Bioinformatique appliquée. Cours 4 BLAST. idée. lire un résultat de Blast. la famille Blast

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "Bioinformatique appliquée. Cours 4 BLAST. idée. lire un résultat de Blast. la famille Blast"

Transcription

1 Bioinformatique appliquée Cours 4 BLAST idée lire un résultat de Blast la famille Blast -1-

2 "quelle est la similarité entre ces 2 séquences? et donc: est-ce que ces deux séquences sont homologues?" "existe-t-il des séquences homologues à la mienne parmi toutes les séquences connues? " (ex: UniProt, ~ 12 millions de séquences, ~ 350 AA/seq) Smith & Waterman: s x 12 millions = 118 heures ~ 5 jours!! -2-

3 Comment trouver l'âme soeur? jeune homme bonne situ., aimant F. Cabrel, amat. Princ. de Clèves, cherche j.f. douce et aimante bonne cuis. pour repass. chem. et + si aff. envoyer photo + CV 250 candidatures, comment faire?? -3-

4 Comment trouver l'âme soeur? Solution 1: vous convoquez les 250 candidat(e)s pour une journée romantique à Disneyland avantage: vous êtes sûr de trouver la/le meilleur(e) candidat(e) parmi les 250 inconvénient: 1 journée / candidat(e) = 8 mois Solution 2: vous faites une pré-sélection sur les CV: écoute F. Cabrel lit la princesse de Clèves vous en convoquez 10 avantage: rapide!! efficace!! inconvénient: vous risquez de louper la perle rare

5 Comment trouver l'âme soeur? l'orthologue séquence prot., long. 650 AA, cherche séq. orthologue dans tout organisme; envoyer séq. + fiche Genbank 82,853,685 candidatures, comment faire?? -5-

6 Comment trouver l'âme soeur? l'orthologue Solution 1: vous alignez les 82,853,685 séquences avec N&W ou S&W avantage: vous êtes sûr de trouver la séquence la plus similaire ~ orthologue inconvénient: 132 jours... programmation dynamique exact Solution 2: vous faites une pré-sélection sur les séquences: vous alignez exactement ces séquences avec S&W avantage: rapide!! efficace!! inconvénient: vous risquez de louper la perle rare... BLAST heuristique -6-

7 Heuristique L'heuristique (du grec heuriskêin, «trouver») est l'utilisation de règles empiriques : pratiques, simples et rapides, facilitant la recherche des faits et l'analyse de situations, dans un objectif de résolution de problèmes et de prise de décision, dans un domaine particulier. [...] Les heuristiques trouvent cependant leur place dans les algorithmes qui nécessitent l'exploration d'un grand nombre de cas, car elles permettent de réduire leur complexité moyenne en examinant d'abord les cas qui ont le plus de chances de donner la réponse. Le choix d'une telle heuristique suppose de connaître déjà certaines propriétés statistiques sur l'ensemble d'instances du problème que l'on s'apprête à résoudre. [...]

8 Comment pré-sélectionner les séquences? - un exemple k YPSTL ma séquence une séquence dans SwissProt YPSTL Première idée: ne retenir que les séquences partageant au moins un mot de longueur k avec ma séquence -8-

9 Pourquoi cette présélection est-elle rapide? toutes les séquences de SwissProt sont indexées on détermine, pour tous les mots de longueurs k, la liste des séquences qui contiennent ce mot ici, k=6: 206 listes AAAAAA AAAAAA Q65342 P34887 P AAAAAD AAAAAD AAAAAC AAAAAC P55342 O635A4 Q55F36... P62413 P77624 Q25R42... AAAAAE AAAAAE AAAAAF AAAAAF O8872 Q2D53 T P62998 O82663 P

10 Pourquoi cette présélection est-elle rapide? AANQRLCGSHLVDALYLVCGERGFFYSPKGGIVEQCCHNTCS AANQRL Q65342 P34887 P GERGFF QCCHNT P55342 O635A4 Q55F36... P62413 P77624 Q25R42... VCGERG ANQRLC O8872 Q2D53 T P62998 O82663 P Que se passe-til si on change la valeur de k?

11 Quel est le choix optimal de la taille k? plus k est grand, plus le critère est strict risque de passer à côté de séquences orthologues! si k est trop petit, le critère n'est pas assez sélectif trop de séquences candidates uniquement les candidat(e)s aimant Le lac Huron dans la version 1985 de l'album Photos de voyages 1 candidat(e) tous les amateurs/trices de guitare 245/250 candidat(e)s Comment faire?

12 Quel est le choix optimal de la taille k? on applique un doublecritère: les séquences doivent partager 2 petits mots (au lieu d'un grand) tous les amateurs/trices de guitare qui en plus aiment la littérature 25/250 candidat(e)s ma séquence PKL LDP PKL LDP une autre séquence

13 heuristique de Blast ma séquence PKL une autre séquence PKV d d Etape 1: trouver 2 paires de mots "voisins" (s >= 11) à égale distance d dans les 2 séquences (d<40) LDP VDP PKL PKV s = 6+5+2=13 LDP VDP s = 6+4+2=

14 heuristique de Blast ma séquence SAGGCPKLIYTVSD SAGGCPKLIYTVSD SAGFCPKVVYTLSE une autre séquence score >S SAGFCPKVVYTLSE RSTGHLDPVSDFFG RSTGHLDPVSDFFG GSSGHVDPVSDFYG score >S GSSGHVDPVSDFYG Etape 2: vérifier que l'on peut étendre ces amorces pour obtenir des alignements sans gaps de score s>s

15 heuristique de Blast Etape 3: faire l'alignement local Smith & Waterman DLFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLQVTGVVVTDATLKNLGSVHVSK DSFGDLSNPGAV MGNPKVKAHGKKVLHSFGEGVHHLD NLKGTFAALSELHCDKL

16 BLAST, ou l'art du raccourci Smith-Waterman BLAST 1 séquence contre tout UniProt: 1 séquence contre tout UniProt: ~ 5 jours ~ 20 secondes

17 BLAST: comment vivre sans?

18 Google = fouiller l'internet Requête Portée [d'après P. Hingamp]

19 BLAST = fouiller les séquences biologiques Blast NCBI Requête Portée [d'après P. Hingamp] NR BLA ST SWISSPROT PDB

20 facile!! 1. requête (votre séquence) 2. portée (à qui vous voulez la comparer) 3. et hop!

21 Les résultats de BLAST 1. récapitulatif de la requête 2. représentation graphique des résultats 3. résumé des résultats 4. les alignements

22 Les résultats de BLAST quelle séquence a été soumise ("query") ; identifiant, longueur, type 1. récapitulatif de la requête quelle banque de donnée est interrogée? quel programme est utilisé?

23 Les résultats de BLAST 2. représentation graphique des résultats ce trait représente la séquence soumise (long. 253 AA) chaque trait de couleur représente un alignement entre la séquence de départ et une séquence de la banque de donnée sélectionnée couleur score longueur taille de l'alignement = HSP ("high scoring pair")

24 Les résultats de BLAST 3. résumé des résultats identifiant descriptif score couverture E-value chaque ligne du résumé correspond à un trait coloré dans la représentation graphique

25 Les résultats de BLAST 4. les alignements query la séquence soumise subject la séquence trouvée dans la bdd alignement = outil QUANTITATIF - scores - Expect (ou E-value) - % identité -% positif - # de gaps

26 Les paramètres cachés de BLAST nombre max. de séquences cibles seuil sur l'e-value taille de l'amorce choix de la matrice de substitution score des gaps pourquoi y a-t-il 2 paramètres??? - Existence - Extension

27 Scores et statistiques de BLAST cet alignement est plus réaliste (1 seul événement évolutif) CGATGCAGCAGCAGCATCG CGATGC------AGCATCG Match = +1 Gap = -1 (13 x 1) + (6 x -1) = 7.. que celui là!! (5 évènements évolutifs) CGATGCAGCAGCAGCATCG CG-TG-AGCA-CA--AT-G (13 x 1) + (6 x -1) = 7 les 2 alignements ont le même score

28 Scores et statistiques de BLAST cet alignement est plus réaliste (1 seul événement évolutif) CGATGCAGCAGCAGCATCG CGATGC------AGCATCG ouverture de gap (5 évènements évolutifs) CGATGCAGCAGCAGCATCG CG-TG-AGCA-CA--AT-G extension de gap (13 x 1) (6 x 1) = -3.. que celui là!! (13 x 1) - (5 x 10) - (6 x 1) = -43 insertion/délétion: 2 paramètres ouverture de gap (par ex -10) extension de gap (par ex -1) Principe de la facturation téléphonique vous payez 10 cts quand l'autre décroche puis 5 cts par minute de conversation

29 Scores et statistiques de BLAST le score final de l'alignement dépend: du choix de la matrice du choix des paramètres de gap difficile de comparer 2 scores si les paramètres ne sont pas identiques Solution: on normalise les scores λ S ln K S '= ln 2 λ et K sont des paramètres pré-calculés, score exprimé en bits

30 Avantage du score il permet de comparer 2 alignements, et de dire lequel est le meilleur gap: 11,1 longueur: 128 identité: 35% gap: 9,2 longueur: 86 identité: 39%

31 Exercice Calculez le score brut de l'alignement suivant M T Y H I N V M F - - L M I

32 Scores et statistiques de BLAST Monsieur, 46.6 bits, c'est un bon score? un étudiant de L2 (20 ans) Papa, 1 euro, c'est cher? ma fille Anna (8 ans) Posons la question autrement

33 Scores et statistiques de BLAST Monsieur, 46.6 bits, c'est un bon score? est ce qu'un score de 46.6 bits est le signe d'une véritable homologie?

34 est ce qu'un score de 46.6 bits est le signe d'une véritable homologie? 2 manières de répondre à cette question Contrôle positif: je prends des séquences dont je sais qu'elles sont homologues, et je regarde les scores: est-ce que j'obtiens des scores de 46.6?? si oui, la réponse est positive! Contrôle négatif: je prends des séquences dont je sais qu'elles ne sont PAS homologues, et je regarde les scores: est-ce que je vais obtenir des scores de 46.6? si oui, la réponse est négative

35 Scores et statistiques de BLAST Monsieur, 46.6 bits, c'est un bon score? est ce qu'un score de 46.6 bits est le signe d'une véritable homologie? Si les 2 séquences n'avaient aucune homologie, est ce qu'on aurait pu obtenir un score de 46.6?

36 Scores et statistiques de BLAST on va fabriquer une séquence artificielle de 253 acides aminés (= 253 AA tirés au hasard parmi les 20) >random sequence 1 consisting of 253 residues. AGCALTLIQRYCQDCGSPEVQTGSNPYAAAHHDMGSFGVACGQDEDKGCRAGGQDQGDVP PMNWTQACDSTTHYWQMCQHPINTWDSFKWFMRHKCWRQFQNFHVFPMVGDICQPLEKHI NKGMYPKAYLSKVWHEFWRCAVYNMHDMRCFFAKTEDTQWGYWPDAKLIRKKLFTDNDEL WTGNNWNAEHFFSQCQGIQDRKPHNWSIHLLNLCCGAFRTQFHGSGCRDVDTSWGWWIYY sa ga LCWVRIQMNEGFE n r s BLAST contre SwissProt h o a nt m ie ol og ie!! acid es amin és

37 Distribution de scores 6578 alignements avec score >= 25 4 alignements avec score >= 35 0 alignements avec score >=

38 est ce que cet alignement traduit une homologie entre les séquences? NON!!

39 Définition de l'e-value de BLAST E-value de X = on s'attendrait à trouver X alignements de score équivalent purement par chance contre une banque de données de taille équivalente s = 46 > Evalue = 4e-4 : je m'attends à trouver en moyenne alignements de score 46 purement par hasard (si je blaste 2500 séquences aléatoires, j'en obtiendrai ~ 1) s = 267 > Evalue = 1e-70: il faut que je blaste 1e70 séquences aléatoires avant de tomber au hasard sur un alignement de cette qualité

40 Définition de l'e-value de BLAST pas le signe d'une homologie zone incertaine ("twilight zone") homologie certaine faux-positifs: on a un alignement, mais les séquences ne sont pas homologues

41 SwissProt 530,000 séquences 149 millions d'aa BLAST ma séquence BLAST est ce que l'e-value sera plus grand, plus petit ou identique? nr-prot 12 millions de séquences SwissProt 400,000 séquences 149 millions d'aa

42 BLAST must-know BLAST= programme d'alignements locaux, permettant d'interroger une base de données de séquences à partir d'une séquence ("query") résultat: liste d'hsp (high scoring pairs = alignements) avec % identité, % positif, %gaps score brut, score en bits, E-value E-value = valeur statistique : combien d'hsp de même score aurions nous obtenu au hasard contre une base de données aléatoire de même taille? E-value diminue lorsque le score augmente: E-val < 10-10: homologie très probable; algorithme heuristique: BLAST prend des raccourcis, mais trouve généralement la meilleure solution (=l'alignement de plus haut score)

43 les séries à succès... blastn blastp blastx tblastn tblastx psi-blast

44 La famille BLAST: vous avez une séquence... nucléique protéique...que vous voulez comparer à une banque de données... nucléique protéique blastn blastx blastp

45 Blastx ou l'art de comparer des acides aminés et des nucléotides >marine metagenome JCVI_SCAF_ GAAGATGAGGCGCACAAAACGGCCTTTGAAGCGCTGGTTAAAGCGGCTAAAATAAACGGAATTAACGGTC ACCGCGATGTTGGTGGTTACCGTGCATCGATGTACAATGCACTAGGCTTAGACAGTGTTCAGGCGTTAGT GGATTGTATGCAAGAATTAGAAAACACACACGCATGAAAGTATTAGCAAACGACGGAATTTCAGCTTCGG GAATCGCAGCGATAGAGGCTTCAGGGCACGAATTAATCACCACTAAAGTCGCTCAAGAGCAACTGGAAAG CTACATCAACGAACACCAGATTGATGTGGTTTTGGTGCGTTCAGCAACTACGGTGCGCAAGGAATTGATT GATGCATGTCCTTCAATAAAAGGCATCGGTCGCGGTGGCGTAGGTATGGATAATATCGATGTGGCGTATG Est ce que cette séquence d'adn/arn code pour une protéine? Est ce que sa traduction ressemble à une protéine connue?

46 Blastx combien de traductions possibles d'un fragment d'adn? 3 cadres de lecture directs 3 cadres de lecture reverse E D E A H K T A F E A L V K A A K I N G K M R R T K R P L K R W L K R L K. T E R. G A Q N G L. S A G. S G. N K R N GAAGATGAGGCGCACAAAACGGCCTTTGAAGCGCTGGTTAAAGCGGCTAAAATAAACGGA CTTCTACTCCGCGTGTTTTGCCGGAAACTTCGCGACCAATTTCGCCGATTTTATTTGCCT F I L S L H S R P A V A C F C L R F V G P A K R K F Q S R L A Q A S N P T F. L R L A S P A F. L Y F I V L F S R P F I 1 fragment d'adn/arn = 6 «protéines»

47 Blastx 1 séquence d'adn traduction dans les 6 cadres de lecture (= 6 «proteines») Blast protéique (Blastp) de chacune des 6 contre une banque de donnée protéique la traduction dans le cadre +3 a une forte similarité locale avec ZP_ de même que la traduction dans le cadre

48 blastx Est ce que mon fragment d'adn code pour une protéine déjà connue? ADN ARN 6 "proteines" Banque de données protéiques traduction dans les 6 cadres de lecture Blastp

49 tblastn protéine Est-ce que le génome de la levure code pour une protéine homologue de l'insuline humaine? Banque de données nucléique Banque de données protéiques traduction dans les 6 cadres de lecture Blastp

50 tblastx ADN ARN 6 "proteines" ( à vous d'inventer la question qui va avec...) Banque de données nucléique Banque de données protéiques traduction dans les 6 cadres de lecture Blastp

51 La famille BLAST: vous avez une séquence... nucléique protéique...que vous voulez comparer à une banque de données... nucléique protéique blastn tblastx tblastn blastx blastp psi-blast

Plan. Comparaison de 2 séquences. Dotplot, alignement optimal Recherche de similarité. Alignement multiple. Phylogénie moléculaire

Plan. Comparaison de 2 séquences. Dotplot, alignement optimal Recherche de similarité. Alignement multiple. Phylogénie moléculaire Plan 1 Banques de données 2 Comparaison de 2 séquences Dotplot, alignement optimal Recherche de similarité 3 Alignement multiple l 4 Phylogénie moléculaire Recherche de similarité 1 séquence (Query) comparée

Plus en détail

Comparaison et alignement de séquences 2

Comparaison et alignement de séquences 2 Comparaison et alignement de séquences 2 LV348 -BI Sophie Pasek sophie.pasek@upmc.fr Comment comparer une séquence contre une banque? Comparaison séquence/banque Pourquoi? : Réunir un échantillon taxonomique

Plus en détail

Recherche par similarité dans les banques/bases de données La suite Blast (Basic Local Alignment Search Tool)

Recherche par similarité dans les banques/bases de données La suite Blast (Basic Local Alignment Search Tool) Recherche par similarité dans les banques/bases de données La suite Blast (Basic Local Alignment Search Tool) A A C T G G T A A C C G A G C T A C G G T C C G Algorithme de Blast (version 1) (Altschul et

Plus en détail

Comparaison et alignement. de séquences 2 LV348 -BI. sophie.pasek@upmc.fr. Sophie Pasek

Comparaison et alignement. de séquences 2 LV348 -BI. sophie.pasek@upmc.fr. Sophie Pasek Comparaison et alignement de séquences 2 LV348 -BI Sophie Pasek sophie.pasek@upmc.fr Comment comparer une séquence contre une banque? Comparaison séquence/banque Pourquoi? : Réunir un échantillon taxonomique

Plus en détail

BIO6: Bioinformatique appliquée Correction du TD3

BIO6: Bioinformatique appliquée Correction du TD3 BIO6: Bioinformatique appliquée Correction du TD3 Exercice 1 : programmation dynamique voir le site web indiqué dans le TD pour corriger l'exercice Exercice 2 : similarité de séquence et distance évolutive

Plus en détail

TD Bioinformatique : Sequence Alignment. Pourquoi faire une recherche par similarité?

TD Bioinformatique : Sequence Alignment. Pourquoi faire une recherche par similarité? TD Bioinformatique : Sequence lignment Pourquoi faire une recherche par similarité? - Savoir si ma séquence ressemble à d'autres déjà connues. - Trouver toutes les séquences d'une même famille. - Rechercher

Plus en détail

La gestion de données dans le cadre d une application de recherche d alignement de séquence : BLAST.

La gestion de données dans le cadre d une application de recherche d alignement de séquence : BLAST. La gestion de données dans le cadre d une application de recherche d alignement de séquence : BLAST. Gaël Le Mahec - p. 1/12 L algorithme BLAST. Basic Local Alignment Search Tool est un algorithme de recherche

Plus en détail

Initiation à la Bioinformatique

Initiation à la Bioinformatique Université d Alexandrie Initiation à la Bioinformatique Basic Local Alignment Search Tool BLAST Université d Alexandrie AUF Auteur(s): Mohamed GAD 2009/2010 Auteur(s) : Mohamed GAD Professeur à l institut

Plus en détail

Algorithmes pour la comparaison de séquences II

Algorithmes pour la comparaison de séquences II Algorithmes pour la comparaison de séquences II Hélène TOUZET touzet@lifl.fr Equipe Bioinfo Master recherche informatique www.lifl.fr/~touzet/masterrecherche.html Pourquoi comparer des séquences? Puisque

Plus en détail

INTRODUCTION À LA BIO-INFORMATIQUE

INTRODUCTION À LA BIO-INFORMATIQUE Biologie moléculaire-2016 1 INTRODUCTION À LA BIO-INFORMATIQUE Dans cette section, on désire vous donner une introduction sur l utilisation du site web du National Center for Biotechnology Information

Plus en détail

Introduction à la bioinformatique

Introduction à la bioinformatique Faculté des Sciences - Rabat Laboratoire de Microbiologie et Biologie Moléculaire -------------------------------------- Université Mohamed V - Agdal Faculté des Sciences B.P. 1014 - Rabat - MAROC TD Biologie

Plus en détail

Alignement de séquences (2/2)

Alignement de séquences (2/2) Alignement de séquences (2/2) Observation à l aide de l outil graphique : le dotplot. Simple, visuel, Très informatif : Permet de repérer une similarité globale Permet de repérer des similarités locales

Plus en détail

Data Mining : la classification non supervisée

Data Mining : la classification non supervisée Data Mining : la classification non supervisée Clustering : une affaire de distance. Etude préliminaire. Valeurs discrètes. Soient les deux individus suivants correspondant à des séquences ADN : X = AGGGTGGC

Plus en détail

TD5 : Prédiction de la structure tridimensionnelle d une protéine Modélisation moléculaire

TD5 : Prédiction de la structure tridimensionnelle d une protéine Modélisation moléculaire TD5 : Prédiction de la structure tridimensionnelle d une protéine Modélisation moléculaire Vous aurez besoin des programmes suivant : d un éditeur de séquence d un visualiseur de structure 3D (PyMOL) Avant-propos

Plus en détail

Introduction à l annotation de séquences

Introduction à l annotation de séquences Introduction à l annotation de séquences - Université de Lille 1-2 eme Semestre But de l annotation de séquences Les séquences nucléiques : Détecter la présence de gènes Trouver la structure des gènes

Plus en détail

Étude de la biodiversité fongique à l aide de techniques de pyroséquençage

Étude de la biodiversité fongique à l aide de techniques de pyroséquençage Étude de la biodiversité fongique à l aide de techniques de pyroséquençage Biodiversité fongique Biodiversité: diversité spécifique d une communauté écologique, correspondant au nombre d espèces et à leur

Plus en détail

Les méthodes d optimisation appliquées à la conception de convertisseurs électromécaniques. Elec 2311 : S7

Les méthodes d optimisation appliquées à la conception de convertisseurs électromécaniques. Elec 2311 : S7 Les méthodes d optimisation appliquées à la conception de convertisseurs électromécaniques Elec 2311 : S7 1 Plan du cours Qu est-ce l optimisation? Comment l optimisation s intègre dans la conception?

Plus en détail

Fiche sujet candidat 1/2

Fiche sujet candidat 1/2 Fiche sujet candidat 1/2 Mise en situation et recherche à mener Dans le cytoplasme, la synthèse de protéine constitue l expression de l information génétique contenue dans l ADN. Pour aboutir à cette synthèse

Plus en détail

Corrigé du TD1. Exercice 1:

Corrigé du TD1. Exercice 1: Corrigé du TD1 Exercice 1: le but était d'aligner des séquences à la main et de compter les substitutions entre acides aminés observées. Le résultat se trouve à cette adresse: http://tagc.univ-mrs.fr/herrmann/bio6/displaymatrix.php

Plus en détail

Fiche technique : étudier les protéines avec UniProt

Fiche technique : étudier les protéines avec UniProt Fiche technique : étudier les protéines avec UniProt http://www.uniprot.org/ Objectifs : ce site en ligne «UniProt», pour Universal Protein Resource, permet d étudier les protéines dans un cadre évolutionniste.

Plus en détail

Corrigé Contrôle terminal : Bioanalyse (EL6BIOFM) 6 mai 2014

Corrigé Contrôle terminal : Bioanalyse (EL6BIOFM) 6 mai 2014 Corrigé Contrôle terminal : Bioanalyse (EL6BIOFM) 6 mai 2014 Exercice 1 (4,5 points) 1. Donner la définition de l acronyme BLAST. (0,5 pt) : Basic Local Alignment Search Tool 2. Expliquer les principes

Plus en détail

Recherche de similarités au moyen de BLAST

Recherche de similarités au moyen de BLAST Recherche de similarités au moyen de BLAST Guy Perrière Laboratoire de Biométrie et Biologie Évolutive UMR CNRS 5558 Université Claude Bernard Lyon 1 http://pbil.univ-lyon1.fr/members/perriere/cours/m1/

Plus en détail

Annotation in silico de séquences biologiques

Annotation in silico de séquences biologiques Annotation in silico de séquences biologiques Carl Herrmann TAGC Inserm U928 Université de la Méditerranée carl.herrmann@univmed.fr Pourquoi Diana est-elle ce qu'elle est...? génotype = l'information génétique

Plus en détail

Poker. A rendre pour le 25 avril

Poker. A rendre pour le 25 avril Poker A rendre pour le 25 avril 0 Avant propos 0.1 Notation Les parties sans * sont obligatoires (ne rendez pas un projet qui ne contient pas toutes les fonctions sans *). Celles avec (*) sont moins faciles

Plus en détail

Projet informatique «Voyageur de commerce» Résolution approchée par algorithme génétique du problème du voyageur de commerce

Projet informatique «Voyageur de commerce» Résolution approchée par algorithme génétique du problème du voyageur de commerce Année 2007-2008 Projet informatique «Voyageur de commerce» Résolution approchée par algorithme génétique du problème du voyageur de commerce B. Monsuez Projet informatique «Voyageur de commerce» Résolution

Plus en détail

Ordinateur, programme et langage

Ordinateur, programme et langage 1 Ordinateur, programme et langage Ce chapitre expose tout d abord les notions de programme et de traitement de l information. Nous examinerons ensuite le rôle de l ordinateur et ses différents constituants.

Plus en détail

TD5 : Prédiction de la structure tridimensionnelle d une protéine Modélisation moléculaire

TD5 : Prédiction de la structure tridimensionnelle d une protéine Modélisation moléculaire TD5 : Prédiction de la structure tridimensionnelle d une protéine Modélisation moléculaire Avant de commencer le TD, installer (ou vérifier qu ils le sont) sur la partition K: du poste de travail, les

Plus en détail

BIN 1002: INTÉGRATION BIOSCIENCES/INFORMATIQUE

BIN 1002: INTÉGRATION BIOSCIENCES/INFORMATIQUE BIN 1002: INTÉGRATION BIOSCIENCES/INFORMATIQUE Plan de Cours Automne 2015 Professeurs: Sylvie Hamel, Département d Informatique et de Recherche Opérationnelle Guillaume Lettre, Institut de Cardiologie

Plus en détail

BIOINFORMATIQUE APPLIQUÉE - CHMI 3206 F. Professeur : Eric R. Gauthier. Test de mi-session. 31 octobre Votre nom :

BIOINFORMATIQUE APPLIQUÉE - CHMI 3206 F. Professeur : Eric R. Gauthier. Test de mi-session. 31 octobre Votre nom : BIOINFORMATIQUE APPLIQUÉE - CHMI 3206 F Professeur : Eric R. Gauthier Test de mi-session 31 octobre 2006 Votre nom : Consignes : 1) Durée : 85 min 2) 5 questions sur 5 pages, pour 80 points. Compte pour

Plus en détail

Série 2 Premiers programmes

Série 2 Premiers programmes Licence pro. GTSBD 2013-2014 Structures de données, langage Python Série 2 Premiers programmes Programmes avec des affectations, des lectures et des écritures Exo 2.1 Le problème de la machine qui rend

Plus en détail

ANNEXE A. Décision du CCNR 11/12-1452+ V concernant L instant gagnant

ANNEXE A. Décision du CCNR 11/12-1452+ V concernant L instant gagnant ANNEXE A Décision du CCNR 11/12-1452+ V concernant L instant gagnant L instant gagnant est une émission télé-tirelire. Un animateur ou une animatrice présente des quizz et casse-têtes à l écran et invite

Plus en détail

Fida KHATER & Abdoulaziz MOUSSA 03 mars 2012 - Journée Portes Ouvertes à l'um2

Fida KHATER & Abdoulaziz MOUSSA 03 mars 2012 - Journée Portes Ouvertes à l'um2 DEVELOPPEMENT D UNE INTERFACE GRAPHIQUE : LOCAL WEB GUI FOR BLAST (LWBG), POUR LES TRAITEMENTS DE DONNEES BIOLOGIQUES Fida KHATER & Abdoulaziz MOUSSA 03 mars 2012 - Journée Portes Ouvertes à l'um2 Plan

Plus en détail

Exercices : Probabilités

Exercices : Probabilités Exercices : Probabilités Partie : Probabilités Exercice Dans un univers, on donne deux événements et incompatibles tels que =0, et =0,7. Calculer,, et. Exercice Un dé (à faces) est truqué de la façon suivante

Plus en détail

Heuristiques pour l alignement et la recherche dans les banques de données biologiques

Heuristiques pour l alignement et la recherche dans les banques de données biologiques Heuristiques pour l alignement et la recherche dans les banques de données biologiques Plan I. Introduction II. Matrices de substitutions: PAM, BLOSUM III. Algorithmes de Filtrage Basés sur la recherche

Plus en détail

Corrigé du baccalauréat ES Antilles Guyane 24 juin 2015

Corrigé du baccalauréat ES Antilles Guyane 24 juin 2015 Corrigé du baccalauréat ES Antilles Guyane 2 juin 2015 EXERCICE 1 Commun à tous les candidats Aucune justification n était demandée dans cet exercice. 1. La fonction f définie sur R par f (x)= x 3 + 6x

Plus en détail

différence groupe-conseil en statistique

différence groupe-conseil en statistique Vais-je atteindre mon objectif cette année? Par Martin Carignan, associé chez Différence www.difference-gcs.com Contexte Les gestionnaires sont souvent évalués sur des résultats mesurés par des indicateurs

Plus en détail

TD- Le calcul de la mobilité sociale

TD- Le calcul de la mobilité sociale TD- Le calcul de la mobilité sociale L objectif de ce TD est de vous montrer comment les sociologues calculent la mobilité sociale intergénérationnelle dans un pays. Pour ce faire, on va calculer des «tables

Plus en détail

Épreuve de mathématiques Terminale ES 200 minutes

Épreuve de mathématiques Terminale ES 200 minutes Examen 2 Épreuve de mathématiques Terminale ES 200 minutes L usage de la calculatrice programmable est autorisé. La bonne présentation de la copie est de rigueur. Cet examen comporte 7 pages et 5 exercices.

Plus en détail

Questionnaire. Questionnaire. www.quint-essenz.ch Promotion Santé Suisse, Avenue de la Gare 52, CH-1001 Lausanne. Fonction

Questionnaire. Questionnaire. www.quint-essenz.ch Promotion Santé Suisse, Avenue de la Gare 52, CH-1001 Lausanne. Fonction Version: 2.0 / 14.10.2003 / 1 Fonction En général, pour les projets de prévention et de promotion de la santé, on utilise un questionnaire pour obtenir des informations et/ou des données sur des avis ou

Plus en détail

Identification de nouveaux membres dans des familles d'interleukines

Identification de nouveaux membres dans des familles d'interleukines Identification de nouveaux membres dans des familles d'interleukines Nicolas Beaume Jérôme Mickolajczak Gérard Ramstein Yannick Jacques 1ère partie : Définition de la problématique Les familles de gènes

Plus en détail

Gérer un site internet simple

Gérer un site internet simple TUTORIEL Gérer un site internet simple Pourquoi avoir un site internet? Table of Contents Table of Contents... 2 Étape 1 : créer un compte Google (Gmail)... 3 Etape 2 : créer un site internet Google...

Plus en détail

Ma banque, mes emprunts et mes intérêts

Ma banque, mes emprunts et mes intérêts Ma banque, mes emprunts et mes intérêts Alexandre Vial 0 janvier 2009 Les intérêts cumulés Je place 00 e à 4% par an pendant un an. Donc au bout d un an, j ai 00 + 00. 4 = 00 00( + 4 ) =04 e. 00 Cependant,

Plus en détail

QUESTIONNAIRE CAHIER DES CHARGES POUR FACILITER LA CREATION DE VOTRE SITE WEB

QUESTIONNAIRE CAHIER DES CHARGES POUR FACILITER LA CREATION DE VOTRE SITE WEB QUESTIONNAIRE CAHIER DES CHARGES POUR FACILITER LA CREATION DE VOTRE SITE WEB 1. Quel est mon idée? Mon concept? Un site vitrine Un portfolio Un site de commerce 2. Quel est l objectif de mon site? 3 quels

Plus en détail

Chapitre 3 : INFERENCE

Chapitre 3 : INFERENCE Chapitre 3 : INFERENCE 3.1 L ÉCHANTILLONNAGE 3.1.1 Introduction 3.1.2 L échantillonnage aléatoire 3.1.3 Estimation ponctuelle 3.1.4 Distributions d échantillonnage 3.1.5 Intervalles de probabilité L échantillonnage

Plus en détail

Initiation à la Bioinformatique Daniel Gautheret ESIL, Université de la Méditerranée

Initiation à la Bioinformatique Daniel Gautheret ESIL, Université de la Méditerranée Initiation à la Bioinformatique Daniel Gautheret ESIL, Université de la Méditerranée V.2004.4 http://www.esil.univ-mrs.fr/~dgaut/cours Bioinformatique Deux définitions possibles Applications de l informatique

Plus en détail

Fiche Pratique. MAJ le 10/04/2013

Fiche Pratique. MAJ le 10/04/2013 MAJ le 10/04/2013 Présentation du problème Vous avez deux choses à sauvegarder : 1. Votre système avec vos logiciels. On utilise dans ce cas un logiciel payant comme true image ou un logiciel gratuit comme

Plus en détail

GoogleAdwords Marketing

GoogleAdwords Marketing GoogleAdwords Marketing Vous apprenez à utiliser l instrument de marketing efficace et économique «de GoogleAdwords» Worldsoft SA Couverture 1 Publicité avec Google AdWords Table des matières 2 Table des

Plus en détail

UNE EXTENSION DU MODELE DE CONSOMMATION DES MENAGES L'OFFRE DE TRAVAIL

UNE EXTENSION DU MODELE DE CONSOMMATION DES MENAGES L'OFFRE DE TRAVAIL UNE EXTENSION DU MODELE DE CONSOMMATION DES MENAGES L'OFFRE DE TRAVAIL I P L A N... A Arbitrage entre consommation et travail B Effets de l'augmentation du salaire C Déterminants de l'offre du travail

Plus en détail

Comment maximiser le référencement de votre site e-commerce en 15 minutes Tout le monde veut optimiser le référencement de son site.

Comment maximiser le référencement de votre site e-commerce en 15 minutes Tout le monde veut optimiser le référencement de son site. Comment maximiser le référencement de votre site e-commerce en 15 minutes Tout le monde veut optimiser le référencement de son site. C est simple, pas une semaine ne se passe sans qu un nouvel article

Plus en détail

TD 1 Biais de codons

TD 1 Biais de codons Module LV348 Version enseignant TD 1 page 1/7 TD 1 Biais de codons Revu dernièrement par Mathilde Carpentier, Cyril Gallut et Joël Pothier Version du 15 janvier 2014 L objectif de ce TP est de prendre

Plus en détail

Fiche technique : utilisation d Anagène (logiciel d étude des données moléculaires).

Fiche technique : utilisation d Anagène (logiciel d étude des données moléculaires). Fiche technique : utilisation d Anagène (logiciel d étude des données moléculaires). Objectifs de la fiche : 1. Ouvrir des séquences (ADN ou protéine). 2. Changer de règle de numérotation & faire apparaître

Plus en détail

Simulateur de coûts de médicaments Foire aux questions

Simulateur de coûts de médicaments Foire aux questions ASSURANCE COLLECTIVE Simulateur de coûts de médicaments Foire aux questions Pour une vue détaillée de l outil, consultez l aide-mémoire qui est accessible à partir de la section «Liens utiles» du simulateur.

Plus en détail

Le Bandonote est un jeu de cartes visant à favoriser la mémorisation des touches du bandonéon bisonique, 142 touches, AA.

Le Bandonote est un jeu de cartes visant à favoriser la mémorisation des touches du bandonéon bisonique, 142 touches, AA. Le Bandonote est un jeu de cartes visant à favoriser la mémorisation des touches du bandonéon bisonique, 142 touches, AA. Ce jeu a suscité la curiosité, en particulier de la part d'étudiants débutants.

Plus en détail

Chapitre 1 I:\ Soyez courageux!

Chapitre 1 I:\ Soyez courageux! Chapitre 1 I:\ Soyez courageux! Pour ne rien vous cacher, le langage d'assembleur (souvent désigné sous le terme "Assembleur", bien que ce soit un abus de langage, puisque "Assembleur" désigne le logiciel

Plus en détail

La signature électronique et les réseaux de confiance

La signature électronique et les réseaux de confiance La signature électronique et les réseaux de confiance Marc.Schaefer@he-arc.ch HE-Arc Ingénierie Institut des systèmes d'information et de communication (ISIC) Laboratoire de téléinformatique (TINF) Plan

Plus en détail

Soutien illimité 7j/7 en maths: Coach, profs, exercices & annales, cours. Sujet de Bac 2013 Maths S Obligatoire & Spécialité - Amérique du Nord

Soutien illimité 7j/7 en maths: Coach, profs, exercices & annales, cours. Sujet de Bac 2013 Maths S Obligatoire & Spécialité - Amérique du Nord Sujet de Bac 2013 Maths S Obligatoire & Spécialité - Amérique du Nord EXERCICE 1 : 5 points On se place dans l espace muni d un repère orthonormé. On considère les points,, et. 1. Démontrer que les points,

Plus en détail

Guide pratique : Les coûts d emprunt d argent

Guide pratique : Les coûts d emprunt d argent QUESTION Guide pratique : Les coûts d emprunt Commanditaire fondateur ABC Alpha pour la vie Canada Guide pratique Question : Les coûts d emprunt Faire l épicerie coûte de l argent. Les vêtements coûtent

Plus en détail

Rolf Wipfli & Baptiste Ossipow 1.4.2007

Rolf Wipfli & Baptiste Ossipow 1.4.2007 Plan test d'utilisation Dans notre test d'utilisation nous voulons évaluer le site Jobber [1]. Notre but est tout d'abord de vérifier l'utilisabilité du site, donc de tester si les fonctionnalités qui

Plus en détail

Lancer FASTA et BLAST en ligne de commande

Lancer FASTA et BLAST en ligne de commande Lancer FASTA et BLAST en ligne de commande V.2006.1 http://www.esil.univ-mrs.fr/~dgaut/cours Daniel Gautheret ESIL, Université de la Méditerranée Fasta Article original: Lipman and Pearson (1985) Science

Plus en détail

D après une idée originale dans «Les maths au quotidien» M.Colonval et A.Roumadni éd. Ellipses

D après une idée originale dans «Les maths au quotidien» M.Colonval et A.Roumadni éd. Ellipses LES ABEILLES D après une idée originale dans «Les maths au quotidien» M.Colonval et A.Roumadni éd. Ellipses 1. Présentation de la trame : Recherche et synthèse d infos Notion d optimisation Intérêt et

Plus en détail

Introduction à la Bio-Informatique IFT3295/IFT6291/BIN6000. Nadia El-Mabrouk DIRO, Université de Montréal

Introduction à la Bio-Informatique IFT3295/IFT6291/BIN6000. Nadia El-Mabrouk DIRO, Université de Montréal Introduction à la Bio-Informatique IFT3295/IFT6291/BIN6000 Nadia El-Mabrouk DIRO, Université de Montréal Qu est-ce que la Bioinformatique? Qu est-ce que la Bio-informatique? Champs multi-disciplinaire

Plus en détail

Intelligence Artificielle Jeux

Intelligence Artificielle Jeux Intelligence Artificielle Jeux Bruno Bouzy http://web.mi.parisdescartes.fr/~bouzy bruno.bouzy@parisdescartes.fr Licence 3 Informatique UFR Mathématiques et Informatique Université Paris Descartes Programmation

Plus en détail

I Exercices. 1 Définition de suites. 2 Sens de variation d une suite

I Exercices. 1 Définition de suites. 2 Sens de variation d une suite I Exercices 1 Définition de suites Pour toutes les suites (u n ) définies ci-dessous, on demande de calculer u 1, u, u 3 et u 6 1 u n = 7n n + { u0 = u n+1 = u n + 3 3 u n est le n ième nombre premier

Plus en détail

QMF-6. Questionnaire de Motivation à la réussite en Formation RÉSULTATS. Yann FORNER XV41ZUJK 15/04/2010 TATA. Féminin. Lycéens.

QMF-6. Questionnaire de Motivation à la réussite en Formation RÉSULTATS. Yann FORNER XV41ZUJK 15/04/2010 TATA. Féminin. Lycéens. Questionnaire de Motivation à la réussite en Formation Yann FORNER RÉSULTATS Nom: Sexe: 15/04/2010 Féminin Âge: 17 Étalonnage: Lycéens Introduction Le Questionnaire de Motivation en situation de Formation

Plus en détail

Stratégies et construction

Stratégies et construction Stratégies et construction Sébastien MARTINEAU Été 2008 Exercice 1 (Niveau 2). Sur une règle d 1 mètre de long se trouvent 2008 fourmis. Chacune part initialement, soit vers la gauche, soit vers la droite,

Plus en détail

Niveau. Situation étudiée. Type d activité. Durée. Objectifs. Seconde.

Niveau. Situation étudiée. Type d activité. Durée. Objectifs. Seconde. Simuler des expériences aléatoires avec une calculatrice Niveau Seconde. Situation étudiée Différentes selon les séances : Séance 1 : Jeu de pile ou face, tirages de boule dans une urne avec des proportions

Plus en détail

Équations et inéquations du 1 er degré

Équations et inéquations du 1 er degré Équations et inéquations du 1 er degré I. Équation 1/ Vocabulaire (rappels) Un équation se présente sous la forme d'une égalité constituée de nombres, de lettres et de symboles mathématiques. Par exemple

Plus en détail

Le sujet traite de l'étude des Amida-Kuji, jeu de hasard japonais.

Le sujet traite de l'étude des Amida-Kuji, jeu de hasard japonais. Amida-kuji Collège Mario Meunier Montbrison (42) Année 2012/2013 Elèves: AIRED A. (4ème 3) BAROU C. (4ème 2) BLANC A. (4ème 9) BOS T. (4ème 3) BRUYERE T. (4ème 9) CHAUMETTE C. (4ème 9) CHERMANNE M. (3ème

Plus en détail

1 Une simple histoire de production, et déjà des calculs

1 Une simple histoire de production, et déjà des calculs Université François Rabelais - L AES Cours d Economie Générale Enoncé du TD n 7 Automne 202 Une simple histoire de production, et déjà des calculs Vous considérez dans cet exercice une firme qui a la possibilité

Plus en détail

AIDE EN LIGNE ESPACE EPARGNANTS

AIDE EN LIGNE ESPACE EPARGNANTS Bienvenue sur votre aide en ligne. Cette aide vise à vous présenter les différentes fonctionnalités de votre espace personnalisé. En cliquant sur une des rubriques ci-dessous, vous découvrirez les réponses

Plus en détail

Utilisation des diagrammes de Voronoï et des algorithmes génétiques pour l'étude des complexes protéine-protéine.

Utilisation des diagrammes de Voronoï et des algorithmes génétiques pour l'étude des complexes protéine-protéine. Utilisation des diagrammes de Voronoï et des algorithmes génétiques pour l'étude des complexes protéine-protéine. Anne Poupon Biologie et Bioinformatique des Systèmes de Signalisation INRA - Nouzilly France

Plus en détail

Chapitre VI Échantillonages et simulations

Chapitre VI Échantillonages et simulations Chapitre VI Commentaires : Récursivement, les commentaires ne sont pas à l attention des élèves.. Fluctuation d échantillonnage Définition : En statistiques, un échantillon de taille n est la liste des

Plus en détail

UNIVERSITE SAAD DAHLAB DE BLIDA

UNIVERSITE SAAD DAHLAB DE BLIDA Chapitre 5 :. Introduction aux méthodes par séparation et évaluation Les méthodes arborescentes ( Branch and Bound Methods ) sont des méthodes exactes d'optimisation qui pratiquent une énumération intelligente

Plus en détail

Cours 4 : Python, listes et boucles

Cours 4 : Python, listes et boucles Cours 4 : Python, listes et boucles Listes Les listes contiennent un tableau de données : patients = ["Jean Dupont", "Paul Dubois", "Marianne Y"] Il est possible de mélanger des types différents : chromosomes_recombines

Plus en détail

Affiliation Cash Livre PDF Gratuit Cliquez Ici Pour Télécharger Merci!

Affiliation Cash Livre PDF Gratuit Cliquez Ici Pour Télécharger Merci! Enfin, Voici l'information que VOUS attendiez depuis longtemps. Vous allez découvrir une méthode inédite et des secrets que la plupart des affiliés ne connaitront jamais... Par: Mustapha GASSEM Le Dans

Plus en détail

T A B L E A U X D O B J E T S E T D A T A B I N D I N G

T A B L E A U X D O B J E T S E T D A T A B I N D I N G T A B L E A U X D O B J E T S E T D A T A B I N D I N G L AUTEUR DE CE TUTORIEL Dominique DAUSSY 3 Place de la Galaxie 76400 TOUSSAINT Mail : daussy.dominique@orange.fr Web : http://dominique-daussy.fr

Plus en détail

Anagène. Démarrer avec le logiciel. Ressources. Traitements courants. Aller plus loin

Anagène. Démarrer avec le logiciel. Ressources. Traitements courants. Aller plus loin Anagène Anagène est un logiciel conçu par le CNDP et INRP. Il est destiné à l'exploitation pédagogique de données moléculaires : séquences de gènes et de protéines. L'élève peut ainsi travailler sur des

Plus en détail

ALIGNEMENT PLUS RAPIDE

ALIGNEMENT PLUS RAPIDE ALIGNEMENT PLUS RAPIDE 1. méthodes heuristiques : hachage, arbres de suffixe, PD limitée (taille totale de trous bornée) 2. PD éparse (pour sous-séquence commune ou chaînage en alignement global heuristique)

Plus en détail

Problème du voyageur de commerce par algorithme génétique

Problème du voyageur de commerce par algorithme génétique Problème du voyageur de commerce par algorithme génétique 1 Problème du voyageur de commerce Le problème du voyageur de commerce, consiste en la recherche d un trajet minimal permettant à un voyageur de

Plus en détail

QMP-7. Questionnaire de Motivation à la réussite en situation Professionelle RÉSULTATS. Yann FORNER U55MA65U 08/01/2014 MIAOU. Masculin.

QMP-7. Questionnaire de Motivation à la réussite en situation Professionelle RÉSULTATS. Yann FORNER U55MA65U 08/01/2014 MIAOU. Masculin. Questionnaire de Motivation à la réussite en situation Professionelle Yann FORNER RÉSULTATS Nom: Sexe: 08/01/2014 Masculin Âge: 37 Introduction Le Questionnaire de Motivation en situation Professionnelle

Plus en détail

MANUEL DE FORMATION DE CONVERSION EN BASES DE DONNÉES

MANUEL DE FORMATION DE CONVERSION EN BASES DE DONNÉES MANUEL DE FORMATION DE CONVERSION EN BASES DE DONNÉES VERSION 6.03 1, rue de la Martinerie 78610 LE PERRAY EN YVELINES SUPPORT TECHNIQUE Tél. : +33-(02).99.73.52.06 Adresse e-mail : support@euroid.fr Site

Plus en détail

Homéoallèles. Analyse différentielle. Normalisation. NGS Transcriptomique Python R. Blé RNA-seq

Homéoallèles. Analyse différentielle. Normalisation. NGS Transcriptomique Python R. Blé RNA-seq Présenté par Xi LIU ATCGCGCTAGCTGGTGTATCGCATCGCGCTAGCTGGTGTATCGCGCTAGCTGGTGTATCGCGCTAGCCTGGTGTATCGCCATCGCGCTAGCTGGCGCTAGCTGAATCGCGCATATG 17 Septembre 2013 Homéoallèles Génome Normalisation Analyse différentielle

Plus en détail

Windows XP. Microsoft. Sommaire :

Windows XP. Microsoft. Sommaire : Microsoft Windows XP Sommaire : OUVERTURE DE SESSION...2 LE BUREAU...3 CHANGER D ENVIRRONEMENT...4 NOUVEAU RACCOURCI...7 LE MENU DEMARRER...9 LES PROGRAMMES AU DEMARRAGE...11 LA GESTION DES FICHIERS...12

Plus en détail

choisir H 1 quand H 0 est vraie - fausse alarme

choisir H 1 quand H 0 est vraie - fausse alarme étection et Estimation GEL-64943 Hiver 5 Tests Neyman-Pearson Règles de Bayes: coûts connus min π R ( ) + ( π ) R ( ) { } Règles Minimax: coûts connus min max R ( ), R ( ) Règles Neyman Pearson: coûts

Plus en détail

AVL Liban La Bioinformatique. Bioinformatique

AVL Liban La Bioinformatique. Bioinformatique AVL Liban 2011 La Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu www.cs.sjsu.edu/faculty/khuri Sami Khuri sami.khuri@sjsu.edu Qu est-ce

Plus en détail

Prédiction de gènes. Cours de présentation des outils bio-informatiques pour la localisation puis l'étude des gènes. Equipe Bonsai (2014)

Prédiction de gènes. Cours de présentation des outils bio-informatiques pour la localisation puis l'étude des gènes. Equipe Bonsai (2014) Prédiction de gènes Cours de présentation des outils bio-informatiques pour la localisation puis l'étude des gènes Equipe Bonsai (2014) La localisation des gènes C'est la première étape pour interpréter

Plus en détail

Baccalauréat ES Polynésie 7 juin 2013

Baccalauréat ES Polynésie 7 juin 2013 Baccalauréat ES Polnésie 7 juin 2013 EXERCICE 1 Cet exercice est un questionnaire à choix multiples. Pour chaque question, une seule des quatre réponses proposées est correcte. Une réponse juste rapporte

Plus en détail

AQESSS - ÉTUDE AUPRÈS DES QUÉBÉCOIS É SUR L INFORMATISATION CLINIQUE LA SANTÉ ÉLECTRONIQUE. De la vie aux idées 4 OCTOBRE 2011

AQESSS - ÉTUDE AUPRÈS DES QUÉBÉCOIS É SUR L INFORMATISATION CLINIQUE LA SANTÉ ÉLECTRONIQUE. De la vie aux idées 4 OCTOBRE 2011 AQESSS - ÉTUDE AUPRÈS DES QUÉBÉCOIS É SUR L INFORMATISATION CLINIQUE COLLOQUE EXPOSITION LA SANTÉ ÉLECTRONIQUE 4 OCTOBRE 2011 De la vie aux idées TABLE DES MATIÈRES CONTEXTE ET OBJECTIFS 3 FAITS SAILLANTS

Plus en détail

BIOINFORMATIQUE APPLIQUEE (BI4U2) EXAMEN DE SECONDE SESSION JUIN 2013

BIOINFORMATIQUE APPLIQUEE (BI4U2) EXAMEN DE SECONDE SESSION JUIN 2013 Année universitaire 2012/2013 Site : X Luminy X St-Charles o St-Jérôme o Cht-Gombert o Aix-Montperrin o Aubagne-SATIS Sujet session de : o 1 er semestre - o 2 ème semestre - X Session 2 Examen de : X L1/L2/oL3

Plus en détail

Crésus-facturation multilingue. Dès version 3.4

Crésus-facturation multilingue. Dès version 3.4 Crésus-facturation multilingue Dès version 3.4 2 Crésus-facturation multi-lingue 1 Introduction Comment faire des factures multilingues? Qu'est ce qu'une facturation multilingue? Pour le logiciel Crésus-facturation,

Plus en détail

ORGANISATION ET GESTION DE DONNÉES

ORGANISATION ET GESTION DE DONNÉES ORGANISATION ET GESTION DE DONNÉES DO.01 Lire un problème DO.02 Résoudre un problème DO.03 Rédiger la solution d'un problème DO.04 Lire un tableau DO.0 Construire un tableau DO.06 Lire un graphique DO.07

Plus en détail

La recherche d emploi, comment l aborder de façon différente?

La recherche d emploi, comment l aborder de façon différente? La recherche d emploi, comment l aborder de façon différente? Conseillère en emploi aux cycles supérieurs Service des stages et du placement (514) 340-4711 poste 5908 Local: C-563 guylaine.dubreuil@polymtl.ca

Plus en détail

Outil pour l attribution des notes

Outil pour l attribution des notes Outil pour l attribution des notes Gilbert Babin A- Contexte Le présent document décrit le mode d utilisation d un outil développé avec Microsoft Excel permettant l analyse et l attribution des notes finales.

Plus en détail

Guide Wilogo: Conseils pour écrire un brief parfait

Guide Wilogo: Conseils pour écrire un brief parfait Guide Wilogo: Conseils pour écrire un brief parfait Que ce soit pour un logo, un web design, des cartes de visite ou du papier à entête - Avec Wilogo vous avez décidé de choisir la meilleure solution de

Plus en détail

StatEnAction 2009/10/30 11:26 page 111 #127 CHAPITRE 10. Machines à sous

StatEnAction 2009/10/30 11:26 page 111 #127 CHAPITRE 10. Machines à sous StatEnAction 2009/0/30 :26 page #27 CHAPITRE 0 Machines à sous Résumé. On étudie un problème lié aux jeux de hasard. Il concerne les machines à sous et est appelé problème de prédiction de bandits à deux

Plus en détail

Algorithmique et Programmation Projets 2012/2013

Algorithmique et Programmation Projets 2012/2013 3 Dames 3. Objectif Il s agit d écrire un programme jouant aux Dames selon les règles. Le programme doit être le meilleur possible. Vous utiliserez pour cela l algorithme α β de recherche du meilleur coup

Plus en détail

Stratégie & Procédure de recrutement des mastères

Stratégie & Procédure de recrutement des mastères Université de Carthage Stratégie & Procédure de recrutement des mastères 2014-2015 Page 1/9 U n i v e r s i t é d e C a r t h a g e Institut des Hautes Etudes Commerciales Politique de recrutement des

Plus en détail

PROGRAMMATION DYNAMIQUE BIOINFORMATIQUE. DA IODAA AgroParisTech Christine MARTIN

PROGRAMMATION DYNAMIQUE BIOINFORMATIQUE. DA IODAA AgroParisTech Christine MARTIN PROGRAMMATION DYNAMIQUE BIOINFORMATIQUE DA IODAA AgroParisTech 2016-2017 Christine MARTIN INTRODUCTION LA BIO-INFORMATIQUE De Multiples définitions Domaine d interface Débuts dans les années 70 Résoudre

Plus en détail

Heuristique et métaheuristique. 8. Optimisation combinatoire et métaheuristiques. Optimisation combinatoire. Problème du voyageur de commerce

Heuristique et métaheuristique. 8. Optimisation combinatoire et métaheuristiques. Optimisation combinatoire. Problème du voyageur de commerce Heuristique et métaheuristique IFT1575 Modèles de recherche opérationnelle (RO) 8. Optimisation combinatoire et métaheuristiques Un algorithme heuristique permet d identifier au moins une solution réalisable

Plus en détail