panavaozana ny fanodinana Farilac sy Ronono Mandry Mamy dia hanomboka ny voalohan ny volana jolay ka ho vitaina amin ny voalohan ny volana oktobra. Ny asa fanavaozana ny toeram-pamokarana Produits Frais amin izao fotoana dia haharitra ny volana jolay hatramin ny oktobra. D ans un proche avenir notre usine doit bénéficier des certifications HACCP, Iso 9001, et C'est-à-dire qu elle devra répondre à des normes d organisation, de production, d équipement et de respect de l environnement internationales strictes et récentes. Le respect de ces normes permet d obtenir des produits de qualité élevée, régulière, dans les délais, des quantités prévues et à des couts maitrisés. Il procure également de meilleures conditions de travail et un respect de l environnement totalement contrôlé. L usine, bâtiments et outils de production, nécessitent une rénovation quasi complète. Nous avons décidé d entreprendre ces travaux sur une période de deux ans : sera l année des grands travaux : Le déménagement de la production yaourt-yao dans le nouveau bâtiment. L aménagement de ce bâtiment pour recevoir ces lignes de production. Le réaménagement du bâtiment Produits Frais d origine qui sera modernisé pour permettre de bien meilleures conditions de production pour les fromages (pates pressées, camembert et fondu) ainsi que pour le beurre et la crème fraiche. La modernisation des bâtiments et environnement des lignes Farilac et Lait Concentré Sucré. Pour cela nous avons conçu les plans et organisation des ces aménagements et bâtiments. Ensuite nous avons défini un budget. Et enfin nous avons sélectionné des entreprises partenaires ou sous traitantes. Elles sont aujourd hui au nombre de cinq pour les principales, qui assurent la rénovation des bâtiments et des équipements de production. A la suite de nombreuses visites sur le site elles ont pu nous donner leur préconisation de travaux et de planning. Au terme de 2013 les bâtiments seront rénovés, les lignes réinstallées et la certification HACCP et ISO 9001 en place sera l année des finitions. Nous reviendrons sur ce sujet. Depuis mai 2012 le service Contrôle Qualité organise la mise en place du système HACCP et des nombreux contrôles et documents nécessaires à la qualité des produits. Depuis deux mois le service Maintenance met en place une maintenance préventive et met tout son potentiel pour la rénovation des matériels qui nécessitent de grandes révisions, telles que dans l aéronautique, ou souvent des réparations de fond indispensables à la remise à niveau des ces machines. Enfin depuis bientôt un mois les entreprises partenaires sont à pied d œuvre pour rénover le nouveau bâtiment. L une d elle a installé son propre atelier sur notre site pour plus de rapidité et d efficacité. Par ailleurs les équipes production (Farilac, LCS, Fromages, collecte également) ont organisé leurs cadences de travail pour constituer trois mois de stock de produits. Ces stocks permettront un arrêt partiel ou complet des lignes de production pour laisser le champ libre aux sociétés partenaires de travaux-rénovation. L aménagement du nouveau bâtiment sera terminé courant juillet. L installation des lignes Yaourt et YAO se fera à ce moment. L aménagement-rénovation des lignes Farilac et LCS commencera début juillet pour finir début octobre. Les travaux de rénovation du bâtiment actuel PF dureront de juillet à octobre. Nosoratan i / Ecrit par Bruno Landrier (Talen ny Ivo-Toerana / Directeur de Site)

10 MIROSO HO AMIN NY FIANTOHANA HACCP : ANTOKA IRAY HO AN NY FAHOMBIAZAN NY SOCOLAIT VERS LA CERTIFICATION HACCP : UN FACTEUR CLÉ POUR LE SUCCÈS DE SOCOLAIT NY ARO VOINA ARA-TSAKAFO LA SÉCURITÉ ALIMENTAIRE IREO FAMPIOFANANA DES FORMATIONS Ny fanadihadiana ny antom-pisian ireo karazam-boina antony lehibe tokoa ho amin ny fifehezana azy ireny, raha adika tsotra ny paik ady HACCP dia fomba iray entina mifehy tanteraka ny aro voina ara-pahasalamana ho an ireo karazan-tsakafo. Trano fikarohana ara-tsiansa iray any Etazonia, izay miankina amin ny NASA no nanangana azy ity. Ny tanjona dia ny mba hisorohana, sy hamongorana ireo loza azo avy amin ny fihinanana sakafo Mihasarotiny ny lalàna maro mahakasika izany, etsy an-daniny koa ireo mpanjifa, ka izany indrindra no nahatonga ny SOCOLAIT miroso amin ity paika goavan ny fiantohana HACCP ity efa ho herin-taona izao. Ny fametrahana ny rafitra fanatsarana HACCP dia mitaky firotsahana antsehatra sy fahazavan-tsaina eo amin ny mpiasa rehetra. Izany indrindra no nahatonga ny orinasa SOCOLAIT nametraka ny lamina ho an ny karazampiofanana atolotra ho an ny fitambaram-ben ny mpiasa ato aminy. Notsindriana manokana ny fampiharana tonga lafatra ny fahadiovana sy ny famokarana. Le système d'analyse des dangers - points critiques pour leur maîtrise, en abrégé système HACCP est une méthode de maîtrise de la sécurité sanitaire des denrées alimentaires. Il a été élaboré aux Etats Unis d Amérique par un laboratoire dépendant de la NASA. Son objectif est la prévention, l élimination de tout danger alimentaire. Les textes législatifs et les consommateurs étant devenus de plus en plus exigeants, SOCOLAIT a décidé de se lancer dans un grand projet de certification HACCP depuis un an. La mise en place du système de qualité HACCP nécessite une pleine adhésion et compréhension de tous les employés. C est pourquoi, SOCOLAIT a mis en place un programme de différentes formations pour la totalité de son personnel. Un accent a été fait en particulier sur les bonnes pratiques d hygiène et de fabrication. Hanatratrarana ireo tanjona, ny orinasa SOCOLAIT dia namolavola tetik asa maro samihafa : Pour arriver à ses fins, SOCOLAIT à mis en œuvre différents plans d action : FITANTANANA MIOMPANA AMIN NY FIANTOHANA ARA-TSAKAFO SYSTÈME DE MANAGEMENT AXE SUR LA SÉCURITÉ ALIMENTAIRE Ny fomba fitantanana HACCP dia miompana amin ireto ainga 7 manaraka ireto : Le système de management HACCP est axé autour des 7 principes suivants : Manomboka amin ny fanadihadiana izay nahatonga ny voina / Procéder à une analyse des dangers Mamantatra ny antony rehetra nahatonga ny loza mba hifehezana azy ireo / Déterminer les points critiques pour pouvoir les maitriser Mamaritra ireo fetra azo ekena / Fixer les limites acceptables Mametraka ireo fomba fanaraha-maso / Mettre en place de systèmes de surveillance Mametraka ireo tolo-kevitra fanitsiana tena ilaina / Déterminer les mesures correctives nécessaires Manamarina fa ny fomba HACCP dia mandeha ara-dalana Vérifier que le système HACCP fonctionne efficacement Mamorona ny antontan-taratasy izay ahitana ireo paik ady narahina ary koa ny firaiketana rehetra / Constituer un dossier dans lequel figureront toutes nos procédures et nos enregistrements FANARENANA IREO FOTO-DRAFITR ASAN NY ORINASA REMISE À NIVEAU DE NOS INFRASTRUCTURES Ho fiantohana ny fahatsaran ny vokatra, SOCOLAIT dia tonga eo amin ny dingana fanatsarana kokoa hatrany ny foto-drafitr asa eto amin ny orinasa. Satria mitaky fitsipika ny HACCP, ny fanarenana rehetra izay an-dalampanantaterahana dia ahafahana manatsara hatrany ireo fepetra rehetra efa noraisina manomboka eo amin ny fandraisana ireo akora fanodina ka hatramin ny fitsinjarana eny amin ny mpanjifa Pour assurer la qualité de nos produits, SOCOLAIT est entrée dans une phase d aménagement de son infrastructure. Comme l exigent les principes de l HACCP, les travaux en cours permettront d optimiser les mesures déjà prises depuis l arrivée de nos matières premières jusqu à la livraison de nos clients. NY LABORATOARA FANARAHA-MASO UN LABORATOIRE DE CONTRÔLE Ny antoka amin ny fahatsaran ny vokatra vokarinay dia hamafisin ny fanananay ny laboratoara fanaraha-maso eto anivon ny orinasa ihany, ary indrindra ny fanarenana izany. Nohon ny fiara-miasa amin ny Institut Pasteur de Madagascar, ny fitomboan ny fanarahana akaiky ny vokatra vokarinay dia ahafahana miantoka tanteraka ny vokatra SOCOLAIT. L assurance qualité de nos produits est renforcée par la présence et la remise à niveau de notre laboratoire de contrôle situé au sein de l usine même. En collaboration avec l Institut Pasteur de Madagascar, une surveillance accrue de nos produits nous permet de garantir l innocuité des produits SOCOLAIT. Nosoratan i / Ecrit par Lianala Andrianjatovo (Talen ny Kalitao/ Directeur Qualité)

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar HUMBOLDT-UNIVERSITÄT ZU BERLIN Landwirtschaftlich-Gärtnerische Fakultät Schriftenreihe des Seminars für Ländliche Entwicklung VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY MINISTERAN NY FAMBOLENA NY FIOMPIANA ARY NY JONO ----------------------------------- REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana ---------------------------------- MINISTERAN NY TOEKARENA

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA TATITRA ANIVON NY ANTENIMIERAM- PIRENENA Praiminisitra Jean RAVELONARIVO 1 TATITRA MANOLOANA NY ANTENIMIERA I 21 MAY 2015 21 MAY 2015 Andininy 54.- Ny Filohan ny Repoblika no manendry ny Praiminisitra

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA Public Disclosure Authorized a REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana JIRAMA JIRO SY RANO MALAGASY E1 403 VOL. 1 Public Disclosure Authorized Public Disclosure Authorized ÉVALUATION

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

DISPOSITIONS COMMUNES

DISPOSITIONS COMMUNES ORDONNANCE N 62-074 du 29 SEPTEMBRE 19 62 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics. ( J.O. n 248 du 12.10.62 p. 2248 ) modifiée et complétée

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Ventin-kevitra Matoan-dahatsoratra Fampahafantarana an i Madagasikara 4 Ny Nosy Telma, mpandraharaha nasionaly manara-penitra iraisam-pirenena

Plus en détail

Évaluation de l impact environnemental et social

Évaluation de l impact environnemental et social RÉPUBLIQUE DE MADAGASCAR Tanindrazana - Fahafahana - Fandrosoana PRÉSIDENCE PROJET PÔLE INTÉGRÉS DE CROISSANCE Secrétariat National Évaluation de l impact environnemental et social Cadre de politique de

Plus en détail

Le malgache. L exemple d une langue sans test

Le malgache. L exemple d une langue sans test Le malgache L exemple d une langue sans test 1. Pourquoi n existe t il pas de cer:fica:on? Peu d échanges commerciaux avec l extérieur Pas d immigra:on importante de «cols blancs» Peu d étudiants étrangers

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

PROJET DE LOI N 027/2007

PROJET DE LOI N 027/2007 REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PROJET DE LOI N 027/2007 DU 25 OCTOBRE 2007 PORTANT LOI DE FINANCES POUR 2008 IMPRIMERIE NATIONALE 2007 - 2 - PROJET DE LOI N 027/2007 PORTANT

Plus en détail

46 Ordonnance n 62-074 du 29 septembre 1962

46 Ordonnance n 62-074 du 29 septembre 1962 Ordonnance n 62-074 du 29 septembre 1962 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics (J.O. n 248 du 12.10.62, p. 2248), modifiée et complétée par

Plus en détail

M o t d u P rov i n c i a l Temps de grâces

M o t d u P rov i n c i a l Temps de grâces Mot du Provincial Temps de grâces Plusieurs événements de la province et de l Église à Madagascar constituent nos sources d action de grâce à adresser au Seigneur. La visite fraternelle et édifiante du

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

LANY TAMINGANA ETO AMINTSIKA

LANY TAMINGANA ETO AMINTSIKA cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN

Plus en détail

Note pratique. Réseau PRATIQUES

Note pratique. Réseau PRATIQUES Note pratique Ny Herin ny hafatra / Le pouvoir des messages pour la santé préventive Expérience du programme de santé materno-infantile mené par Inter Aide à Farafangana, Madagascar Notice Type de document

Plus en détail

RAPPORT DE FORMATION

RAPPORT DE FORMATION RAPPORT DE FORMATION CHANGEMENT DE COMPORTEMENT ET DE CARACTERE Dans la Lutte contre la Corruption Commune ANTSIRABE Région VAKINANKARATRA Organisation de la Société Civile Hotel IMPERIAL Antsirabe 20

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES DEPARTEMENT INTERDISCIPLINAIRE DE FORMATION PROFESSIONNELLE COMMUNICATION ET DYNAMIQUE LOCALE RAPPORT

Plus en détail

MANUEL DE MANAGEMENT QUALITE

MANUEL DE MANAGEMENT QUALITE MANUEL DE MANAGEMENT QUALITE Z.I. Saint Lambert des Levées - 49412 SAUMUR Cedex - France Tél. (+33) 02 41 40 41 40 - Fax. (+33) 02 41 40 41 49 www.castel.fr SOMMAIRE TITRE SECTION TABLE DES MATIERES Domaine

Plus en détail

Atelier thématique QUA1 -Présentation de la norme ISO 9001-

Atelier thématique QUA1 -Présentation de la norme ISO 9001- Forum QHSE - QUALITE Atelier thématique QUA1 -Présentation de la norme ISO 9001- Laurent GUINAUDY OC2 Consultants Atelier ISO 9001 1 Présentation du Cabinet OC2 Consultants Cabinet créé en 1996 Zone d

Plus en détail