UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

Dimension: px
Commencer à balayer dès la page:

Download "UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY"

Transcription

1 ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR

2

3 L édito Ny ronono, tsilo mpitondra amin ny ho avy kosa dia mety hanome hatramin ny 25 litatra eo ho eo Eto am-piandohana dia tiako ny mampatsiahy ny maha sarobidy ity sakafo ity. isan andro mandritra ny 10 volana. Ny tsy fanjarian-tsakafo sy ny tsy fahampian ny fepetra ara-pahasalamana no sakana. Ny rononon omby aloha dia ronono omen ny reniomby ny zanany ho sakafony. Misy ireo sokajin-tsakafo rehetra izy ( protida,gliosida,lipida), ireo sira mineraly toy ny kalsioma sy fosiforo, ireo otrikaina. Ny ronon omby dia azo ahodina, ary tena akora fototra ho an ny orin asan-dronono. Araka ny endriky ny voka-dronono, dia mihinana azy betsaka ny olombelona, eo amin ny salan isa 226g isan andro (salan isa eran-tany). Ny fihinanana betsaka ny rononon omby dia tafiditra anaty kolo-tsaina voatonona tamin ny tantara angano fahiny ka hatramin ny asa soratra misy ankehitriny. TENA TOMBONTSOA FANARARAOTRA HO AN NY TANTSAHA MALAGASY SOCOLAIT dia manamafy sy mamela ireo mpiaramiombon antoka aminy ho amin ny tontolon ny fifampitokisana : manome antoka ny fidiram-bola mandritra ny taona izahay. Mampiofana izahay, tsy mamela ho irery izahay, mampisongadina ny porofo izahay mba ho antoka ara-tsakafon ireo mpanjifa, ary farany maniry ny fanamafisana ny lanjan ny VITA MALAGASY. Ny fanomezan-danja indray ny fanangonandronono dia tsy maintsy ahitana mivaingana fiovana ara-toe-karena sy sosialy: manome fanampina fidiram-bola ho an ny tantsaha voalohany indrindra,sy/na koa fomba iray hafa ivoarana ho an ny faritra hafa. Tsy maintsy manao izay mety izahay mba hamoronana fiompiana mendrika ara-tsosialy, ka voaaramaso sy voafehy. Miezaka izahay miaraka amin ny ministera mpiahy mba hamaritra ny fetra tokony arahina hampaharitra ny ezaka efa natao. Tsy misy antony mampitsahatra ny fitomboan ny filana erantany afatsy ny krizy ara-toe-karena ankapobeny. Manana 42tapitrisa hektarana tany azo ambolena isika eto Madagasikara, izany hoe 70% n ny velaran-tany. Ny vokatry ny fambolena dia mampiseho ny 29% n ny PIB, ary koa 70%n ny mponina miasa. Manana ny ho enti-manana rehetra isika mba ahombiazana: ny velaran-tany ambolena, ny tambanivohitra izay vonona, ny tontolom-piompiana izay misy na dia nihaosa aza izany nandritra ny taona vitsy farany. Ny vola miditra iainan ny mpiompy SOCOLAIT dia tena zava-dehibe amin izany: hatramin ny nahatongavanay, ny fiaraha-miasanay eny ambanivohitra amin ny fanangonana ronono sy ny tantsoroky ny tantsaha mpiompy dia ohatra mivaingana. Tsotra ny tanjonay: hampitombo ny habetsahan-dronono isaky ny mpiompy sady manatsara ny kalitaon-dronono. Mba hanatanterahana izany,dia manaraka, manofana ireo mpiompy tranainy sy vaovao ny ekipanay isan andro. Amin izao fotoana, manome ronono 4 litatra isan andro ny omby vavy iray; ny omby vavy be ronono iray voakarakara tsara SOCOLAIT dia ao anatin ny tetika mandresy/mandresy: ny fahazoana fahaleovan-tena (fanenana araka izay tratra ny fanafarana avy any an-dafy) amin ny fandraisana famatsian-dronono amin ny alalan ny fanangonana dia ahafahana mampijoro ny tsy fiovaovam-bidy eo anivon ny mpanjifa sy ahafahana mampivoatra ny drafitra ara-toe-karena sy sosialy ho an ireo mpiompy. Ny tsirairay avy aminareo dia tokony ho tsilom-pifandraisana eo anivon ny fianakaviana sy ny namana,eo anivon ny tontolo ambanivohitra mba hamporisika azy handroso ao anaty tetik asa maharitra ara-toe-karena sy sosialy. Manararaotra etoana aho, ny firariantsoa amin ny fetin ny fahaleovantenam-pirenena. Nosoratan i / Ecrit par Philippe PENOUTY (Tale Jeneraly / Directeur Général)

4 L édito En préambule je souhaiterai rappeler l importance de cet aliment. Le lait de vache est avant tout le lait produit par la vache pour alimenter son veau. Il contient les trois types de nutriments principaux (glucides, lipides, protéines), des sels minéraux tels le calcium et le phosphore, des vitamines. Le lait de vache peut être plus ou moins transformé, et forme la principale matière première de l'industrie laitière. Sous ses différentes formes les humains le consomment en abondance, pour une moyenne de 226 grammes par jour (moyenne mondiale). La consommation abondante du lait de vache en a fait un élément culturel mentionné aussi bien dans les anciennes mythologies que dans des œuvres plus modernes. UNE OPPORTUNITE POUR LE PAYSANNAT MALGACHE. La croissance de la demande mondiale n aura aucune raison de s arrêter, sauf crise économique générale. A Madagascar, nous avons 42 Millions d hectares de terres agricoles, soit 70 % du territoire. La production agricole représente 29% du PIB du pays et 70% de la population active. Nous avons tous les atouts pour réussir, les surfaces agricoles, une population rurale très impliquée, un cheptel existant même s il s est appauvri ces dernières années. Une source de revenu au quotidien substantielle pour les éleveurs SOCOLAIT a un rôle important dans cette démarche, depuis notre arrivée, notre partenariat, avec le monde rural dans la collecte du Lait et l accompagnement des éleveurs en est l exemple probant. Nos objectifs sont simples, développer les volumes de lait collectés par éleveur tout en améliorant la qualité du lait. Pour ce faire nos équipes au quotidien accompagnent, forment les générations actuelles et nouvelles d éleveur. Sommaire Le lait, un vecteur d avenir A l heure actuelle une vache donne environ 4 litres de lait par jour, une vache laitière mise dans de bonnes conditions pourrait en produire en moyenne 25 litres de lait par jour sur une période de 10 mois. La nutrition, le manque d hygiène sont des freins à l atteinte de ces rendements journaliers. SOCOLAIT veut consolider et déployer ses partenariats dans un esprit de confiance mutuelle, nous offrons une garantie de revenus toute l année. Nous formons, nous accompagnons, nous développons la traçabilité pour la sécurité alimentaire de tous nos consommateurs et enfin nous souhaitons affirmer une valeur, le «VITA MALAGASY» La revalorisation de la collecte de lait devrait répondre à un impératif économique et social, offrir un complément de ressources au paysannat des régions de production dans un premier temps et/ou une alternative de développement pour les autres régions. Nous devons tout faire pour créer un modèle social d élevage, cela devra être contrôlé et encadré. Nous nous efforçons avec les ministères de tutelle de définir les contours réglementaires pour assurer la pérennité des efforts qui seront engagés. SOCOLAIT est dans un projet gagnant/gagnant : l obtention de notre indépendance (diminuer au maximum les importations) d approvisionnement en lait par le biais de la collecte, nous permettra de maintenir une stabilité des prix envers les consommateurs et de développer un projet économique et social pour les eleveurs. Chacun d entre vous doit être un vecteur de communication auprès de vos familles et amis dans le monde rural pour les encourager à s engager dans un projet durable économiquement et socialement. Je profite de cet éditorial pour vous souhaiter d excellentes fêtes d indépendance. EDITORIAL P.3/P.4 MARKETING P.5 SYSTÈME D INFORMATION P.6 DIRECTION TECHNIQUE P.8 DIRECTION COMMERCIALE P.9 DIRECTION DE SITE P.10 Edité par SOCOLAIT S.A Route Mandaniresaka Antsirabe 110 MADAGASCAR Directeur de publication: Philippe PENOUTY Rédacteur en chef: Comité de rédaction: Bruno Landrier, David De La Fuente, Vincent Lucas, Rosa Andriamifidy, Hanitriniaina Raveloarimino, Emmanuelle Rasoarahona Ont collaboré à ce numéro: Onja Rabezandrina, Avo Rajoelson, Miora Rakotoarivony, Loic Hoinville, Miangaly Andriampanasina, Romy Rajoelison, Amédée Ratovoson Crédit photos: Socolait Régie Publicitaire: SOCOLAIT 3ème étage Imm. DIGITAL Ivandry Antananarivo 101 Tél.: Impression: Print Express Nombre d exemplaires: 350 Doria GIZY

5 Ny Foire Internationale de MADAGASCAR dia anisan ny hetsika lehibe indrindra ara ekonomika ho an ny mpandraharaha malagasy.io no ambohim-pihaonan ny orinasa 250 eto an- toerana sy avy any ivelany izay ahitana ny fandraisan anjaran i Indonesia,i Frantsa,ny Sinoa sy ny Nosy Morisy. Fanindroany izao i SOCOLAIT no nandray anjara tamin ity hetsika lehibe ity.ny tanjona mandritra ny hetsika moa dia ny hampafantatra ireo karazana vokatra vitantsika amin ireo mpanjifa eto an toerana sy ireo avy any ivelany ary koa mba hitafatafa amin ireo mpanjifa vahiny ahafahana manondrana ny vokatra makany. Nampiavaka ny fandraisantsika anjara ireo hetsika samihafa natolotra ireo mpitsidika ny trano heva tao izany ny fizarana yaourt ho an ny ankizy,ny fanadramana nitohy ny karazana entana vokarintsika toy ny fromazy ny yaourt. Ireny fanadramana ireny dia nahazoana valin ny mahafapo avy amin ny ny maro anisa tamin ireo mpitsidika izay nilaza fa maika hahita ireo vokatra vaovao ireo eny amin ny tsena Nandritra io hetsika io koa no nahafahan ny mpiaramiasa nifampizara tamin ireo mpitsidika an arivony toy ny mpiasa,ny mpianatra,ny mpandray anjara hafa,ny mpanao politika,ny ray amandreny,ny ankizy., :nifampizara ny soa toavina,ny tanjona ary ny famoronana ataon i SOCOLAIT izay hireharehantsika fatratra ao ohatra ny fampisehoana ireo vokatra vaovao,ny fanavaozana vita natao tany amin ny ozinina,ny firosoana makany amin ny fanaraha- penitra manaraka ny ISO ary niavaka ny fampidinana ny vidin ny yaourt mba ho zakan ny rehetra Fisaorana lehibe no atolotra ireo rehetra tonga nanafana ny trano hevantsika :ireo tale lehibe,ny tomponandraikitra isatsokajiny,ny ekipa ara-barotra ary ireo tovovavy mpanentana.dia mifanome fotoana indray ary isika amin ny hetsika manaraka hitondrana zava baovao marobe!. Socolait sy ny fandraisany anjara tany amin ny FIM Socolait à la FIM nationales et internationales avec la présence de plusieurs pays comme l Indonésie, la France, la Chine et l ile Maurice. Cette édition fut la deuxième participation de la Socolait. Le but de cette participation était d exposer toutes les références de produits de l entreprise au public national et international et d échanger avec des clients étrangers potentiels en vue de l exportation de nos produits. Notre participation s est distinguée par les diverses animations que nous avions effectuées sur le stand, entre autres la distribution de yaourt aux enfants, les dégustations permanentes de tous les produits frais (fromages, yaourt, yao,..) ainsi que les Krumps mais surtout les dégustations des nouveaux produits en cours de lancement. Ces dégustations ont comptabilisé en majeur partie des retours positifs par les visiteurs de la foire qui ont affirmé leur impatience de voir ces nouveaux produits sur le marché. Durant l événement, l équipe présente sur le stand a pu partagé aux milliers de visiteurs : professionnels, étudiants, exposants, hommes politiques, parents, enfants, les valeurs, les ambitions et les innovations de la Socolait dont nous sommes si fiers comme la présentation des nouveaux produits, les travaux de réaménagement à l usine achevés, la certification Iso en cours, et la baisse du prix du yaourt. Un grand merci à tous ceux qui sont venus animer notre stand (les directeurs, les responsables de département, l équipe commerciale et les animatrices). Nous nous donnons rendez vous en 2015 pour la prochaine édition avec bien sur de nouvelles innovations! La Foire Internationale de Madagascar est le plus grand évènement économique de l année pour les grandes entreprises malgaches.c est une foire qui a regroupé plus de 250 entreprises Nosoratan i / Ecrit par Miangaly ANDRIAMPANASINA (Lehiben ny sampana Marketing/ Responsable Trade Marketing)

6 LA CHARTE INFORMATIQUE SOCOLAIT Définition : La charte a pour objet de définir les conditions d utilisation et les règles de bon usage des ressources informatiques de la SOCOLAIT. Famaritana: Ity fitsipika fototra ity dia mamaritra ny fepetra fampiasana sy ny fitsipika arahina mikasika ny fikirakirana ny fitaovana informatika-n ny SOCOLAIT. 1.Champ d'application : Sauf mention contraire, la charte s'applique à l'ensemble des utilisateurs du système d'information et de communication de l'entreprise, quel que soit leur statut. 2.Confidentialité des paramètres d'accès : L'accès à certains éléments du système d'information est protégé par des paramètres de connexion. La confidentialité engage aussi l utilisateur à préserver les données propres au service auquel ils sont affectés, et bien évidemment propre à l entreprise. 3.Protection des ressources sous la responsabilité de l'utilisateur : L'utilisateur est responsable des ressources qui lui sont confiées dans le cadre de l'exercice de ses fonctions. Il doit concourir à la protection des dites ressources, en faisant preuve de prudence. Des manuels d utilisation et notes de service sont diffusées afin d éviter tout risque. 4.Accès à Internet : Dans le cadre de leur activité, les utilisateurs peuvent avoir accès à Internet. Pour des raisons de sécurité, l'accès à certains sites peut être limité ou prohibé par le SERVI- CE INFORMATIQUE. L utilisateur peut en demander l accès sous la condition que ces besoins sont justifiés. 5.Messagerie électronique : La messagerie électronique est un moyen d'amélioration de la communication au sein de l entreprise et avec les tiers. Le SER- VICE INFORMATIQUE incite l utilisateur à rédiger des mails clairs (autant dans la forme que dans le fond), éviter l envoi de mails abusifs et volumineux. D autres outils sont prévus à cet effet. 6.Sanctions : Le manquement aux règles et mesures de sécurité de la charte est susceptible d'engager la responsabilité de l'utilisateur et de d entraîner à son encontre des avertissements, des limitations ou suspensions d utiliser tout ou une partie du système d information et de communication. 7.Engagements : Le SERVICE INFORMATIQUE est à la disposition des salariés pour leur fournir : toute information concernant l'utilisation des NTIC (Nouvelles Technologies de l Information et de la Communication) ainsi qu une formation appropriée. les limites techniques des systèmes d'information et sur les menaces susceptibles de peser sur sa sécurité. un service adéquat pour la résolution des problèmes liés aux systèmes d information. des propositions d amélioration et d évolution des systèmes d information. Les ressources informatiques nécessaires à leur activité professionnelle. 1.Sehatra fampiharana : ankoatra ny filazana manokana, ity fitsipika fototra ity dia mihantra amin ny vondron ny mpampiasa (olona mampiasa fitaovana) ny «système d information et de communication» ato amin ny orin asa. 2.Tsiambaratelon ny fahafahana miditra : ny fidirana amina singa sasany ao amin ny systeme d information dia voaaro 3.Fiarovana ny fitaovana dia eo amban ny andraikitry ny mpampiasa (olona mampiasa ny fitaovana) : ny mpampiasa dia tompon andraikitra amin ny fitaovana nomena azy hamitanany ny asany, ary tokony ho mailo foana. 4.Fidirana tranon-kala : ao anatin ny sehatry ny asa, ny mpampiasa (olona mampiasa fitaovana) dia afaka miditra anaty tranon-kala. Mba ho fiarovana, ny fidirana anaty tranon-kala sasantsasany dia voafetra na voararan ny «SERVICE INFOR- MATIQUE» 5.Mailaka : ny mailaka dia fitaovana fampivelarana ny fifandraisana ato anatin ny orin asa sy ny any ivelany. 6.Sazy : ny tsy fanarahan-dalàna sy ny toromarika fiarovana ao anatin ity fitsipika fototra ity dia andraikitra fenon ny mpampiasa (olona mampiasa fitaovana) ary mety ahazoana fampitandremana; fampihenana na fanesorana tanteraka ny fampiasana ny «système d information et de communication». 7.Fampahafantarana ny mpiasa : ny «SERVICE INFORMATI- QUE» dia misokatra ho an ny mpiasa mba hanome azy ireo : ny vaovao rehetra mikasika fampiasana ny NTIC ary koa fiofanana mifanaraka amin izany. ny fetra ara-teknikan ny «systèmes d information», ary koa ny loza mety hiantra amin ny fiarovana azy. sosokevitra fanatsarana sy fampivoarana ny systèmes d information. Ny fitaovana ilaina amin ny fanatanterahana ny asa. FAHATERAHANA / NAISSANCES Faly isika rehetra mandray ato anatin ny fiankaviambe SOCOLAIT ireto ankizy manaraka teo / Nous sommes heureux d accueillir dans la grande famille SOCO- LAIT les enfants suivants : ANDRIANANDRASANA Fanomezantsoa Koren ( ANDRIANANDRASANA Mamy Charlie) et RAJOSIA Ralaitafara Ny Riana Etienne (RAJOSIARISAONA Lovasoa Lalaina) Nosoratan i / Ecrit par Romy RAJOELISON / Amédée RATOVOSON (Sampana S.I / Service S.I)

7

8 Asa vaovao : vita ny fanavaozana sy ny fanatsarana Travaux neufs : Fin des travaux de rénovation et réhabilitation Iny telovolana farany iny no fetra farany namitana ny trano vaovao ny fandraisana ronono, ny fanaovana fromage ary ny trano fisolona sy fametrahana akanjo. Taoriana ny nanaovana ny asa fanamboarana sy fanavaozana tao anatin ny herintaona zay dia ho faranana amin ity volana jona ity ny asa. Lasa toy ny vaovao ny trano famokarana, ary azo ampitahaina amin ny orinasa any Eropa. Isaorana etoana ireo nanantotosa ny asa rehetra: ny LABOMECA teo amin ny lafin ny fantsona, ny SMEF teo amin ny fametrahana ny fampangatsiahana, ny BATIR sy ny MADACON- STRUCT teo amin ny momba ny fanamboarana ny tao-trano, ny SOMECA teo amin ny momba ny herin aratra, ary indrindra indrindra ny ekipa ny sapandraharaha teknika ny SOCOLAIT izay nanao ny asa manara-penitra nandritra ny fanamboarana rehetra. Les trois derniers mois a été le délai nécessaire afin de terminer la nouvelle réception lait, la nouvelle fromagerie ainsi que les vestiaires. Les travaux de rénovation ont donc pris fin en Juin après plus d un an de travail. L usine, désormais comme neuve, n a rien à envier aux usines que l on peut retrouver en Europe. Nous tenons à remercier toutes les équipes ayant participé à ces travaux, LABOMECA pour les tuyauteries, la SMEF pour les installations froids, BATIR et Madaconstruct pour le génie civil, SOMECA pour les installations électriques mais aussi et surtout les équipes techniques de la SOCOLAIT ayant fourni un travail de qualité tout au long du chantier. Mise en place du plan de maintenance préventive Ho fanatsarana maharitra ny sampandraharaha teknika dia dia mametraka ny maintenance preventive izay mbola tsy mampiharina hatramin izay, ny hankamaroan ny asa mantsy dia toa lasa vonjy taitra avokoa. Izany dia natao miendrika fiche izay ahitana ireo asa ho tanterahina. Ny maintenance preventive toy ny asa notanterahin ny ekipa teknika ihany koa dia mandalo fanarahamaso isa-maraina. Ny fanaraha-maso ny fitaovana dia efa ho vita ihany koa, izay demande de travail sy ny bon de travail izay afahana manaraka ireo asa vonjy taitra atao dia noraketina ao anaty solosaina mba hananana ny firaketana ireo fitaovana. Mba hanatsarana ny fametrahana sy ny fanaraha-maso io maintenance io, ny SOCOLAIT dia hampiasa ny logiciel GMAO, izay hafahana manao ny firaiketana ireo fitaovana, ia asa aryindrindra manaraka ny fivoaran ny ekipa teknika ny fametrahana io logicviel vaovao io dia voafaritra ho amin ny farany volana jona, ary mba hampiharana azy tsara dia roa volana no ilaina Araka ny efa noresahina tamin ny soco sera nivoaka farany momba ny niandrasana ny Chaudière AKKAYA. Efa amperinasa izy ankehitriny taoriana ny 3 andro nametrahana azy sy ny erinandro nanaovana ny fanandramana. io chaudière io dia afahana miantoka maharitra ny asa famokarana. Tsy lany hevitra vaovao, ny sampandraharaha ny teknika dia efa mihevitra ny fanatsarana manaraka indray Nosoratan i / Ecrit par David DE LA FUENTE (Tale ara-teknika / Dir. Technique ) En amélioration constante, le département technique s attaque désormais à la mise en place de la maintenance préventive. Inexistante jusqu à présent, la plupart des interventions sont d ordres curatives. Sous forme de fiche de maintenance où sont notées les interventions à effectuer, la maintenance préventive passe aussi par un contrôle journalier des installations effectuées chaque matin par les équipes techniques. Nouveaux matériels Comme nous en avions parlés dans notre précédent épisode, nous étions en attente de notre nouvelle chaudière AKKAYA. Après plus de 3 jours de travail afin de la mettre en place et une semaine d essai elle est désormais opérationnelle. Etant fiable, elle nous permettra de garantir un processus de fabrication constant. Jamais à cours d idée, le département technique planche d ores et déjà sur les futures améliorations de la Socolait

9 Resaka nifanaovana tamin Ingahy RAMANANTSOA,Tompon ny EPI PLUS etsy BESARETY - Interview avec Mr RAMANANTSOA,gérant de l EPI PLUS à BESARETY Socolait :Miarahaba anao ny SOCOLAIT ry Ingahy Ramanantsoa, Bonjour Mr RAMANANTSOA Ramanantsoa : Miarahaba anao ihany koa inona no vaovao entinao? Bonjour, quelle nouvelle vous amène? SOCOLAIT :O ry Ingahy Ramanantsoa, ny orinasa SOCOLAIT dia manome toky anao fa hisy foana ny zava-baovao ary anisany voalohany hahafantatra izany ianao rehefa tonga izany fotoana izany fa ny mba tiako anontaniana anao aloha androany dia ny akon ny fampidinana ny vidin ny Yaourt SOCOLAIT izay nampiharintsika herinandro vitsivitsy lasa izay, indrindra amin ny mahampanjinjara vokatra SOCOLAIT anao. Nanao ahoana ny niainanao iny fihenana iny sy ny akony teo amin ny mpanjifa? Mr RAMANANTSOA, la société SOCOLAIT vous promet d apporter toujours d améliorations et vous serez parmi les premiers à être informé.la raison de ma visite est de vous demander en étant notre distributeur, quel est l impact de la baisse du prix des yaourts appliquée depuis plusieurs semaines passées Ramanantsoa : Voalohany indrindra aloha dia efa ela no niandrasana an iny hetsika iny, zava-dehibe ho an ny Malagasy rehetra mihitsy no nataonareo satria manolotra vokatra tsara amin ny vidiny takatry ny rehetra ianareo izany hoe mitsinjo ny olona amin ny fahasahiranany ny SOCOLAIT. Cette action était déjà attendue depuis longtemps,la plupart de la population malgache bénéficie de cette baisse comme vous avez offert de produits de qualité à un prix à la portée de tous,en ce temps de crise votre promotion allège le panier des ménagères. Manarak izany amin ny mahampanjinjara anay dia miteny ho azy ny vokatra, ianareo angamba afaka manamarina fa niakatra dia niakatra ny varotra raha oharina ny volana Aprily eny fa na de ireo volana hafa rehetra teo aloha aza. En plus, en tant que distributeur le résultat de notre partenariat montre que les ventes ne cessent d augmenter par rapport au mois d Avril et aux autres mois précédents Akon ny fampidinana ny vidin ny yaourt ho 600 ar ny iray Echo de la baisse des prix des yaourts à 600 ar le pot n avons pas pu suivre à temps les approvisionnements SOCOLAIT : Ho anao manokana tafita any mpanjifa ary ve ilay vidiny 600 Ar izay napetraka Pour vous, est ce que les consommateurs ont adopté le prix de 600Ar le pot d yaourt? Ramanantsoa : Tafita mihitsy na dia tsy zato isan-jato ary, nanampy betsaka tamin izany ihany koa ny fampahafantarana nataonareo tamin ny haino aman-jery ka nahatonga ny olona hitaky mihitsy ny vidiny 600 Ar, tena zava-dehibe mihitsy iny. Evidement cela est acquis presque à 100 % ;en plus les campagnes publicitaires lancées sur les medias poussent les clients à nous exiger le prix à 600ar :c etait très important. SOCOLAIT : Miarahaba anao manokana aho ry Ingahy Ramanantsoa amin ny anaran ny SOCO- LAIT noho izany vokatra azonao izany, hirariana mba hihoatra lavitra noho izany ny volana Jiona sy amin ny ho avy rehetra. Je vous félicite Mr RAMANANTSOA de ce résultat prometteur et nous espérons que les ventes du mois de Juin et des mois à venir seront encore plus fructueuses Sao de mba misy ary hafatra mba tianao ampitaina ao anatin izao resadresaka ataontsika zao. Avez-vous de messages à passer pour conclure? Ramanantsoa : Tsotra fotsiny ny hafatra, tsara de tsara ny zavatra ataonareo fa tohizo, hamafiso hatrany ny serasera amin ny mpanjifaamin ny alalan ireo haino aman-jery samihafa fa tombony ho anareo izany ary manampy betsaka anay ihany koa. C est tres simple, votre stratégie reste bénéfique pour nous et pour les consommateurs,renforcez toujours votre communication avec eux à l aide des différents medias car c est avantageux pour vous et une grande aide pour nous partenaires Ary farany rahoviana izahay no mba entinareo mijery ny ozinina mpamokatra any Antsirabe? Et pour finir quand est ce que vous allez nous faire visiter votre usine à Antsirabe? Socolait : Fifaliana lehibe ho anay ny handray anao any ry Ingahy Ramanantsoa, alamintsika ny fotoana amin ny maha mety azy, voaray ihany koa ireo hafatra ireo, toky no omeko anao fa tsy hitsahatra ny fanavaozana sy ny fanatsarana ataontsika SOCOLAIT : Azonao lazaina anay ary ve hoe taham piakaran ny amin ny lafiny rehetra atoamin ny SOCOLAIT. Misaotra indrindra anao ary manome fotoana anao amin ny manaraka indray. varotra tato amianreo tamin iny volana iny? Pouvez vous nous dire le taux de cette augmentation? Nous serions très heureux de vous accueillir la bas, nous allons Ramanantsoa : raha oharina tamin ny volana Aprily dia niakatra organiser cette visite et vous informerons de la suite, nous tany amin ny 52% tany ho any, tokony nihoatra izany ary fa izahay no nisy fotoana tsy naharaka kely. avons noté ces messages et ayez confiance nous allons toujours continuer les améliorations sur tous les plans et tenir les enga- Par rapport au mois d Avril nous avons Nosoratan i / Ecrit par constaté une hausse d environ 52 %, Onja RABEZANDRINA gements avancés. Nous vous remercions même plus car il y a des périodes où nous (Lehiben ny sampana / Responsable Ventes Directes) de votre contribution et à la prochaine.

10 Dia ireto ary ny valin ilay adina momban ny HACCP,ireo mendrika dia notolorana valisoa.tamin ny anaran'ny SOCOLAIT no nanomezana mari pakasitrahana azy ireo momban'y fahalalana azony.ireto ambany ireto ary ny santionan'ny diplaoma sy sary vitsivitsy nandritra ny lanonana fanolorana izany diplaoma izany. 1) Définir la démarche HACCP Système qui définit, évalue et maitrise les dangers significatifs au regard de la sécurité des aliments Valin ilay fahalalana mikasika ny HACCP Réponses sur les tests de connaissances sur l'haccp Et voici les réponses à notre test HACCP, les lauréats ont été primés. La Socolait leur a remis un diplôme attestant de leurs connaissances en la matière. Ci-dessous un exemple de diplôme ainsi que quelques photos de la cérémonie de remise des diplômes. 2) Qui devrait être formés à l'haccp (principes et applications): Tout le personnel : les services de production, maintenance, qualité, commercial 3) Quels sont les types de dangers qui peuvent concerner un aliment? Biologique : par exemple une contamination microbienne Physique : par exemple débris de verre Chimique : par exemple résidu de produits de nettoyage 4) Expliquer la méthode des 5M et donner des exemples La méthode 5M est un diagramme de cause à effets qui permet d identifier et de gérer des risques. Les 5M signifient : Milieu : l'environnement, le positionnement, le contexte. Main d œuvre : les interventions humaines. Matière : toutes les matières premières et consommables utilisés pour les processus de fabrication de conditionnement 5) Expliquer ce qu est un CCP et donner des exemples CCP : Contrôle des points critiques Etape du procédé à laquelle un moyen de maîtrise peut-être exercé afin de prévenir ou éliminer un danger menaçant la sécurité des aliments ou le ramener à un niveau acceptable 6) Expliquer ce qu est une limite critique Critère pour déterminer si un CCP est maîtrisé. Exemple : température de pasteurisation yaourt 95 C±2 C 7) Que retrouve-t-on dans les diagrammes HACCP: Les zones concernées, les intrants, les matières premières, les paramètres du process, les étapes à suivre, la gestion des déchets industriels, les ccp Matériel : l'équipement, les machines, le matériel informatique, les logiciels et les technologies Méthode : le mode opératoire, la logique du processus et la recherche et développement Nosoratan i / Ecrit par Bruno LANDRIER (Talen ny Ivo-Toerana / Directeur de Site) 8) Comment peut on prouver que les paramètres du process sont respectés? La preuve de la maitrise des paramètres est apportée par les enregistrements

11

12

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY MINISTERAN NY FAMBOLENA NY FIOMPIANA ARY NY JONO ----------------------------------- REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana ---------------------------------- MINISTERAN NY TOEKARENA

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar HUMBOLDT-UNIVERSITÄT ZU BERLIN Landwirtschaftlich-Gärtnerische Fakultät Schriftenreihe des Seminars für Ländliche Entwicklung VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA TATITRA ANIVON NY ANTENIMIERAM- PIRENENA Praiminisitra Jean RAVELONARIVO 1 TATITRA MANOLOANA NY ANTENIMIERA I 21 MAY 2015 21 MAY 2015 Andininy 54.- Ny Filohan ny Repoblika no manendry ny Praiminisitra

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

Note pratique. Réseau PRATIQUES

Note pratique. Réseau PRATIQUES Note pratique Ny Herin ny hafatra / Le pouvoir des messages pour la santé préventive Expérience du programme de santé materno-infantile mené par Inter Aide à Farafangana, Madagascar Notice Type de document

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Ventin-kevitra Matoan-dahatsoratra Fampahafantarana an i Madagasikara 4 Ny Nosy Telma, mpandraharaha nasionaly manara-penitra iraisam-pirenena

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

Conversations en ligne : descriptions, perspectives. Louise Ouvrard

Conversations en ligne : descriptions, perspectives. Louise Ouvrard Conversations en ligne : descriptions, perspectives Eléments théoriques La variation Quelques caractéristiques du discours électronique La langue malgache Le corpus Présentation Analyse Quels apports à

Plus en détail

Le malgache. L exemple d une langue sans test

Le malgache. L exemple d une langue sans test Le malgache L exemple d une langue sans test 1. Pourquoi n existe t il pas de cer:fica:on? Peu d échanges commerciaux avec l extérieur Pas d immigra:on importante de «cols blancs» Peu d étudiants étrangers

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES DEPARTEMENT INTERDISCIPLINAIRE DE FORMATION PROFESSIONNELLE COMMUNICATION ET DYNAMIQUE LOCALE RAPPORT

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

PROJET DE LOI N 027/2007

PROJET DE LOI N 027/2007 REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PROJET DE LOI N 027/2007 DU 25 OCTOBRE 2007 PORTANT LOI DE FINANCES POUR 2008 IMPRIMERIE NATIONALE 2007 - 2 - PROJET DE LOI N 027/2007 PORTANT

Plus en détail

Évaluation de l impact environnemental et social

Évaluation de l impact environnemental et social RÉPUBLIQUE DE MADAGASCAR Tanindrazana - Fahafahana - Fandrosoana PRÉSIDENCE PROJET PÔLE INTÉGRÉS DE CROISSANCE Secrétariat National Évaluation de l impact environnemental et social Cadre de politique de

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

MpANAMORY RAdO RABARILALA

MpANAMORY RAdO RABARILALA ENIM-BOLANA TSY TAFATSANGANA FANJAITRA MIISA 21 NO NESORINA TAO AN-KIBON i LALAINA P.06 N 3190 L u n d i 2 9 j u i n 2 0 1 5 PRIX : Ar 400 zatovolahy NANGALATRA volamena P.06 TENY AM-pASANA : NANONOFY

Plus en détail

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent cyan magenta jaune noir PROGRAMME P.7 RENCONTRE DE VONTOVORONA POSSIBLE ECHEC Les partis et associations de GRATUIT QUOTIDIEN D INFORMATION N 0137 DU Mercredi 25 Août 2010 FIARAHAMONINA HADIHADIANA NY

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE -----------------------

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- MINISTERE DES TRANSPORTS ET DE LA METEOROLOGIE -------------- RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- I. CONTEXTE Malgré

Plus en détail

DISPOSITIONS COMMUNES

DISPOSITIONS COMMUNES ORDONNANCE N 62-074 du 29 SEPTEMBRE 19 62 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics. ( J.O. n 248 du 12.10.62 p. 2248 ) modifiée et complétée

Plus en détail

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA Public Disclosure Authorized a REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana JIRAMA JIRO SY RANO MALAGASY E1 403 VOL. 1 Public Disclosure Authorized Public Disclosure Authorized ÉVALUATION

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

masolavitra mensuel d informations régionales Edition Numéro 42 - Mai 2014

masolavitra mensuel d informations régionales Edition Numéro 42 - Mai 2014 masolavitra mensuel d informations régionales Edition Numéro 42 - Mai 2014 gratuit Sommaire Bonjour, Un peu plus de 900 millions d ariary. Tel est le montant total des nouveaux projets que l association

Plus en détail