Bibliographie Introduction à la bioinformatique

Dimension: px
Commencer à balayer dès la page:

Download "Bibliographie Introduction à la bioinformatique"

Transcription

1 Bibliographie Introduction à la bioinformatique 5. Les bases de données biologiques, SQL et la programmation Python/C++ Zvelebil et Baum, Understanding bioinformatics Beighley, Head First SQL Chari, A tutorial on DB concepts, SQL using MySQL at MySQL++ at Python MySQL : projects/mysql-python/ 1 2 Objectifs Expliquer pourquoi les bases de données sont importantes pour la bioinformatique Expliquer les structures et les types de bases de données différents Savoir où trouver quelles données biologiques Être capable de construire une base de données relationnelle Savoir comment normaliser des données pour une base de données relationnelle Être capable d utiliser des bibliothèques de programmation pour connecter un logiciel à une base de données Carte: traiter des bases de données 3 4

2 Les bases de données A cause de l explosion des données (séquences et structures) les bases de données (BD) ont joué un rôle important dés le début Collectionner les données dans un BD permet l analyse de ces données pour trouver des similarités La structure d une base de données Une BD est composé d un groupe de fichiers (flat-files) ou des tableaux (Base de données relationnelle) La naissance de la bioinformatique Parce que les données sont importantes pour l analyse et parce que les données sont disponibles pour tous le monde, on doit s assurer de la qualité des données Ces fichiers ou tableaux sont composés de plusieurs articles (records) et attributs (fields or attributes) 5 6 Fichier pour des séquences Fichier pour des séquences 2 Le format le plus bien connu pour les séquences est le format FASTA La première ligne (après le >) fournit l information au sujet du séquence La deuxième partie fournit le séquence (ici d une protéine) >sp P06241 FYN_HUMAN Proto-oncogene tyrosine-protein kinase Fyn OS=Homo sapiens GN=FYN PE=1 SV=3 MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL Le fichier qui est utilisé par UniProt ajoute des informations supplémentaires... DR EMBL; M14676; AAA ; -; mrna. DR EMBL; M14333; AAC ; -; mrna. DR EMBL; S74774; AAB ; -; mrna. DR EMBL; Z97989; CAI ; -; Genomic_DNA. FT TURN DR EMBL; Z97989; CAI ; -; Genomic_DNA. FT HELIX DR EMBL; BC032496; AAH ; -; mrna. FT HELIX DR IPI; IPI ; -. FT HELIX DR IPI; IPI ; -. FT HELIX DR IPI; IPI ; -. FT HELIX DR PIR; A24314; TVHUSY. FT HELIX ID FYN_HUMAN DR Reviewed; RefSeq; NP_ ; 537 AA. -. SQ SEQUENCE 537 AA; MW; 4A1E443A4B5A0977 CRC64; AC P06241; Q16248; Q5R3A6; DR Q5R3A7; RefSeq; Q8N5D7; NP_ ; -. MGCVQCKDKE ATKLTEERDG SLNQSSGYRY GTDPTPQHYP SFGVTSIPNY NNFHAAGGQG DT 01-JAN-1988, integrated DR into RefSeq; UniProtKB/Swiss-Prot. NP_ ; -. LTVFGGVNSS SHTGTLRTRG GTGVTLFVAL YDYEARTEDD LSFHKGEKFQ ILNSSEGDWW DT 23-JAN-2007, sequence DR version UniGene; 3. Hs ; -. EARSLTTGET GYIPSNYVAP VDSIQAEEWY FGKLGRKDAE RQLLSFGNPR GTFLIRESET DT 15-DEC-2009, entry version DR PDB; A0N; NMR; -; B= TKGAYSLSIR DWDDMKGDHV KHYKIRKLDN GGYYITTRAQ FETLQQLVQH YSERAAGLCC DE RecName: Full=Proto-oncogene DR PDB; tyrosine-protein 1AOT; NMR; -; F= kinase RLVVPCHKGM PRLTDLSVKT KDVWEIPRES LQLIKRLGNG QFGEVWMGTW NGNTKVAIKT Fyn; DR PDB; 1AOU; NMR; -; F= LKPGTMSPES FLEEAQIMKK LKHDKLVQLY AVVSEEPIYI VTEYMNKGSL LDFLKDGEGR DE EC= ; DR PDB; 1AVZ; X-ray; 3.00 A; C= ALKLPNLVDM AAQVAAGMAY IERMNYIHRD LRSANILVGN GLICKIADFG LARLIEDNEY DE AltName: Full=p59-Fyn; DR PDB; 1AZG; NMR; -; B= TARQGAKFPI KWTAPEAALY GRFTIKSDVW SFGILLTELV TKGRVPYPGM NNREVLEQVE DE AltName: Full=Protooncogene DR PDB; Syn; 1EFN; X-ray; 2.50 A; A/C= RGYRMPCPQD CPISLHELMI HCWKKDPEER PTFEYLQSFL EDYFTATEPQ YQPGENL DE AltName: Full=SLK; DR PDB; 1FYN; X-ray; 2.30 A; A= // GN Name=FYN; DR PDB; 1G83; X-ray; 2.60 A; A/B= OS Homo sapiens (Human). DR PDB; 1M27; X-ray; 2.50 A; C= OC Eukaryota; Metazoa; Chordata; DR PDB; Craniata; 1NYF; NMR; Vertebrata; -; A= Euteleostomi; DR PDB; 1NYG; NMR; -; A= OC Mammalia; Eutheria; Euarchontoglires; DR PDB; 1SHF; X-ray; Primates; 1.90 A; A/B= Haplorrhini; DR PDB; 1ZBJ; NMR; -; A= OC Catarrhini; Hominidae; DR Homo. PDB; 2DQ7; X-ray; 2.80 A; X= OX NCBI_TaxID=9606; UNIPROT : 7 8

3 Les Bases de données relationnelle Les Bases de données relationnelle 2 Les fichiers-plats sont faciles à créer mais (comme dans l exemple précédent) difficile à consulter. Pour la consultation d une BD relationnelle ont utilise un langage d'interrogation : SQL (Structured Query Language) Les base de données (BD) relationnelle sont employées couramment pour des données biologiques Les données sont enregistrées dans un ensemble de tableaux qui sont liés par un champ partagé, appelé une clé SELECT protein-code, protein-name FROM protab1 WHERE species-origin= Bovine P100I Hemoglobin 9 10 Les Bases de données relationnelle 3 Autres formats SELECT protab1.protein-code, protab1.protein-name, protab2.protein-sequence FROM protab1,protab2 WHERE protab1.protein-code = protab2.protein-code AND protab2.protein-code = P1002 P1002 Hemoglobin MDKTSHGFEIKLLTPKKLQQWLMIAIYFGHT... Le XML (extensible markup language) est un outil général pour le stockage de données et de l information Comme le HTML, ce langage utilise des indicateurs qui entourent des sections de données Différent du HTML, XML offre la possibilité de créer des indicateurs arbitraires XQuery est utilisé pour l interrogation des fichier de XML <?xml version='1.0' encoding='utf-8'?> <uniprot xmlns="http://uniprot.org/uniprot" xmlns:xsi="http:// xsi:schemalocation="http:// uniprot.org/uniprot uniprot.xsd"> <entry dataset="swiss-prot" created=" " modified=" " version="139"> <accession>p06241</accession> <accession>q16248</accession> <accession>q5r3a6</accession> <accession>q5r3a7</accession> <accession>q8n5d7</accession> <name>fyn_human</name> <protein> <recommendedname ref="1"> <fullname>proto-oncogene tyrosine-protein kinase Fyn</fullName> </recommendedname> <alternativename> <fullname>p59-fyn</fullname> </alternativename> <alternativename> <fullname>protooncogene Syn</fullName> </alternativename> <alternativename> <fullname>slk</fullname> </alternativename> </protein> <gene> <name type="primary">fyn</name> </gene> <organism key="2"> <name type="scientific">homo sapiens</name> <name type="common">human</name> <dbreference type="ncbi Taxonomy" id="9606" key="3" />

4 Types des bases de données Types de bases de données 2 Parfois on fait la distinction entre des bases de données qui sont composées de données primaires ou secondaires (dérivées) Les bases de données primaires contiennent les résultats expérimentaux bruts ou la première incitation pour rendre des données publiques Dans UniProt les données sont la séquence et son identification Tous les références vers d autres bases de données ou sur les interactions/fonctions des protéines sont des annotations ex. GenBank, UniProt, RCSB protein database,... Les bases de données secondaires contiennent des résultats des analyses de ressources primaires Les données sont les informations principales de la base de données et toutes les informations additionnelles sont des annotations ex. CATH, PFAM, SCOP, SNPeffect, BriX Quelles bases de données? Ontologies Parce que les bases de données font la combinaison entre des données différentes provenant de différents lieux et que chaque ressource utilise des mots différents, on a besoin d une spécification explicite des mots et des rapports entre eux pour le partage des données : ontologie Le journal Nucleic Acids Research (NAR) compile une liste des bases de données (le Molecular Biology Database Collection) qui est divisée en 14 catégories L ontologie de gènes (GO) L ontologie MOA

5 Exemple de séquences de l ADN : GenBank Exemple de séquences de protéines : UniProt Genbank/ UniParc est une base de données nonredondante de toutes les séquences de protéines disponibles publiquement UniProtKB est la base de données centrale avec des annotations riches et précises UniRef (100,90 et 50) sont des ensembles de séquences qui étaient dérivées en utilisant des différents degrés de similarité (100%, 90% et 50%) 17 Exemple des génomes de vertébrés et d autres espèces eucaryotes: ENSEMBL Exemple des structures: RCSB protein database index.html 18 home.do 19 20

6 Exemple interactions entre des protéines: MINT Exemple classification des protéines: INTERPRO Welcome.do La qualité des données La qualité des données 2 C est important que les données ne mènent pas à des conclusions incorrectes Parfois on ajoute une mesure pour la qualité et le fiabilité des données Parfois le même travail est fait plusieurs fois et ces résultats font partie de la même base de données : il y de la redondance Cette redondance pourrait introduire un déplacement dans les résultat d une analyse par exemple: Si 50% des séquences dans une base de données ont une similarité de plus de 90%, l analyse des fréquences d acides aminées différents ne donne pas une idée correcte des fréquences de ceux-ci dans toutes les protéines normales 23 24

7 La qualité des données 3 uniformité des données Une méthode pourrait vérifier automatiquement si les séquences sont correctes. Autrement, il faut introduire des nouveaux caractères qui représentent l incertitude Un méthode pourrait vérifier si les coordonnées des atomes dans une structure (ex. les longueurs et les angles des liens entre les atomes) sont correctes... Même si les méthodes automatiques pour détecter des erreurs dans les données produisent des bons résultats, l intervention humaine est toujours importante pour assurer la qualité des données Comment créer une base de donnée relationnelle? Comme déjà expliqué, une BD est une ensemble de données qui sont organisées dans un certain façon Ces BD enlèvent tous les redondances et essaie de clarifier la structure dans les données c.a.d. on enlève les données semblables de la collection de données et on les mets dans des tableaux On fait ça pour chaque tableau récursivement A l'extrémité la base de données complet est normalisée Une base de donnée normalisée est plus facile à mettre à jour ou étendre ultérieurement Comment créer une base de donnée relationnelle? Comme déjà expliqué, une BD est une ensemble de données qui sont organisées dans un certain façon Ces BD enlèvent tous les redondances et essaie de clarifier la structure dans les données c.a.d. on enlève les données semblables de la collection de données et on les mets dans des tableaux On fait ça pour chaque tableau récursivement A l'extrémité la base de données complet est normalisée Une base de donnée normalisée est plus facile à mettre à jour ou étendre ultérieurement Comment créer une base de donnée relationnelle? Comme déjà expliqué, une BD est une ensemble de données qui sont organisées dans un certain façon Ces BD enlèvent tous Ceci les n est redondances pas un cours et sur essaie les de clarifier la structure dans les données bases de données c.a.d. on enlève les données semblables de la collection de données et on les mets dans des tableaux On fait ça pour chaque tableau récursivement A l'extrémité la base de données complet est normalisée Une base de donnée normalisée est plus facile à mettre à jour ou étendre ultérieurement 27 27

8 Normalisation en 5 glissières Ex 5.1 : Prenons les données suivantes : Normalisation en 5 glissières 2 La première forme normale : chaque type de colonne est unique et il n y a aucun groupe de répétitions de données le nom de la protéine FYN le nom d espèce souris la séquence numéro d identification domaine 1 (NI) NI domaine 1 région 1 (start/ stop) domaine 2 NI domaine 2 région 2 (start/ stop) KLTEERDG... MGCVQCKDKEAA P39688 SH2 PF SH3 PF Dans notre exemple, les domaines sont répétés dans des protéines différentes SRC SRC CD2AP souris homme homme QRRRSLEP... MGSNKSKPKDAS P05480 SH2 PF SH3 PF QRRRSLEP... MGSNKSKPKDAS P12931 SH2 PF SH3 PF VHDDELTI... MVDYIVEYDYDA Q9Y5K6 SH3 PF SH3 PF Si on détecte un autre domaine dans la protéine, on doit ajouter 3 colonnes additionnelles Par exemple, la protéine CD2AP a trois domaines SH3 dans sa structure Transformez ce tableau en un ensemble de tableaux normalisés tableau de liaison Il y un rapport multiple entre les protéines et les domaines: nouveau tableau : domaines dans protéines Normalisation en 5 glissières 3 Normalisation en 5 glissières 4 La deuxième forme normale : Tous les attributs dans le tableau devraient dépendre seulement de l identificateur unique du tableau Attention!!! On a utilisé ici les numéros de références de UniProt. Ces numéros sont uniques La troisième forme normale : Aucune entrée de colonne ne devrait dépendre d une autre entrée (la valeur) que la clé du tableau le nom de la protéine FYN SRC SRC CD2AP le nome d espèce souris souris homme homme le séquence MGCVQCKDKEAA KLTEERDG... MGSNKSKPKDAS QRRRSLEP... MGSNKSKPKDAS QRRRSLEP... MVDYIVEYDYDA VHDDELTI... numéro d identification (NI) P39688 P05480 P12931 Q9Y5K6 le nom de la protéine FYN SRC SRC le nome d espèce souris souris homme le séquence MGCVQCKDKEAA KLTEERDG... MGSNKSKPKDAS QRRRSLEP... MGSNKSKPKDAS QRRRSLEP... numéro d identification (NI) P39688 P12931 P12931 l information sur les espèces ne fait pas partie de l information des protéines Faire un nouveau tableau pour les espèces CD2AP homme MVDYIVEYDYDA VHDDELTI... Q9Y5K

9 Normalisation en 5 glissières 5 SQL Ces trois étapes de normalisation nous donnent une diagramme décrivant les tableaux et leurs relations Il y a 4 commandes de base en SQL INSERT - pour ajouter des données DELETE - pour effacer des données SELECT - pour retrouver des données UPDATE - pour changer des données Maintenant on va les construire en utilisant MySQL Getting started with MySQL : articles/mysql_intro.html SQL 2 SQL 3 Avant de construire les tableaux pour la base de données, on doit connaître les types de chaque attribut Avant de construire les tableaux pour la base de données, on doit connaître les types de chaque attribut Ici nous mentionnons seulement les types dont nous avons besoin pour l exemple Ici nous mentionnons seulement les types dont nous avons besoin pour l exemple Nombres Les attributs DetP-région-start et DetPrégion-stop sont des nombres qui indiquent le début et le fin d un domaine dans la séquence de la protéine La longueur d un domaine est toujours inférieur à 1000 résidus Dans ce cas Le type SMALLINT de SQL est suffisant SMALLINT 2 bytes Nombre entier avec l intervalle non-signé de 0 à et un intervalle signé entre et Chaînes de texte de longueur fixe Toutes les clés (comme NI-protéine et NIdomaine), nom-domaine, nom-espèces et nom-protéines ont une longueur limitée 6 et 7 caractères pour les clés et maximum 255 caractères pour le reste Dans ces cas le type CHAR(longueur) ou le type VARCHAR(longueur) de SQL est suffisant Le longueur de VARCHAR est limité à 255 caractères CHAR(longueur) et VARCHAR(longueur) longueur bytes Une Chaîne de texte de longueur fixe. Quand un mot est assigné à l attribut, les espaces à la fin inutilisés sont enlevés avant d enregistrer les données 34 35

10 SQL 4 Avant de construire les tableaux pour la base de données, on doit connaître les types de chaque attribut Ici nous mentionnons seulement les types dont nous avons besoin pour l exemple SQL 5 Maintenant, toute l information est disponible pour construire la base de données Textes L attribut séquence doit enregistrer des chaînes de caractères avec une longueur supérieure à 255 caractères et il y a une variance entre des protéines différentes Dans ce cas le type TEXT de SQL est suffisant TEXT 64 Kbytes On commence avec la création d une base de données avec le nom sequences Attention au restrictions : la base de données est créé par le root! SQL 6 SQL 7 et aussi tous les tableaux Les tableaux sont créés en utilisant la commande CREATE TABLE L ensemble des attributs detp_ni_proteine, detp_ni_domaine et detp_region_start fournis une identification unique pour chaque article dans le tableau detp Pour afficher les tableaux de la base de données, on utilise la commande SHOW TABLES Pour afficher les attributs au sein d un tableau, on utilise la commande SHOW COLUMNS FROM ALTER TABLE est utilisé pour créer la clé primaire la combinaison des trois premiers attributs est la clé primaire 38 39

11 SQL 8 SQL 9 Les données sont insérées en utilisant la commande INSERT INTO Les données peuvent être insérées toutes ensembles SELECT montre les données enregistrées dans le tableau SQL 10 SQL

12 SQL 12 SQL 13 Maintenant, que toutes les données sont insérées dans la base de données essayons des variations de déclaration de SELECT Choisir toutes les protéines avec le nom SRC Choisir toutes les protéines qui ont la sous-séquence SNKSK dans leur séquence % représente plusieurs caractères aléatoires Les résultats peuvent être arrangés dans une ordre particulier en utilisant la déclaration ORDER BY Choisir toutes les protéines qui ont la sous-séquence K_A dans leur séquence _ signifie un caractère aléatoire asc et desc signifient l ordre croissant et décroissant SQL 14 SQL 15 Choisir toutes les protéines qui ont la sous-séquence K_A dans leur séquence ET qui font partie de l'espèce souris La déclaration SELECT peut combiner des tableaux différents les autres opérations logiques sont OR, NOT Montrer tous les domaines de chaque protéine Compter les nombres de protéines FYN er SRC dans la base de données MAX et SUM sont deux autres opérations mathématiques dans SQL Voici ce qui fait une base de données relationnelle 46 47

13 SQL 16 La déclaration JOIN fait la combinaison entre des tableaux automatiquement LEFT JOIN combine les tableaux et affiche les valeurs de toutes les données dans la tableau gauche (proteines) avec les valeurs du tableau droit (especes), s ils sont connus SQL 17 RIGHT JOIN fait de même mais de droite à gauche Parce que le numéro 7227 n existe pas dans le tableau especes, la protéine ABL n est pas affichée Dans l exemple, on ajoute une nouvelle protéine avec un NI d espèce qui est inconnu dans le tableau especes 7227 (mouche) SQL 18 SQL 19 ALTER est utilisé pour ajouter des nouvelles colonnes dans les tableaux ou pour changer les colonnes UPDATE est utilisé pour changer les valeurs des attributs dans un tableau ipi est le international protein index introduit par l organisation EBI la déclaration MODIFY peut changer des propriétés des colonnes il n y a pas de IPI pour la protéine ABL ALTER peut aussi changer le nom du tableau 50 51

14 SQL 20 DELETE est utilisé pour enlever des données On pourrait crée une copie de sauvegarde en utilisant mysqldump SQL 21 DROP TABLE enlève les tableaux ATTENTION!!! Comment connecter un logiciel à une base de données? La classe DBConnection Le type de retour d un select est StoreQueryResult Le type Connection de mysqlpp enregistre la connexion avec la base de données de MySQL 54 55

15 La classe DBConnection 2 La classe DBConnection 3 L objet query enregistre la déclaration SQL le retour de cette fonction est la nouvelle clé de l article enregistrée par la méthode insert Le méthode connect établi la connexion avec la base de données Le méthode disconnect enlève la connexion avec la base de données La méthode query.execute() est utilisée si on ne prévoit pas de résultats, autrement on utilise query.store() pour enregistrer les résultats Le main Le main 2 l information pour la base de données Voila fait la connexion fait la déclaration de SELECT le résultats sont enregistrés dans selresult la méthode at(.) retourne une ligne des résultats Petite fonction auxiliaire pour obtenir la valeur d'un attribut particulier dans le ligne row 58 59

16 et en Python? et en Python? 60 61

Base de donnée relationnelle. Exemple de table: Film. Exemple de table: Acteur. Exemple de table: Role. Contenu de la table Role

Base de donnée relationnelle. Exemple de table: Film. Exemple de table: Acteur. Exemple de table: Role. Contenu de la table Role IFT7 Programmation Serveur Web avec PHP Introduction à MySQL Base de donnée relationnelle Une base de données relationnelle est composée de plusieurs tables possédant des relations logiques (théorie des

Plus en détail

TP BIOINFORMATIQUE Bases de Données relationnelles

TP BIOINFORMATIQUE Bases de Données relationnelles TP BIOINFORMATIQUE Bases de Données relationnelles Objectif : Construire et utiliser une base de données relationnelle simple. Déroulement : Ce TP se déroulera sur 2 séances. 1. Modélisation simplifiée

Plus en détail

COMMANDES SQL... 2 COMMANDES DE DEFINITION DE DONNEES... 2

COMMANDES SQL... 2 COMMANDES DE DEFINITION DE DONNEES... 2 SQL Sommaire : COMMANDES SQL... 2 COMMANDES DE DEFINITION DE DONNEES... 2 COMMANDES DE MANIPULATION DE DONNEES... 2 COMMANDES DE CONTROLE TRANSACTIONNEL... 2 COMMANDES DE REQUETE DE DONNEES... 2 COMMANDES

Plus en détail

FONCTIONS DE TRAITEMENT} COUNT

FONCTIONS DE TRAITEMENT} COUNT Nom Prénom Promotion Date Buhl Damien Année 1 Groupe 2 21 Janvier 2007 CER Prosit n 22 Mots-Clés : - Requête/Langage SQL Le langage SQL (Structured Query Language) est un langage de requêtes, il permet

Plus en détail

ALIGNEMENT PLUS RAPIDE

ALIGNEMENT PLUS RAPIDE ALIGNEMENT PLUS RAPIDE 1. méthodes heuristiques : hachage, arbres de suffixe, PD limitée (taille totale de trous bornée) 2. PD éparse (pour sous-séquence commune ou chaînage en alignement global heuristique)

Plus en détail

Chap. 5 : Langage SQL (Structured Query Language) Pr. : Mohamed BASLAM Contact : baslam.med@gmail.com Niveau : S4 BCG Année : 2014/2015 1

Chap. 5 : Langage SQL (Structured Query Language) Pr. : Mohamed BASLAM Contact : baslam.med@gmail.com Niveau : S4 BCG Année : 2014/2015 1 Chap. 5 : Langage SQL (Structured Query Language) Pr. : Mohamed BASLAM Contact : baslam.med@gmail.com Niveau : S4 BCG Année : 2014/2015 1 Plan Généralités Langage de Définition des (LDD) Langage de Manipulation

Plus en détail

Formation PHP/ MYSQL

Formation PHP/ MYSQL Formation PHP/ MYSQL Deuxième PARTIE 1/12 II MYSQL (PHPmyAdmin) Création d un annuaire avec une table MySQL dans phpmyadmin. Voici l écran de PHPmyAdmin lorsque vous vous y connectez. 2/12 1) Création

Plus en détail

Informatique en CPGE (2015-2016) Le langage SQL

Informatique en CPGE (2015-2016) Le langage SQL Informatique en CPGE (2015-2016) Le langage SQL S. B. Lycée des EK 30 mai 2016 Le SQL (Structured Query Language = langage de requêtes structuré) est un langage informatique de dialogue avec une base de

Plus en détail

I) Bases de données et tables :

I) Bases de données et tables : I) Bases de données et tables : Un S.G.B.D. est un outil pour organiser, stocker, modifier, calculer et extraire des infos. Une B.D.R. peut être considérée comme un ensemble de tables à 2 dimensions. Exemple

Plus en détail

CREATION WEB DYNAMIQUE

CREATION WEB DYNAMIQUE CREATION WEB DYNAMIQUE IV ) MySQL IV-1 ) Introduction MYSQL dérive directement de SQL (Structured Query Language) qui est un langage de requêtes vers les bases de données relationnelles. Le serveur de

Plus en détail

MySQL 5. Guide de l'administrateur et du développeur. Michael Kofler. Groupe Eyrolles, 2005 pour l édition française, ISBN : 2-212-11633-0

MySQL 5. Guide de l'administrateur et du développeur. Michael Kofler. Groupe Eyrolles, 2005 pour l édition française, ISBN : 2-212-11633-0 MySQL 5 Guide de l'administrateur et du développeur Michael Kofler Groupe Eyrolles, 2005 pour l édition française, ISBN : 2-212-11633-0 Table des matières Avant-propos..............................................

Plus en détail

ORACLE SQL LDD. Langage de définition de données

ORACLE SQL LDD. Langage de définition de données ORACLE SQL LDD Langage de définition de données Le langage SQL (Structured Query Language) SQL a été normalisé par l ANSI puis par l ISO depuis 1986 sous ses différents aspects : LDD : définition des données

Plus en détail

L2 sciences et technologies, mention informatique SQL

L2 sciences et technologies, mention informatique SQL Bases de données L2 sciences et technologies, mention informatique SQL ou : le côté obscure de la jolie théorie films titre réalisateur année starwars lucas 1977 nikita besson 1990 locataires ki-duk 2005

Plus en détail

Informatique Initiation aux requêtes SQL. Sommaire

Informatique Initiation aux requêtes SQL. Sommaire cterrier.com 1/14 04/03/2008 Informatique Initiation aux requêtes SQL Auteur : C. Terrier ; mailto:webmaster@cterrier.com ; http://www.cterrier.com Utilisation : Reproduction libre pour des formateurs

Plus en détail

Introduction aux bases de données

Introduction aux bases de données Introduction aux bases de données Cours 3. : Le langage SQL Vincent Martin email : vincent.martin@univ-tln.fr page personnelle : http://lsis.univ-tln.fr/~martin/ Master 1. LLC Université du Sud Toulon

Plus en détail

Faculté I&C, Claude Petitpierre, André Maurer. Bases de données. SQL (Structured Query Language)

Faculté I&C, Claude Petitpierre, André Maurer. Bases de données. SQL (Structured Query Language) Bases de données SQL (Structured Query Language) Une base de données contient des tables idv region cepage annee Lavaux chasselas 2005 Chianti sangiovese 2002 2 Bourgogne pinot noir 2000 Le nom et le type

Plus en détail

Langage SQL (1) 4 septembre 2007. IUT Orléans. Introduction Le langage SQL : données Le langage SQL : requêtes

Langage SQL (1) 4 septembre 2007. IUT Orléans. Introduction Le langage SQL : données Le langage SQL : requêtes Langage SQL (1) Sébastien Limet Denys Duchier IUT Orléans 4 septembre 2007 Notions de base qu est-ce qu une base de données? SGBD différents type de bases de données quelques systèmes existants Définition

Plus en détail

SQL Historique 1982 1986 1992

SQL Historique 1982 1986 1992 SQL Historique 1950-1960: gestion par simple fichier texte 1960: COBOL (début de notion de base de données) 1968: premier produit de sgbdr structuré (IBM -> IDMS) 1970-74: élaboration de l'outil d'analyse

Plus en détail

2 ème PARTIE : LE LANGAGE SQL

2 ème PARTIE : LE LANGAGE SQL 2 ème PARTIE : LE LANGAGE SQL PLAN : I. Le langage de manipulation des données II. Le langage de définition des données III. Administration de la base de données IV. Divers (HORS PROGRAMME) Introduction:

Plus en détail

Introduction au langage SQL

Introduction au langage SQL Introduction au langage SQL 1. Description SQL est un acronyme pour Structured Query Language qui a été conçu par IBM, et a succédé au langage SEQUEL. C est maintenant le langage le plus utilisé dans les

Plus en détail

Introduction aux Systemes d Information et aux Bases de Données

Introduction aux Systemes d Information et aux Bases de Données Introduction aux Systemes d Information et aux Bases de Données L2 Informatique Serenella Cerrito Département d Informatique Évry 2014-2015 Quels valeurs peut prendre un attribut? Ici, les types les plus

Plus en détail

DUT Génie Biologique Option Bioinformatique. Les bases de données relationnelles. Travaux Pratiques n 4

DUT Génie Biologique Option Bioinformatique. Les bases de données relationnelles. Travaux Pratiques n 4 DUT Génie Biologique Option Bioinformatique Les bases de données relationnelles avec MySQL Éric Pipard Travaux Pratiques n 4 Jointures externes Requêtes internes et externes Vues et transactions Objectifs

Plus en détail

Chapitre 4 : Le langage SQL

Chapitre 4 : Le langage SQL Chapitre 4 : Le langage SQL Table des matières I) Introduction...2 II) Rappel...2 III) Gestion de la base de données...2 1) Création de la base de données...2 2) Modification de la base de données...2

Plus en détail

15 septembre 2010. Démo #2 MySQL Séquençage

15 septembre 2010. Démo #2 MySQL Séquençage 15 septembre 2010 Démo #2 MySQL Séquençage SQL et MySQL SQL: structured query language langage pour manipuler des données dans des bases de données relationnelles MySQL: Implantation de SQL Ajout à SQL

Plus en détail

IFT3030 Base de données. Chapitre 6 SQL. Plan du cours

IFT3030 Base de données. Chapitre 6 SQL. Plan du cours IFT3030 Base de données Chapitre 6 SQL Plan du cours Introduction Architecture Modèles de données Modèle relationnel Algèbre relationnelle SQL Conception Fonctions avancées Concepts avancés Modèle des

Plus en détail

Bases de données relationnelles

Bases de données relationnelles Bases de données relationnelles Système de Gestion de Bases de Données Une base de données est un ensemble de données mémorisé par un ordinateur, organisé selon un modèle et accessible à de nombreuses

Plus en détail

LINQ to SQL. Version 1.1

LINQ to SQL. Version 1.1 LINQ to SQL Version 1.1 2 Chapitre 03 - LINQ to SQL Sommaire 1 Introduction... 3 1.1 Rappels à propos de LINQ... 3 1.2 LINQ to SQL... 3 2 LINQ to SQL... 3 2.1 Importer des tables... 3 2.1.1 Le concepteur

Plus en détail

Pierre Parrend, Régis Martinez, Soumaya El Kadiri Introduction à SQL, QLIO, 2006-2007. SQL: Introduction

Pierre Parrend, Régis Martinez, Soumaya El Kadiri Introduction à SQL, QLIO, 2006-2007. SQL: Introduction Introduction à SQL IUT Lumière, DUT QLIO 2006-2007 Pierre Parrend, Régis Martinez, Soumaya El-Kadiri SQL: Introduction I. Le Language SQL Pour interroger une Base de Données (BD), il faut dialoguer avec

Plus en détail

Instructions SQL. Première partie : Langage de description et de gestion des données

Instructions SQL. Première partie : Langage de description et de gestion des données Instructions SQL Première partie : Langage de description et de gestion des données Quelques instructions et leur syntaxe 1. Introduction Trois principales catégories d instructions. Instructions de création

Plus en détail

Bioinformatique BTV Stockage des données

Bioinformatique BTV Stockage des données 1 / 64 Bioinformatique BTV Stockage des données Jean-Michel Richer jean-michel.richer@univ-angers.fr http://www.info.univ-angers.fr/pub/richer Juillet 2008 2 / 64 Plan Plan 1 Introduction 2 Format de stockage

Plus en détail

Introduction au langage SQL

Introduction au langage SQL Introduction au langage SQL Les bases de données relationnelles Le langage SQL est un langage universel destiné à travailler sur des bases de données relationnelles. Nous considérerons ici qu'une base

Plus en détail

INITIATION AU LANGAGE SQL

INITIATION AU LANGAGE SQL ECOLE NATIONALE DES INGENIEURS DES TRAVAUX AGRICOLES DE BORDEAUX DEPARTEMENT ENTREPRISE ET SYSTEMES UNITE DE FORMATION INFORMATIQUE ET GENIE DES EQUIPEMENTS ~o~o~o~ INITIATION AU LANGAGE SQL Notes de cours

Plus en détail

Cours de Base de Données Cours n.2 Introduction à MySQL/PhPMyAdmin

Cours de Base de Données Cours n.2 Introduction à MySQL/PhPMyAdmin Cours de Base de Données Cours n.2 Introduction à MySQL/PhPMyAdmin Ce cours reprend beaucoup de transparents du cours de Philippe LAHIRE Elisabetta De Maria - edemaria@i3s.unice.fr UFR Sciences et Laboratoire

Plus en détail

Langage SQL : créer et interroger une base

Langage SQL : créer et interroger une base Langage SQL : créer et interroger une base Dans ce chapitre, nous revenons sur les principales requêtes de création de table et d accès aux données. Nous verrons aussi quelques fonctions d agrégation (MAX,

Plus en détail

Plan. Bases de données. Cours 1 : Généralités & rappels. But du cours. Organisation du cours. Polytech Paris-Sud. Apprentis 4 ème année

Plan. Bases de données. Cours 1 : Généralités & rappels. But du cours. Organisation du cours. Polytech Paris-Sud. Apprentis 4 ème année Plan Bases de données Polytech Paris-Sud Apprentis 4 ème année Cours 1 : Généralités & rappels 1.1 Avant-propos 1.2 Algèbre relationnelle kn@lri.fr http://www.lri.fr/~kn 2/18 But du cours Organisation

Plus en détail

INTRODUCTION A SQL. http://www.lri.fr/~rigaux/bd/sql.html

INTRODUCTION A SQL. http://www.lri.fr/~rigaux/bd/sql.html 012345678901234567890123 INTRODUCTION A SQL SQL = Structured Query Language SEQUEL = Structured English as a QUEry Language standard ISO depuis 87. Avantages : implanté + ou - complètement sur principaux

Plus en détail

Chapitre 1 Installer MySQL 5 21

Chapitre 1 Installer MySQL 5 21 Chapitre 1 Installer MySQL 5 21 1.1. Les outils nécessaires... 22 1.2. Télécharger et installer le serveur MySQL... 22 Télécharger la dernière version... 22 Lancer l installation sous Windows... 23 Lancer

Plus en détail

UFR de Mathématiques et Informatique

UFR de Mathématiques et Informatique UFR de Mathématiques et Informatique Licence professionnelle "Les métiers de l'internet" Réf. Regles_MCD_MPD.doc Module BD1 (Partiel et examen) Date dernière version : Avril 2002 Diffusion : apprenants

Plus en détail

11. MySQL. Cours Web. MySQL. 11. MySQL. 11. MySQL. Structured Query Language. Lionel Seinturier. Université Pierre & Marie Curie

11. MySQL. Cours Web. MySQL. 11. MySQL. 11. MySQL. Structured Query Language. Lionel Seinturier. Université Pierre & Marie Curie Cours Web Lionel Seinturier Université Pierre & Marie Curie Lionel.Seinturier@lip6.fr Structured Query Language Langage de manipulation des données stockées dans une base de données interrogation/insertion/modification/suppression

Plus en détail

Information utiles. cinzia.digiusto@gmail.com. webpage : Google+ : http://www.ibisc.univ-evry.fr/ digiusto/

Information utiles. cinzia.digiusto@gmail.com. webpage : Google+ : http://www.ibisc.univ-evry.fr/ digiusto/ Systèmes de gestion de bases de données Introduction Université d Evry Val d Essonne, IBISC utiles email : cinzia.digiusto@gmail.com webpage : http://www.ibisc.univ-evry.fr/ digiusto/ Google+ : https://plus.google.com/u/0/b/103572780965897723237/

Plus en détail

Rapport de Cryptographie

Rapport de Cryptographie Cryptographie [MIF30] / Année 2008-2009 Rapport de Cryptographie Les Injections SQL Sylvie Tixier & François-Xavier Charlet Page 1 20/05/2009 Sommaire Introduction...3 Définition d une injection SQL...3

Plus en détail

1.1/Architecture des SGBD Les architectures physiques de SGBD sont très liées au mode de répartition.

1.1/Architecture des SGBD Les architectures physiques de SGBD sont très liées au mode de répartition. LP Informatique(DA2I), F7 : Administration Système, Réseaux et Base de données 15/11/2007, Enseignant : M. Nakechbnadi, mail : nakech@free.fr Première parie : Administration d une BD Chapitre 1 : Architecture

Plus en détail

Les bases de données (suite) Support de cours Pascal Ballet

Les bases de données (suite) Support de cours Pascal Ballet Les bases de données (suite) Support de cours Pascal Ballet La saisie et l'impression des données Les formulaires de saisie Les formulaires de saisie jouent deux rôles importants : - la mise en forme des

Plus en détail

Création de base de données en SQL - exercices dans le cadre du cours à l'ibis. Sébastien Clément, avril 2011

Création de base de données en SQL - exercices dans le cadre du cours à l'ibis. Sébastien Clément, avril 2011 Création de base de données en SQL - exercices dans le cadre du cours à l'ibis. Sébastien Clément, avril 2011 Interface Web PhpPgAdmin: permet de faire des requêtes SQL ( 1 commandes) permet de visualiser

Plus en détail

Vulnérabilités logicielles Injection SQL

Vulnérabilités logicielles Injection SQL MGR850 Hiver 2014 Vulnérabilités logicielles Injection SQL Hakima Ould-Slimane Chargée de cours École de technologie supérieure (ÉTS) Département de génie électrique 1 Plan SQL Injection SQL Injections

Plus en détail

2.1/ Les privilèges sous oracle

2.1/ Les privilèges sous oracle LP Informatique(DA2I), UF7 : Administration Système, Réseaux et Base de données 13/12/2007, Enseignant : M. Nakechbnadi, mail : nakech@free.fr Première parie : Administration d une BD Chapitre 2 : Transaction,

Plus en détail

UTILISER LE SERVEUR MYSQL...

UTILISER LE SERVEUR MYSQL... MySQL (pour Windows 9x) UTILISER LE SERVEUR MYSQL... 2 LANCER LE SERVEUR MYSQL... 2 ARRETER LE SERVEUR MYSQL... 3 TRAVAIL AVEC LA CONSOLE MYSQL... 3 CREATION / SUPPRESSION D'UN BASE... 3 UTILISER UN BASE...

Plus en détail

Qu'est-ce que Mysql?

Qu'est-ce que Mysql? Mysql avec php Qu'est-ce que Mysql? Annie Danzart Annie.Danzart@enst.fr http://www.infres.enst.fr/~danzart/mysql/ Qu est-ce que Mysql? Aperçu Langage Le serveur La base de données Interfaces d accès Fonctions

Plus en détail

Cours 7 : Langage de définition, manipulation et contrôle des données

Cours 7 : Langage de définition, manipulation et contrôle des données Cours 7 : Langage de définition, manipulation et contrôle des données Objets d une base de données Dans un schéma Tables, vues Index, clusters, séquences, synonymes Packages, procédures, fonctions, déclencheurs

Plus en détail

Exploiter les données d'un PGI avec SQL

Exploiter les données d'un PGI avec SQL Exploiter les données d'un PGI avec SQL Propriétés Description Titre de la production Auteur Exploiter les données d'un PGI avec SQL Véronique Bennetot-Dereux GREID Académie de Créteil v.bennetot-dereux@ac-creteil.fr

Plus en détail

Le langage SQL pour Oracle - partie 1 : SQL comme LDD

Le langage SQL pour Oracle - partie 1 : SQL comme LDD Le langage SQL pour Oracle - partie 1 : SQL comme LDD 1 SQL : Introduction SQL : Structured Query Langage langage de gestion de bases de donn ees relationnelles pour Définir les données (LDD) interroger

Plus en détail

OpenPaaS Le réseau social d'entreprise

OpenPaaS Le réseau social d'entreprise OpenPaaS Le réseau social d'entreprise Spécification des API datastore SP L2.3.1 Diffusion : Institut MinesTélécom, Télécom SudParis 1 / 12 1OpenPaaS DataBase API : ODBAPI...3 1.1Comparaison des concepts...3

Plus en détail

Introduction aux bases de données relationnelles

Introduction aux bases de données relationnelles Formation «Gestion des données scientifiques : stockage et consultation en utilisant des ases de données» 24 au 27 /06/08 Introduction aux ases de données relationnelles Christine Tranchant-Dureuil UMR

Plus en détail

TP1 - Corrigé. Manipulations de données

TP1 - Corrigé. Manipulations de données TP1 - Corrigé Manipulations de données 1. Démarrez mysql comme suit : bash$ mysql -h 127.0.0.1 -u user4 -D db_4 p Remarque: le mot de passe est le nom de user. Ici user4 2. Afficher la liste des bases

Plus en détail

Le language SQL (2/2)

Le language SQL (2/2) Les commandes de base sous Unix SQL (Première partie) Walter RUDAMETKIN Bureau F011 Walter.Rudametkin@polytech-lille.fr Création d'une base ([] facultatif) : createdb nombase [ -U comptepostgres ] Destruction

Plus en détail

Bases de Données. SQL: Définition

Bases de Données. SQL: Définition Université Mohammed V- Agdal Ecole Mohammadia d'ingénieurs Rabat Bases de Données Mr N.EL FADDOULI 2014-2015 SQL: Définition Structured Query Langage(SQL): - Langage g de base dans les SGBD - Langage de

Plus en détail

Les bases de données

Les bases de données Les bases de données Introduction aux fonctions de tableur et logiciels ou langages spécialisés (MS-Access, Base, SQL ) Yves Roggeman Boulevard du Triomphe CP 212 B-1050 Bruxelles (Belgium) Idée intuitive

Plus en détail

Modification des données stockées dans une base. LIF4 - Initiation aux Bases de données : SQL - 3. Exemple. Insertion. Insertion utilisant une requête

Modification des données stockées dans une base. LIF4 - Initiation aux Bases de données : SQL - 3. Exemple. Insertion. Insertion utilisant une requête Modification des données stockées dans une base LIF4 - Initiation aux Bases de données : SQL - 3 E.Coquery emmanuel.coquery@liris.cnrs.fr http ://liris.cnrs.fr/ ecoquery La modification s effectue par

Plus en détail

Le langage SQL (deuxième partie) c Olivier Caron

Le langage SQL (deuxième partie) c Olivier Caron Le langage SQL (deuxième partie) 1 Les requêtes de consultation Représente la majorité des requêtes 1 Les requêtes de consultation Représente la majorité des requêtes Encapsule complètement l algèbre relationnel

Plus en détail

Cours 3 Le langage SQL

Cours 3 Le langage SQL DUT SRC IUT de Marne-la-Vallée 05/02/2014 M2203 Bases de données Cours 3 Le langage SQL Philippe Gambette Sources Cours de Tony Grandame à l'iut de Marne-la-Vallée en 2010-2011 Cours de Mathieu Mangeot,

Plus en détail

SQL et Bases de données relationnelles. November 26, 2013

SQL et Bases de données relationnelles. November 26, 2013 November 26, 2013 SQL : En tant que langage d interrogation En tant que langage de mise à jour En tant que langage de définition de données Langages de requête Langages qui permettent d interroger la BD

Plus en détail

Révisions sur les Bases de données. Lycée Thiers - PC/PC*

Révisions sur les Bases de données. Lycée Thiers - PC/PC* Bases de données Architecture clients-serveur Architecture trois tiers Vocabulaire des BDD Algèbre relationnelle Création/modification d une table Commandes SQL de manipulation de tables Définition formelle

Plus en détail

Objectifs du TP : Initiation à Access

Objectifs du TP : Initiation à Access Objectifs du TP : Initiation à Access I. Introduction Microsoft Access fait partie de l ensemble Microsoft Office. C est un SGBDR (système de gestion de bases de données relationnelles) présentant une

Plus en détail

2011 Hakim Benameurlaine 1

2011 Hakim Benameurlaine 1 Table des matières 1 PRÉSENTATION DE TSQL... 2 1.1 Historique... 2 1.2 Les différents types d instructions... 2 1.2.1 Langage de Définition des Données... 2 1.2.2 Langage de Manipulation des Données...

Plus en détail

Bases de données (SQL)

Bases de données (SQL) Bases de données (SQL) Skander Zannad et Judicaël Courant 2014-03-26 1 Le modèle logique (MLD) On a représenté des données par des tables. Par exemple, pour les films : The good, the Bad and the Ugly 1966

Plus en détail

Plan de la scéance. Modélisation et conception de bases de données. Que doit-on concevoir? L3Pro SCT Bases de données et programmation

Plan de la scéance. Modélisation et conception de bases de données. Que doit-on concevoir? L3Pro SCT Bases de données et programmation Modélisation et conception de bases de données L3Pro SCT Bases de données et programmation Mathieu Sassolas IUT de Sénart Fontainebleau Département Informatique Année 2015-2016 Plan de la séance 3 2 /

Plus en détail

Rudiments SQL pour Oracle BDA_RCS

Rudiments SQL pour Oracle BDA_RCS Rudiments SQL pour Oracle BDA_RCS 08-11-2014 1 La base de données Gestion des commandes 08-11-2014 2 Les noms de colonnes sont volontairement simplifiés 3 Ajout de nouvelles colonnes dans des tables qui

Plus en détail

Bases de Données relationnelles et leurs systèmes de Gestion

Bases de Données relationnelles et leurs systèmes de Gestion III.1- Définition de schémas Bases de Données relationnelles et leurs systèmes de Gestion RAPPELS Contraintes d intégrité sous Oracle Notion de vue Typage des attributs Contrainte d intégrité Intra-relation

Plus en détail

Jusqu à 14 h : Open Questions! On vous explique ce que vous n avez pas compris lors de la première formation.

Jusqu à 14 h : Open Questions! On vous explique ce que vous n avez pas compris lors de la première formation. Bienvenue! Jusqu à 14 h : Open Questions! On vous explique ce que vous n avez pas compris lors de la première formation. Téléchargez les logiciels nécessaires pour cette formation : http ://formation-web.via.ecp.fr

Plus en détail

TP 1 Bases de Données Prise en main d Oracle L3 Informatique Université d Aix-Marseille

TP 1 Bases de Données Prise en main d Oracle L3 Informatique Université d Aix-Marseille TP 1 Bases de Données Prise en main d Oracle L3 Informatique Université d Aix-Marseille 1 Prise en main de SQLplus Oracle est un SGBD Relationnel muni de nombreuses fonctionnalités (celles classiques des

Plus en détail

Olivier Mondet http://unidentified-one.net

Olivier Mondet http://unidentified-one.net T-GSI Ch.4 Le Langage SQL LDD, LCD Cet exercice guidé reprend le plan suivis lors de l intervention de formation faite pour l académie de Versailles. L objectif principal visait en la présentation du langage

Plus en détail

1. LA GESTION DES BASES DE DONNEES RELATIONNELLES

1. LA GESTION DES BASES DE DONNEES RELATIONNELLES Dossier G11 - Interroger une base de données La base de données Facturation contient tout un ensemble d'informations concernant la facturation de la SAFPB (société anonyme de fabrication de produits de

Plus en détail

Les requêtes de consultation. Ex. bibliothèque état de la base. Ex. bibliothèque état de la base. Consultation simple d'une table

Les requêtes de consultation. Ex. bibliothèque état de la base. Ex. bibliothèque état de la base. Consultation simple d'une table Les requêtes de consultation Représente la ma jorité des requêtes SQL (Deuxième partie) Walter RUDAMETKIN Bureau F011 Walter.Rudametkin@polytech-lille.fr Encapsule complètement l'algèbre relationnel Une

Plus en détail

BdD Base de Données. Clément VERMOT-DESROCHES

BdD Base de Données. Clément VERMOT-DESROCHES BdD Base de Données Clément VERMOT-DESROCHES 17 novembre 2009 Table des matières 1 Présentation Générale 3 1.1 Présentation Générale............................. 3 1.1.1 Définition................................

Plus en détail

Web dynamique. Techniques, outils, applications. (Partie C)

Web dynamique. Techniques, outils, applications. (Partie C) Web dynamique Techniques, outils, applications (Partie C) Nadir Boussoukaia - 2006 1 SOMMAIRE 1. MySQL et PHP (20 min) 2. SQL (petits rappels) (20 min) 2 MySQL et PHP Synthèse 3 MySQL et PHP SGBD MySQL

Plus en détail

NFA 008. Introduction à NoSQL et MongoDB 25/05/2013

NFA 008. Introduction à NoSQL et MongoDB 25/05/2013 NFA 008 Introduction à NoSQL et MongoDB 25/05/2013 1 NoSQL, c'est à dire? Les bases de données NoSQL restent des bases de données mais on met l'accent sur L'aspect NON-relationnel L'architecture distribuée

Plus en détail

LES REQUÊTES EN LANGAGE S.Q.L.

LES REQUÊTES EN LANGAGE S.Q.L. LES REQUÊTES EN LANGAGE S.Q.L. Une base de données contient un nombre important d informations. Ces informations sont organisées, mais pour être effectivement exploitables, il faut pouvoir sélectionner,

Plus en détail

Formation PHP/MySQL. Pierre PATTARD. Avril 2005

Formation PHP/MySQL. Pierre PATTARD. Avril 2005 Formation PHP/MySQL Pierre PATTARD Julien BENOIT Avril 2005 Le PHP Langage interprété, côté serveur pages interprétées par le serveur web pas de compilation, code éditable avec un bloc notes. aucune différences

Plus en détail

Chapitre V. Les bases de données relationnelles en pratique : Mise en oeuvre et utilisation

Chapitre V. Les bases de données relationnelles en pratique : Mise en oeuvre et utilisation Chapitre V Les bases de données relationnelles en pratique : Mise en oeuvre et utilisation 175 Mise en oeuvre et utilisation d une base de données : points principaux Organisation d un système de gestion

Plus en détail

Python: Manipulation d Informations 02/05/2013

Python: Manipulation d Informations 02/05/2013 Python: Manipulation d Informations 02/05/2013 Sommaire 1. Introduction 2. Bases de données 3. Systèmes de gestion de bases de données 4. Grammaire SQL 5. Python et les bases de données : le module «SQLite»

Plus en détail

Vulnérabilités logicielles Injection SQL. Chamseddine Talhi École de technologie supérieure (ÉTS) Dép. Génie logiciel et des TI

Vulnérabilités logicielles Injection SQL. Chamseddine Talhi École de technologie supérieure (ÉTS) Dép. Génie logiciel et des TI Vulnérabilités logicielles Injection SQL Chamseddine Talhi École de technologie supérieure (ÉTS) Dép. Génie logiciel et des TI 1 Plan SQL Injection SQL Injections SQL standards Injections SQL de requêtes

Plus en détail

Introduction au langage SQL

Introduction au langage SQL Introduction au langage SQL SQL (sigle de Structured Query Language, en français langage de requête structurée) est un langage informatique normalisé servant à effectuer des opérations sur des bases de

Plus en détail

Bases de Données Relationnelles. SQL Le langage de définition des données de SQL

Bases de Données Relationnelles. SQL Le langage de définition des données de SQL Bases de Données Relationnelles SQL Le langage de définition des données de SQL Introduction SQL : Structured Query Language SQL est normalisé SQL 2: adopté (SQL 92) SQL 3: adopté (SQL 99) Standard d'accès

Plus en détail

Conception de Systèmes de Bases de Données Avec UML TD 1 - Correction

Conception de Systèmes de Bases de Données Avec UML TD 1 - Correction 1 1 Bases de Données Avancées Module B IUT Lumière, License CE-STAT 2006-2007 Pierre Parrend Conception de Systèmes de Bases de Données Avec UML TD 1 - Correction Etapes de conception d'un système de base

Plus en détail

MySQL 5 (versions 5.1 à 5.6) Guide de référence du développeur (Nouvelle édition)

MySQL 5 (versions 5.1 à 5.6) Guide de référence du développeur (Nouvelle édition) Avant-propos 1. Les objectifs de ce livre 13 2. Les principaux sujets qu'aborde ce livre 13 3. À qui s adresse ce livre? 14 4. Les pré-requis 14 Introduction à MySQL 1. Introduction aux bases de données

Plus en détail

Récapitulatif Walter RUDAMETKIN

Récapitulatif Walter RUDAMETKIN Récapitulatif Walter RUDAMETKIN Bureau F011 Walter.Rudametkin@polytech-lille.fr Notre dernier cours Moi :) Vous :( 2 Récapitulatif Les SGBD Relationnelles Objectifs et histoire Conception d'une base de

Plus en détail

SQL : Origines et Evolutions

SQL : Origines et Evolutions SQL : Origines et Evolutions SQL est dérivé de l'algèbre relationnelle et de SEQUEL Il a été intégré à SQL/DS, DB2, puis ORACLE, INGRES, Il existe trois versions normalisées, du simple au complexe : SQL1

Plus en détail

Compte rendu d activité Fiche n 1

Compte rendu d activité Fiche n 1 Compte rendu d activité Fiche n 1 Alexandre K. (http://ploufix.free.fr) Nature de l activité Création d une base de connaissances avec PostgreSQL Contexte : Le responsable technique souhaite la mise en

Plus en détail

2011 Hakim Benameurlaine 1

2011 Hakim Benameurlaine 1 Table des matières 1 CRÉATION DES OBJETS DE BASES DE DONNÉES... 2 1.1 Architecture d une base de données... 2 1.1.1 Niveau logique... 2 1.1.2 Niveau physique... 3 1.2 Gestion d une base de données... 3

Plus en détail

Cours de Bases de Données Avancées 2006-2007 Groupe cinema, Rapport 4

Cours de Bases de Données Avancées 2006-2007 Groupe cinema, Rapport 4 1 Annexes Avec ce rapport il faut rendre en annexe le script SQL corrigé qui permet de créer la base de données selon votre modèle relationnel ainsi que de la peupler avec un nombre de tuples suffisant.

Plus en détail

SQL : création et mises-à-jour de schémas et de données

SQL : création et mises-à-jour de schémas et de données SQL : création et mises-à-jour de schémas et de données Commandes de définition de données (DDL) Commandes de mise-à-jour de données (DML) Vues SQL-MAJ, vues-1 / 33 Exemple Définition de la relation

Plus en détail

TP n o 14 : Bases de données, première partie

TP n o 14 : Bases de données, première partie TP n o 14 : Bases de données, première partie I Introduction Dans ce TP nous allons effectuer des opérations élementaires sur une base de données ne comportant qu une seule table. Lors de la prochaine

Plus en détail

SQL (Première partie) Walter RUDAMETKIN

SQL (Première partie) Walter RUDAMETKIN SQL (Première partie) Walter RUDAMETKIN Bureau F011 Walter.Rudametkin@polytech-lille.fr Les commandes de base sous Unix Création d'une base ([] facultatif) : createdb nombase [ -U comptepostgres ] Destruction

Plus en détail

Modèle relationnel Création et modification des relations en SQL

Modèle relationnel Création et modification des relations en SQL Modèle relationnel Création et modification des relations en SQL ENT - Clé sql2009 BD - Mírian Halfeld-Ferrari p. 1 Insertion dans une relation Pour insérer un tuple dans une relation: insert into Sailors

Plus en détail

1. Base de données SQLite

1. Base de données SQLite Dans ce TP, nous allons voir comment créer et utiliser une base de données SQL locale pour stocker les informations. La semaine prochaine, ça sera avec un WebService. On repart de l application AvosAvis

Plus en détail

Université Paris 13 TP Base de données Année 2008-2009 Institut Galilée feuille 2 : requêtes SQL INFO1

Université Paris 13 TP Base de données Année 2008-2009 Institut Galilée feuille 2 : requêtes SQL INFO1 Université Paris 13 TP Base de données Année 2008-2009 Institut Galilée feuille 2 : requêtes SQL INFO1 Exercice 1 : requêtes simples Pour traiter de la vente par correspondance on considère la modélisation

Plus en détail

Introduction aux bases de données Cours 4 : Le langage MySQL

Introduction aux bases de données Cours 4 : Le langage MySQL Cours 4 : Le langage MySQL ESIL Université de la méditerranée Odile.Papini@esil.univmed.fr http://odile.papini.perso.esil.univmed.fr/sources/bdmat.html Plan du cours 1 Introduction 2 Identificateurs Types

Plus en détail

Le langage SQL (première partie) c Olivier Caron

Le langage SQL (première partie) c Olivier Caron Le langage SQL (première partie) 1 Plan Le S.G.B.D. postgres Le langage SQL Langage de manipulation de données Langage de requêtes 2 Quelques mots sur Postgres (1/2) Travaux de Stonebraker (Univ. Berkeley)

Plus en détail

1/28 XML. I XML = extensible markup language. I Langage de description de documents (semi)-structurés, utilisant des.

1/28 XML. I XML = extensible markup language. I Langage de description de documents (semi)-structurés, utilisant des. 1/28 2/28 Anne-Cécile Caron Master MIAGE - BDA 1er trimestre 2013-2014 XML I XML = extensible markup language I Langage de description de documents (semi-structurés, utilisant des balises

Plus en détail