Bibliographie Introduction à la bioinformatique

Dimension: px
Commencer à balayer dès la page:

Download "Bibliographie Introduction à la bioinformatique"

Transcription

1 Bibliographie Introduction à la bioinformatique 5. Les bases de données biologiques, SQL et la programmation Python/C++ Zvelebil et Baum, Understanding bioinformatics Beighley, Head First SQL Chari, A tutorial on DB concepts, SQL using MySQL at MySQL++ at Python MySQL : projects/mysql-python/ 1 2 Objectifs Expliquer pourquoi les bases de données sont importantes pour la bioinformatique Expliquer les structures et les types de bases de données différents Savoir où trouver quelles données biologiques Être capable de construire une base de données relationnelle Savoir comment normaliser des données pour une base de données relationnelle Être capable d utiliser des bibliothèques de programmation pour connecter un logiciel à une base de données Carte: traiter des bases de données 3 4

2 Les bases de données A cause de l explosion des données (séquences et structures) les bases de données (BD) ont joué un rôle important dés le début Collectionner les données dans un BD permet l analyse de ces données pour trouver des similarités La structure d une base de données Une BD est composé d un groupe de fichiers (flat-files) ou des tableaux (Base de données relationnelle) La naissance de la bioinformatique Parce que les données sont importantes pour l analyse et parce que les données sont disponibles pour tous le monde, on doit s assurer de la qualité des données Ces fichiers ou tableaux sont composés de plusieurs articles (records) et attributs (fields or attributes) 5 6 Fichier pour des séquences Fichier pour des séquences 2 Le format le plus bien connu pour les séquences est le format FASTA La première ligne (après le >) fournit l information au sujet du séquence La deuxième partie fournit le séquence (ici d une protéine) >sp P06241 FYN_HUMAN Proto-oncogene tyrosine-protein kinase Fyn OS=Homo sapiens GN=FYN PE=1 SV=3 MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL Le fichier qui est utilisé par UniProt ajoute des informations supplémentaires... DR EMBL; M14676; AAA ; -; mrna. DR EMBL; M14333; AAC ; -; mrna. DR EMBL; S74774; AAB ; -; mrna. DR EMBL; Z97989; CAI ; -; Genomic_DNA. FT TURN DR EMBL; Z97989; CAI ; -; Genomic_DNA. FT HELIX DR EMBL; BC032496; AAH ; -; mrna. FT HELIX DR IPI; IPI ; -. FT HELIX DR IPI; IPI ; -. FT HELIX DR IPI; IPI ; -. FT HELIX DR PIR; A24314; TVHUSY. FT HELIX ID FYN_HUMAN DR Reviewed; RefSeq; NP_ ; 537 AA. -. SQ SEQUENCE 537 AA; MW; 4A1E443A4B5A0977 CRC64; AC P06241; Q16248; Q5R3A6; DR Q5R3A7; RefSeq; Q8N5D7; NP_ ; -. MGCVQCKDKE ATKLTEERDG SLNQSSGYRY GTDPTPQHYP SFGVTSIPNY NNFHAAGGQG DT 01-JAN-1988, integrated DR into RefSeq; UniProtKB/Swiss-Prot. NP_ ; -. LTVFGGVNSS SHTGTLRTRG GTGVTLFVAL YDYEARTEDD LSFHKGEKFQ ILNSSEGDWW DT 23-JAN-2007, sequence DR version UniGene; 3. Hs ; -. EARSLTTGET GYIPSNYVAP VDSIQAEEWY FGKLGRKDAE RQLLSFGNPR GTFLIRESET DT 15-DEC-2009, entry version DR PDB; A0N; NMR; -; B= TKGAYSLSIR DWDDMKGDHV KHYKIRKLDN GGYYITTRAQ FETLQQLVQH YSERAAGLCC DE RecName: Full=Proto-oncogene DR PDB; tyrosine-protein 1AOT; NMR; -; F= kinase RLVVPCHKGM PRLTDLSVKT KDVWEIPRES LQLIKRLGNG QFGEVWMGTW NGNTKVAIKT Fyn; DR PDB; 1AOU; NMR; -; F= LKPGTMSPES FLEEAQIMKK LKHDKLVQLY AVVSEEPIYI VTEYMNKGSL LDFLKDGEGR DE EC= ; DR PDB; 1AVZ; X-ray; 3.00 A; C= ALKLPNLVDM AAQVAAGMAY IERMNYIHRD LRSANILVGN GLICKIADFG LARLIEDNEY DE AltName: Full=p59-Fyn; DR PDB; 1AZG; NMR; -; B= TARQGAKFPI KWTAPEAALY GRFTIKSDVW SFGILLTELV TKGRVPYPGM NNREVLEQVE DE AltName: Full=Protooncogene DR PDB; Syn; 1EFN; X-ray; 2.50 A; A/C= RGYRMPCPQD CPISLHELMI HCWKKDPEER PTFEYLQSFL EDYFTATEPQ YQPGENL DE AltName: Full=SLK; DR PDB; 1FYN; X-ray; 2.30 A; A= // GN Name=FYN; DR PDB; 1G83; X-ray; 2.60 A; A/B= OS Homo sapiens (Human). DR PDB; 1M27; X-ray; 2.50 A; C= OC Eukaryota; Metazoa; Chordata; DR PDB; Craniata; 1NYF; NMR; Vertebrata; -; A= Euteleostomi; DR PDB; 1NYG; NMR; -; A= OC Mammalia; Eutheria; Euarchontoglires; DR PDB; 1SHF; X-ray; Primates; 1.90 A; A/B= Haplorrhini; DR PDB; 1ZBJ; NMR; -; A= OC Catarrhini; Hominidae; DR Homo. PDB; 2DQ7; X-ray; 2.80 A; X= OX NCBI_TaxID=9606; UNIPROT : 7 8

3 Les Bases de données relationnelle Les Bases de données relationnelle 2 Les fichiers-plats sont faciles à créer mais (comme dans l exemple précédent) difficile à consulter. Pour la consultation d une BD relationnelle ont utilise un langage d'interrogation : SQL (Structured Query Language) Les base de données (BD) relationnelle sont employées couramment pour des données biologiques Les données sont enregistrées dans un ensemble de tableaux qui sont liés par un champ partagé, appelé une clé SELECT protein-code, protein-name FROM protab1 WHERE species-origin= Bovine P100I Hemoglobin 9 10 Les Bases de données relationnelle 3 Autres formats SELECT protab1.protein-code, protab1.protein-name, protab2.protein-sequence FROM protab1,protab2 WHERE protab1.protein-code = protab2.protein-code AND protab2.protein-code = P1002 P1002 Hemoglobin MDKTSHGFEIKLLTPKKLQQWLMIAIYFGHT... Le XML (extensible markup language) est un outil général pour le stockage de données et de l information Comme le HTML, ce langage utilise des indicateurs qui entourent des sections de données Différent du HTML, XML offre la possibilité de créer des indicateurs arbitraires XQuery est utilisé pour l interrogation des fichier de XML <?xml version='1.0' encoding='utf-8'?> <uniprot xmlns="http://uniprot.org/uniprot" xmlns:xsi="http:// xsi:schemalocation="http:// uniprot.org/uniprot uniprot.xsd"> <entry dataset="swiss-prot" created=" " modified=" " version="139"> <accession>p06241</accession> <accession>q16248</accession> <accession>q5r3a6</accession> <accession>q5r3a7</accession> <accession>q8n5d7</accession> <name>fyn_human</name> <protein> <recommendedname ref="1"> <fullname>proto-oncogene tyrosine-protein kinase Fyn</fullName> </recommendedname> <alternativename> <fullname>p59-fyn</fullname> </alternativename> <alternativename> <fullname>protooncogene Syn</fullName> </alternativename> <alternativename> <fullname>slk</fullname> </alternativename> </protein> <gene> <name type="primary">fyn</name> </gene> <organism key="2"> <name type="scientific">homo sapiens</name> <name type="common">human</name> <dbreference type="ncbi Taxonomy" id="9606" key="3" />

4 Types des bases de données Types de bases de données 2 Parfois on fait la distinction entre des bases de données qui sont composées de données primaires ou secondaires (dérivées) Les bases de données primaires contiennent les résultats expérimentaux bruts ou la première incitation pour rendre des données publiques Dans UniProt les données sont la séquence et son identification Tous les références vers d autres bases de données ou sur les interactions/fonctions des protéines sont des annotations ex. GenBank, UniProt, RCSB protein database,... Les bases de données secondaires contiennent des résultats des analyses de ressources primaires Les données sont les informations principales de la base de données et toutes les informations additionnelles sont des annotations ex. CATH, PFAM, SCOP, SNPeffect, BriX Quelles bases de données? Ontologies Parce que les bases de données font la combinaison entre des données différentes provenant de différents lieux et que chaque ressource utilise des mots différents, on a besoin d une spécification explicite des mots et des rapports entre eux pour le partage des données : ontologie Le journal Nucleic Acids Research (NAR) compile une liste des bases de données (le Molecular Biology Database Collection) qui est divisée en 14 catégories L ontologie de gènes (GO) L ontologie MOA

5 Exemple de séquences de l ADN : GenBank Exemple de séquences de protéines : UniProt Genbank/ UniParc est une base de données nonredondante de toutes les séquences de protéines disponibles publiquement UniProtKB est la base de données centrale avec des annotations riches et précises UniRef (100,90 et 50) sont des ensembles de séquences qui étaient dérivées en utilisant des différents degrés de similarité (100%, 90% et 50%) 17 Exemple des génomes de vertébrés et d autres espèces eucaryotes: ENSEMBL Exemple des structures: RCSB protein database index.html 18 home.do 19 20

6 Exemple interactions entre des protéines: MINT Exemple classification des protéines: INTERPRO Welcome.do La qualité des données La qualité des données 2 C est important que les données ne mènent pas à des conclusions incorrectes Parfois on ajoute une mesure pour la qualité et le fiabilité des données Parfois le même travail est fait plusieurs fois et ces résultats font partie de la même base de données : il y de la redondance Cette redondance pourrait introduire un déplacement dans les résultat d une analyse par exemple: Si 50% des séquences dans une base de données ont une similarité de plus de 90%, l analyse des fréquences d acides aminées différents ne donne pas une idée correcte des fréquences de ceux-ci dans toutes les protéines normales 23 24

7 La qualité des données 3 uniformité des données Une méthode pourrait vérifier automatiquement si les séquences sont correctes. Autrement, il faut introduire des nouveaux caractères qui représentent l incertitude Un méthode pourrait vérifier si les coordonnées des atomes dans une structure (ex. les longueurs et les angles des liens entre les atomes) sont correctes... Même si les méthodes automatiques pour détecter des erreurs dans les données produisent des bons résultats, l intervention humaine est toujours importante pour assurer la qualité des données Comment créer une base de donnée relationnelle? Comme déjà expliqué, une BD est une ensemble de données qui sont organisées dans un certain façon Ces BD enlèvent tous les redondances et essaie de clarifier la structure dans les données c.a.d. on enlève les données semblables de la collection de données et on les mets dans des tableaux On fait ça pour chaque tableau récursivement A l'extrémité la base de données complet est normalisée Une base de donnée normalisée est plus facile à mettre à jour ou étendre ultérieurement Comment créer une base de donnée relationnelle? Comme déjà expliqué, une BD est une ensemble de données qui sont organisées dans un certain façon Ces BD enlèvent tous les redondances et essaie de clarifier la structure dans les données c.a.d. on enlève les données semblables de la collection de données et on les mets dans des tableaux On fait ça pour chaque tableau récursivement A l'extrémité la base de données complet est normalisée Une base de donnée normalisée est plus facile à mettre à jour ou étendre ultérieurement Comment créer une base de donnée relationnelle? Comme déjà expliqué, une BD est une ensemble de données qui sont organisées dans un certain façon Ces BD enlèvent tous Ceci les n est redondances pas un cours et sur essaie les de clarifier la structure dans les données bases de données c.a.d. on enlève les données semblables de la collection de données et on les mets dans des tableaux On fait ça pour chaque tableau récursivement A l'extrémité la base de données complet est normalisée Une base de donnée normalisée est plus facile à mettre à jour ou étendre ultérieurement 27 27

8 Normalisation en 5 glissières Ex 5.1 : Prenons les données suivantes : Normalisation en 5 glissières 2 La première forme normale : chaque type de colonne est unique et il n y a aucun groupe de répétitions de données le nom de la protéine FYN le nom d espèce souris la séquence numéro d identification domaine 1 (NI) NI domaine 1 région 1 (start/ stop) domaine 2 NI domaine 2 région 2 (start/ stop) KLTEERDG... MGCVQCKDKEAA P39688 SH2 PF SH3 PF Dans notre exemple, les domaines sont répétés dans des protéines différentes SRC SRC CD2AP souris homme homme QRRRSLEP... MGSNKSKPKDAS P05480 SH2 PF SH3 PF QRRRSLEP... MGSNKSKPKDAS P12931 SH2 PF SH3 PF VHDDELTI... MVDYIVEYDYDA Q9Y5K6 SH3 PF SH3 PF Si on détecte un autre domaine dans la protéine, on doit ajouter 3 colonnes additionnelles Par exemple, la protéine CD2AP a trois domaines SH3 dans sa structure Transformez ce tableau en un ensemble de tableaux normalisés tableau de liaison Il y un rapport multiple entre les protéines et les domaines: nouveau tableau : domaines dans protéines Normalisation en 5 glissières 3 Normalisation en 5 glissières 4 La deuxième forme normale : Tous les attributs dans le tableau devraient dépendre seulement de l identificateur unique du tableau Attention!!! On a utilisé ici les numéros de références de UniProt. Ces numéros sont uniques La troisième forme normale : Aucune entrée de colonne ne devrait dépendre d une autre entrée (la valeur) que la clé du tableau le nom de la protéine FYN SRC SRC CD2AP le nome d espèce souris souris homme homme le séquence MGCVQCKDKEAA KLTEERDG... MGSNKSKPKDAS QRRRSLEP... MGSNKSKPKDAS QRRRSLEP... MVDYIVEYDYDA VHDDELTI... numéro d identification (NI) P39688 P05480 P12931 Q9Y5K6 le nom de la protéine FYN SRC SRC le nome d espèce souris souris homme le séquence MGCVQCKDKEAA KLTEERDG... MGSNKSKPKDAS QRRRSLEP... MGSNKSKPKDAS QRRRSLEP... numéro d identification (NI) P39688 P12931 P12931 l information sur les espèces ne fait pas partie de l information des protéines Faire un nouveau tableau pour les espèces CD2AP homme MVDYIVEYDYDA VHDDELTI... Q9Y5K

9 Normalisation en 5 glissières 5 SQL Ces trois étapes de normalisation nous donnent une diagramme décrivant les tableaux et leurs relations Il y a 4 commandes de base en SQL INSERT - pour ajouter des données DELETE - pour effacer des données SELECT - pour retrouver des données UPDATE - pour changer des données Maintenant on va les construire en utilisant MySQL Getting started with MySQL : articles/mysql_intro.html SQL 2 SQL 3 Avant de construire les tableaux pour la base de données, on doit connaître les types de chaque attribut Avant de construire les tableaux pour la base de données, on doit connaître les types de chaque attribut Ici nous mentionnons seulement les types dont nous avons besoin pour l exemple Ici nous mentionnons seulement les types dont nous avons besoin pour l exemple Nombres Les attributs DetP-région-start et DetPrégion-stop sont des nombres qui indiquent le début et le fin d un domaine dans la séquence de la protéine La longueur d un domaine est toujours inférieur à 1000 résidus Dans ce cas Le type SMALLINT de SQL est suffisant SMALLINT 2 bytes Nombre entier avec l intervalle non-signé de 0 à et un intervalle signé entre et Chaînes de texte de longueur fixe Toutes les clés (comme NI-protéine et NIdomaine), nom-domaine, nom-espèces et nom-protéines ont une longueur limitée 6 et 7 caractères pour les clés et maximum 255 caractères pour le reste Dans ces cas le type CHAR(longueur) ou le type VARCHAR(longueur) de SQL est suffisant Le longueur de VARCHAR est limité à 255 caractères CHAR(longueur) et VARCHAR(longueur) longueur bytes Une Chaîne de texte de longueur fixe. Quand un mot est assigné à l attribut, les espaces à la fin inutilisés sont enlevés avant d enregistrer les données 34 35

10 SQL 4 Avant de construire les tableaux pour la base de données, on doit connaître les types de chaque attribut Ici nous mentionnons seulement les types dont nous avons besoin pour l exemple SQL 5 Maintenant, toute l information est disponible pour construire la base de données Textes L attribut séquence doit enregistrer des chaînes de caractères avec une longueur supérieure à 255 caractères et il y a une variance entre des protéines différentes Dans ce cas le type TEXT de SQL est suffisant TEXT 64 Kbytes On commence avec la création d une base de données avec le nom sequences Attention au restrictions : la base de données est créé par le root! SQL 6 SQL 7 et aussi tous les tableaux Les tableaux sont créés en utilisant la commande CREATE TABLE L ensemble des attributs detp_ni_proteine, detp_ni_domaine et detp_region_start fournis une identification unique pour chaque article dans le tableau detp Pour afficher les tableaux de la base de données, on utilise la commande SHOW TABLES Pour afficher les attributs au sein d un tableau, on utilise la commande SHOW COLUMNS FROM ALTER TABLE est utilisé pour créer la clé primaire la combinaison des trois premiers attributs est la clé primaire 38 39

11 SQL 8 SQL 9 Les données sont insérées en utilisant la commande INSERT INTO Les données peuvent être insérées toutes ensembles SELECT montre les données enregistrées dans le tableau SQL 10 SQL

12 SQL 12 SQL 13 Maintenant, que toutes les données sont insérées dans la base de données essayons des variations de déclaration de SELECT Choisir toutes les protéines avec le nom SRC Choisir toutes les protéines qui ont la sous-séquence SNKSK dans leur séquence % représente plusieurs caractères aléatoires Les résultats peuvent être arrangés dans une ordre particulier en utilisant la déclaration ORDER BY Choisir toutes les protéines qui ont la sous-séquence K_A dans leur séquence _ signifie un caractère aléatoire asc et desc signifient l ordre croissant et décroissant SQL 14 SQL 15 Choisir toutes les protéines qui ont la sous-séquence K_A dans leur séquence ET qui font partie de l'espèce souris La déclaration SELECT peut combiner des tableaux différents les autres opérations logiques sont OR, NOT Montrer tous les domaines de chaque protéine Compter les nombres de protéines FYN er SRC dans la base de données MAX et SUM sont deux autres opérations mathématiques dans SQL Voici ce qui fait une base de données relationnelle 46 47

13 SQL 16 La déclaration JOIN fait la combinaison entre des tableaux automatiquement LEFT JOIN combine les tableaux et affiche les valeurs de toutes les données dans la tableau gauche (proteines) avec les valeurs du tableau droit (especes), s ils sont connus SQL 17 RIGHT JOIN fait de même mais de droite à gauche Parce que le numéro 7227 n existe pas dans le tableau especes, la protéine ABL n est pas affichée Dans l exemple, on ajoute une nouvelle protéine avec un NI d espèce qui est inconnu dans le tableau especes 7227 (mouche) SQL 18 SQL 19 ALTER est utilisé pour ajouter des nouvelles colonnes dans les tableaux ou pour changer les colonnes UPDATE est utilisé pour changer les valeurs des attributs dans un tableau ipi est le international protein index introduit par l organisation EBI la déclaration MODIFY peut changer des propriétés des colonnes il n y a pas de IPI pour la protéine ABL ALTER peut aussi changer le nom du tableau 50 51

14 SQL 20 DELETE est utilisé pour enlever des données On pourrait crée une copie de sauvegarde en utilisant mysqldump SQL 21 DROP TABLE enlève les tableaux ATTENTION!!! Comment connecter un logiciel à une base de données? La classe DBConnection Le type de retour d un select est StoreQueryResult Le type Connection de mysqlpp enregistre la connexion avec la base de données de MySQL 54 55

15 La classe DBConnection 2 La classe DBConnection 3 L objet query enregistre la déclaration SQL le retour de cette fonction est la nouvelle clé de l article enregistrée par la méthode insert Le méthode connect établi la connexion avec la base de données Le méthode disconnect enlève la connexion avec la base de données La méthode query.execute() est utilisée si on ne prévoit pas de résultats, autrement on utilise query.store() pour enregistrer les résultats Le main Le main 2 l information pour la base de données Voila fait la connexion fait la déclaration de SELECT le résultats sont enregistrés dans selresult la méthode at(.) retourne une ligne des résultats Petite fonction auxiliaire pour obtenir la valeur d'un attribut particulier dans le ligne row 58 59

16 et en Python? et en Python? 60 61

COMMANDES SQL... 2 COMMANDES DE DEFINITION DE DONNEES... 2

COMMANDES SQL... 2 COMMANDES DE DEFINITION DE DONNEES... 2 SQL Sommaire : COMMANDES SQL... 2 COMMANDES DE DEFINITION DE DONNEES... 2 COMMANDES DE MANIPULATION DE DONNEES... 2 COMMANDES DE CONTROLE TRANSACTIONNEL... 2 COMMANDES DE REQUETE DE DONNEES... 2 COMMANDES

Plus en détail

Bioinformatique BTV Stockage des données

Bioinformatique BTV Stockage des données 1 / 64 Bioinformatique BTV Stockage des données Jean-Michel Richer jean-michel.richer@univ-angers.fr http://www.info.univ-angers.fr/pub/richer Juillet 2008 2 / 64 Plan Plan 1 Introduction 2 Format de stockage

Plus en détail

SQL Historique 1982 1986 1992

SQL Historique 1982 1986 1992 SQL Historique 1950-1960: gestion par simple fichier texte 1960: COBOL (début de notion de base de données) 1968: premier produit de sgbdr structuré (IBM -> IDMS) 1970-74: élaboration de l'outil d'analyse

Plus en détail

15 septembre 2010. Démo #2 MySQL Séquençage

15 septembre 2010. Démo #2 MySQL Séquençage 15 septembre 2010 Démo #2 MySQL Séquençage SQL et MySQL SQL: structured query language langage pour manipuler des données dans des bases de données relationnelles MySQL: Implantation de SQL Ajout à SQL

Plus en détail

Information utiles. cinzia.digiusto@gmail.com. webpage : Google+ : http://www.ibisc.univ-evry.fr/ digiusto/

Information utiles. cinzia.digiusto@gmail.com. webpage : Google+ : http://www.ibisc.univ-evry.fr/ digiusto/ Systèmes de gestion de bases de données Introduction Université d Evry Val d Essonne, IBISC utiles email : cinzia.digiusto@gmail.com webpage : http://www.ibisc.univ-evry.fr/ digiusto/ Google+ : https://plus.google.com/u/0/b/103572780965897723237/

Plus en détail

Langage SQL : créer et interroger une base

Langage SQL : créer et interroger une base Langage SQL : créer et interroger une base Dans ce chapitre, nous revenons sur les principales requêtes de création de table et d accès aux données. Nous verrons aussi quelques fonctions d agrégation (MAX,

Plus en détail

Cours 7 : Langage de définition, manipulation et contrôle des données

Cours 7 : Langage de définition, manipulation et contrôle des données Cours 7 : Langage de définition, manipulation et contrôle des données Objets d une base de données Dans un schéma Tables, vues Index, clusters, séquences, synonymes Packages, procédures, fonctions, déclencheurs

Plus en détail

OpenPaaS Le réseau social d'entreprise

OpenPaaS Le réseau social d'entreprise OpenPaaS Le réseau social d'entreprise Spécification des API datastore SP L2.3.1 Diffusion : Institut MinesTélécom, Télécom SudParis 1 / 12 1OpenPaaS DataBase API : ODBAPI...3 1.1Comparaison des concepts...3

Plus en détail

CREATION WEB DYNAMIQUE

CREATION WEB DYNAMIQUE CREATION WEB DYNAMIQUE IV ) MySQL IV-1 ) Introduction MYSQL dérive directement de SQL (Structured Query Language) qui est un langage de requêtes vers les bases de données relationnelles. Le serveur de

Plus en détail

Langage SQL (1) 4 septembre 2007. IUT Orléans. Introduction Le langage SQL : données Le langage SQL : requêtes

Langage SQL (1) 4 septembre 2007. IUT Orléans. Introduction Le langage SQL : données Le langage SQL : requêtes Langage SQL (1) Sébastien Limet Denys Duchier IUT Orléans 4 septembre 2007 Notions de base qu est-ce qu une base de données? SGBD différents type de bases de données quelques systèmes existants Définition

Plus en détail

11. MySQL. Cours Web. MySQL. 11. MySQL. 11. MySQL. Structured Query Language. Lionel Seinturier. Université Pierre & Marie Curie

11. MySQL. Cours Web. MySQL. 11. MySQL. 11. MySQL. Structured Query Language. Lionel Seinturier. Université Pierre & Marie Curie Cours Web Lionel Seinturier Université Pierre & Marie Curie Lionel.Seinturier@lip6.fr Structured Query Language Langage de manipulation des données stockées dans une base de données interrogation/insertion/modification/suppression

Plus en détail

Instructions SQL. Première partie : Langage de description et de gestion des données

Instructions SQL. Première partie : Langage de description et de gestion des données Instructions SQL Première partie : Langage de description et de gestion des données Quelques instructions et leur syntaxe 1. Introduction Trois principales catégories d instructions. Instructions de création

Plus en détail

Les bases de données

Les bases de données Les bases de données Introduction aux fonctions de tableur et logiciels ou langages spécialisés (MS-Access, Base, SQL ) Yves Roggeman Boulevard du Triomphe CP 212 B-1050 Bruxelles (Belgium) Idée intuitive

Plus en détail

Introduction aux bases de données: application en biologie

Introduction aux bases de données: application en biologie Introduction aux bases de données: application en biologie D. Puthier 1 1 ERM206/Technologies Avancées pour le Génome et la Clinique, http://tagc.univ-mrs.fr/staff/puthier, puthier@tagc.univ-mrs.fr ESIL,

Plus en détail

Olivier Mondet http://unidentified-one.net

Olivier Mondet http://unidentified-one.net T-GSI Ch.4 Le Langage SQL LDD, LCD Cet exercice guidé reprend le plan suivis lors de l intervention de formation faite pour l académie de Versailles. L objectif principal visait en la présentation du langage

Plus en détail

Pour les débutants. langage de manipulation des données

Pour les débutants. langage de manipulation des données Pour les débutants SQL : langage de manipulation des données Les bases de données sont très utilisées dans les applications Web. La création, l interrogation et la manipulation des données de la base sont

Plus en détail

TP1 - Corrigé. Manipulations de données

TP1 - Corrigé. Manipulations de données TP1 - Corrigé Manipulations de données 1. Démarrez mysql comme suit : bash$ mysql -h 127.0.0.1 -u user4 -D db_4 p Remarque: le mot de passe est le nom de user. Ici user4 2. Afficher la liste des bases

Plus en détail

Bases de données relationnelles

Bases de données relationnelles Bases de données relationnelles Système de Gestion de Bases de Données Une base de données est un ensemble de données mémorisé par un ordinateur, organisé selon un modèle et accessible à de nombreuses

Plus en détail

1. LA GESTION DES BASES DE DONNEES RELATIONNELLES

1. LA GESTION DES BASES DE DONNEES RELATIONNELLES Dossier G11 - Interroger une base de données La base de données Facturation contient tout un ensemble d'informations concernant la facturation de la SAFPB (société anonyme de fabrication de produits de

Plus en détail

Vulnérabilités logicielles Injection SQL. Chamseddine Talhi École de technologie supérieure (ÉTS) Dép. Génie logiciel et des TI

Vulnérabilités logicielles Injection SQL. Chamseddine Talhi École de technologie supérieure (ÉTS) Dép. Génie logiciel et des TI Vulnérabilités logicielles Injection SQL Chamseddine Talhi École de technologie supérieure (ÉTS) Dép. Génie logiciel et des TI 1 Plan SQL Injection SQL Injections SQL standards Injections SQL de requêtes

Plus en détail

Le langage SQL pour Oracle - partie 1 : SQL comme LDD

Le langage SQL pour Oracle - partie 1 : SQL comme LDD Le langage SQL pour Oracle - partie 1 : SQL comme LDD 1 SQL : Introduction SQL : Structured Query Langage langage de gestion de bases de donn ees relationnelles pour Définir les données (LDD) interroger

Plus en détail

Le langage SQL (première partie) c Olivier Caron

Le langage SQL (première partie) c Olivier Caron Le langage SQL (première partie) 1 Plan Le S.G.B.D. postgres Le langage SQL Langage de manipulation de données Langage de requêtes 2 Quelques mots sur Postgres (1/2) Travaux de Stonebraker (Univ. Berkeley)

Plus en détail

Auto-évaluation DB2 for z/os: cours de base

Auto-évaluation DB2 for z/os: cours de base Auto-évaluation DB2 for z/os: cours de base Document: f1067test.fm 22/01/2013 ABIS Training & Consulting P.O. Box 220 B-3000 Leuven Belgium TRAINING & CONSULTING INTRODUCTION AUTO-ÉVALUATION DB2 FOR Z/OS:

Plus en détail

Cours de Base de Données Cours n.2 Introduction à MySQL/PhPMyAdmin

Cours de Base de Données Cours n.2 Introduction à MySQL/PhPMyAdmin Cours de Base de Données Cours n.2 Introduction à MySQL/PhPMyAdmin Ce cours reprend beaucoup de transparents du cours de Philippe LAHIRE Elisabetta De Maria - edemaria@i3s.unice.fr UFR Sciences et Laboratoire

Plus en détail

PHP 5. La base de données MySql. A. Belaïd 1

PHP 5. La base de données MySql. A. Belaïd 1 PHP 5 La base de données MySql A. Belaïd 1 Base de données C est quoi une base de données? Une base de données contient une ou plusieurs tables, chaque table ayant un ou plusieurs enregistrements Exemple

Plus en détail

14/04/2014. un ensemble d'informations sur un sujet : exhaustif, non redondant, structuré, persistant. Gaëlle PERRIN SID2 Grenoble.

14/04/2014. un ensemble d'informations sur un sujet : exhaustif, non redondant, structuré, persistant. Gaëlle PERRIN SID2 Grenoble. Gaëlle PERRIN SID2 Grenoble Le 10/04/2014 Base de Données (BD) : une grande quantité de données, centralisées ou non, servant pour les besoins d'une ou plusieurs applications, interrogeables et modifiables

Plus en détail

Web dynamique. Techniques, outils, applications. (Partie C)

Web dynamique. Techniques, outils, applications. (Partie C) Web dynamique Techniques, outils, applications (Partie C) Nadir Boussoukaia - 2006 1 SOMMAIRE 1. MySQL et PHP (20 min) 2. SQL (petits rappels) (20 min) 2 MySQL et PHP Synthèse 3 MySQL et PHP SGBD MySQL

Plus en détail

Le Langage SQL version Oracle

Le Langage SQL version Oracle Université de Manouba École Supérieure d Économie Numérique Département des Technologies des Systèmes d Information Le Langage SQL version Oracle Document version 1.1 Mohamed Anis BACH TOBJI anis.bach@isg.rnu.tn

Plus en détail

Présentation du module Base de données spatio-temporelles

Présentation du module Base de données spatio-temporelles Présentation du module Base de données spatio-temporelles S. Lèbre slebre@unistra.fr Université de Strasbourg, département d informatique. Partie 1 : Notion de bases de données (12,5h ) Enjeux et principes

Plus en détail

Bases de Données relationnelles et leurs systèmes de Gestion

Bases de Données relationnelles et leurs systèmes de Gestion III.1- Définition de schémas Bases de Données relationnelles et leurs systèmes de Gestion RAPPELS Contraintes d intégrité sous Oracle Notion de vue Typage des attributs Contrainte d intégrité Intra-relation

Plus en détail

Création et Gestion des tables

Création et Gestion des tables Création et Gestion des tables Version 1.0 Z Grégory CASANOVA 2 Sommaire 1 Introduction... 3 2 Pré-requis... 4 3 Les tables... 5 3.1 Les types de données... 5 3.1.1 Les types de données Sql Server... 5

Plus en détail

NFA 008. Introduction à NoSQL et MongoDB 25/05/2013

NFA 008. Introduction à NoSQL et MongoDB 25/05/2013 NFA 008 Introduction à NoSQL et MongoDB 25/05/2013 1 NoSQL, c'est à dire? Les bases de données NoSQL restent des bases de données mais on met l'accent sur L'aspect NON-relationnel L'architecture distribuée

Plus en détail

4. Utilisation d un SGBD : le langage SQL. 5. Normalisation

4. Utilisation d un SGBD : le langage SQL. 5. Normalisation Base de données S. Lèbre slebre@unistra.fr Université de Strasbourg, département d informatique. Présentation du module Contenu général Notion de bases de données Fondements / Conception Utilisation :

Plus en détail

Rapport de Cryptographie

Rapport de Cryptographie Cryptographie [MIF30] / Année 2008-2009 Rapport de Cryptographie Les Injections SQL Sylvie Tixier & François-Xavier Charlet Page 1 20/05/2009 Sommaire Introduction...3 Définition d une injection SQL...3

Plus en détail

Bases de données. Chapitre 1. 1.1 Généralité sur les bases de données. 1.2 Avec sqlite3. 1.1.1 Le langage SQL et les bases de données

Bases de données. Chapitre 1. 1.1 Généralité sur les bases de données. 1.2 Avec sqlite3. 1.1.1 Le langage SQL et les bases de données Chapitre 1 Bases de données 1.1 Généralité sur les bases de données 1.1.1 Le langage SQL et les bases de données La base de données (BDD) est un système qui enregistre des informations. Ces informations

Plus en détail

1 Introduction et installation

1 Introduction et installation TP d introduction aux bases de données 1 TP d introduction aux bases de données Le but de ce TP est d apprendre à manipuler des bases de données. Dans le cadre du programme d informatique pour tous, on

Plus en détail

2011 Hakim Benameurlaine 1

2011 Hakim Benameurlaine 1 Table des matières 1 CRÉATION DES OBJETS DE BASES DE DONNÉES... 2 1.1 Architecture d une base de données... 2 1.1.1 Niveau logique... 2 1.1.2 Niveau physique... 3 1.2 Gestion d une base de données... 3

Plus en détail

Exemple accessible via une interface Web. Bases de données et systèmes de gestion de bases de données. Généralités. Définitions

Exemple accessible via une interface Web. Bases de données et systèmes de gestion de bases de données. Généralités. Définitions Exemple accessible via une interface Web Une base de données consultable en ligne : Bases de données et systèmes de gestion de bases de données The Trans-atlantic slave trade database: http://www.slavevoyages.org/tast/index.faces

Plus en détail

Memento MYSQL LINUX. Pour installer le serveur Mysql. Installer les paquets suivants :

Memento MYSQL LINUX. Pour installer le serveur Mysql. Installer les paquets suivants : Memento MYSQL LINUX Pour installer le serveur Mysql Installer les paquets suivants : Mysql-server (moteur de bases de données) Apache2 (serveur web si besoin) Php5 (langage de programmation permettant

Plus en détail

1/ Présentation de SQL Server :

1/ Présentation de SQL Server : Chapitre II I Vue d ensemble de Microsoft SQL Server Chapitre I : Vue d ensemble de Microsoft SQL Server Module: SQL server Semestre 3 Année: 2010/2011 Sommaire 1/ Présentation de SQL Server 2/ Architerture

Plus en détail

Bases de données Niveau 1 SQL - MySQL MariaDB - Cours et TP 5 DDL et DML

Bases de données Niveau 1 SQL - MySQL MariaDB - Cours et TP 5 DDL et DML Bases de données Niveau 1 SQL - MySQL MariaDB - Cours et TP 5 DDL et DML MariaDB : https://mariadb.org/ Site officiel MySQL : http://www-fr.mysql.com/ Zone pour les développeurs : http://dev.mysql.com/

Plus en détail

Le Langage De Description De Données(LDD)

Le Langage De Description De Données(LDD) Base de données Le Langage De Description De Données(LDD) Créer des tables Décrire les différents types de données utilisables pour les définitions de colonne Modifier la définition des tables Supprimer,

Plus en détail

Les BASES de DONNEES dans WampServer

Les BASES de DONNEES dans WampServer Les BASES de DONNEES dans WampServer 1 Définitions Générales Une base de données (BDD) permet d'enregistrer, de stocker, de ranger des données de façon organisée et hiérarchisée. SQL est le langage qui

Plus en détail

Apprendre le langage SQL le DDL - 1 / 30 - Apprendre le langage SQL par l exemple

Apprendre le langage SQL le DDL - 1 / 30 - Apprendre le langage SQL par l exemple Apprendre le langage SQL le DDL - 1 / 30 - Apprendre le langage SQL par l exemple Ce document est publié sous licence Creative Commons CC-by-nc-nd. Il ne peut ni être modifié, ni faire l objet d une exploitation

Plus en détail

Mysql avec EasyPhp. 1 er mars 2006

Mysql avec EasyPhp. 1 er mars 2006 Mysql avec EasyPhp 1 er mars 2006 Introduction MYSQL dérive directement de SQL (Structured Query Language) qui est un langage de requètes vers les bases de données relationnelles. Il en reprend la syntaxe

Plus en détail

Cours de Bases de Données Avancées 2006-2007 Groupe cinema, Rapport 4

Cours de Bases de Données Avancées 2006-2007 Groupe cinema, Rapport 4 1 Annexes Avec ce rapport il faut rendre en annexe le script SQL corrigé qui permet de créer la base de données selon votre modèle relationnel ainsi que de la peupler avec un nombre de tuples suffisant.

Plus en détail

Présentation du module. Base de données spatio-temporelles. Exemple. Introduction Exemple. Plan. Plan

Présentation du module. Base de données spatio-temporelles. Exemple. Introduction Exemple. Plan. Plan Base de données spatio-temporelles S. Lèbre slebre@unistra.fr Université de Strasbourg, département d informatique. Présentation du module Contenu général Partie 1 : Notion de bases de données (Conception

Plus en détail

La gestion de données dans le cadre d une application de recherche d alignement de séquence : BLAST.

La gestion de données dans le cadre d une application de recherche d alignement de séquence : BLAST. La gestion de données dans le cadre d une application de recherche d alignement de séquence : BLAST. Gaël Le Mahec - p. 1/12 L algorithme BLAST. Basic Local Alignment Search Tool est un algorithme de recherche

Plus en détail

Chapitre 4. 4.1 Installation de MySQL. Au fond, est-ce que ranger ça ne revient pas un peu à foutre le bordel dans son désordre?

Chapitre 4. 4.1 Installation de MySQL. Au fond, est-ce que ranger ça ne revient pas un peu à foutre le bordel dans son désordre? Chapitre 4 Introduction à SQL Au fond, est-ce que ranger ça ne revient pas un peu à foutre le bordel dans son désordre? Philippe Geluck 4.1 Installation de MySQL Pour télécharger MySQL avec l'installateur

Plus en détail

Sauvegarde locale des données : SharedPreferences, SQLite, Files

Sauvegarde locale des données : SharedPreferences, SQLite, Files Sauvegarde locale des données : SharedPreferences,, Files Jean-Ferdinand Susini Maître de conférences au CNAM Sources : Wikipedia, developper.android.com Paris, 31/05/2015 Les SharedPreferences 2 Héritier

Plus en détail

ISC21-1 --- Système d Information Architecture et Administration d un SGBD Compléments SQL

ISC21-1 --- Système d Information Architecture et Administration d un SGBD Compléments SQL ISC21-1 --- Système d Information Architecture et Administration d un SGBD Compléments SQL Jean-Marie Pécatte jean-marie.pecatte@iut-tlse3.fr 16 novembre 2006 ISIS - Jean-Marie PECATTE 1 Valeur de clé

Plus en détail

16H Cours / 18H TD / 20H TP

16H Cours / 18H TD / 20H TP INTRODUCTION AUX BASES DE DONNEES 16H Cours / 18H TD / 20H TP 1. INTRODUCTION Des Fichiers aux Bases de Données 2. SYSTEME DE GESTION DE BASE DE DONNEES 2.1. INTRODUCTION AUX SYSTEMES DE GESTION DE BASES

Plus en détail

SGBDR. Systèmes de Gestion de Bases de Données (Relationnelles)

SGBDR. Systèmes de Gestion de Bases de Données (Relationnelles) SGBDR Systèmes de Gestion de Bases de Données (Relationnelles) Plan Approches Les tâches du SGBD Les transactions Approche 1 Systèmes traditionnels basés sur des fichiers Application 1 Gestion clients

Plus en détail

Cours de Bioinformatique Appliquée (Partie 1)

Cours de Bioinformatique Appliquée (Partie 1) Enseignement de Bioinformatique Appliquée CM 10h TD 16h (4 séances de 4h) Travail Personnel 8h Horaires de CM -08 Sept 14-16h -09 Sept 10-12h -15 Sept 14-16h -22 Sept 14-16h -29 Sept 14-16h Travail Personnel

Plus en détail

Automatisation de la plateforme MicroScope avec l API JBPM. Engelen. CEA/DSV/IG/Genoscope Métabolique Laboratoire (Atelier) de Génomique.

Automatisation de la plateforme MicroScope avec l API JBPM. Engelen. CEA/DSV/IG/Genoscope Métabolique Laboratoire (Atelier) de Génomique. Atelier «BioWorkFlow» - 25/09/08 Automatisation de la plateforme MicroScope avec l API JBPM David Vallenet & Stéfan Engelen CEA/DSV/IG/Genoscope CNRS-UMR Génomique Métabolique Laboratoire (Atelier) de

Plus en détail

I. MySQL : Serveur et SGBD

I. MySQL : Serveur et SGBD Le Système de Gestion de Base de Données MySQL I. MySQL : Serveur et SGBD Menu I. MySQL : Serveur et SGBG II. Création d'une base de données avec MySQL MySQL est un système de gestion et conception de

Plus en détail

Les requêtes Oracle XML DB. Du modèle relationnelle au modèle Hiérarchique

Les requêtes Oracle XML DB. Du modèle relationnelle au modèle Hiérarchique Les requêtes Oracle XML DB Du modèle relationnelle au modèle Hiérarchique Sommaire Rappel des modèles Le modèle relationnel Le modèle hiérarchique Leurs différences Oracle XML DB Les types de XMLType Les

Plus en détail

SQL SERVER 2008 Le 20/10/2010

SQL SERVER 2008 Le 20/10/2010 Définitions SQL SERVER 2008 Le 20/10/2010 Une base de données est un objet particulièrement difficile à définir puisqu il est abordé en pratique selon différents points de vue : Pour un administrateur,

Plus en détail

Partie 0 : Gestion des tablespace et des utilisateurs... 3

Partie 0 : Gestion des tablespace et des utilisateurs... 3 Sommaire Partie 0 : Gestion des tablespace et des utilisateurs... 3 1- Créer deux TableSpaces votre_nom-tbs et Votre_nom-TempTBS :... 3 2. Créer un utilisateur qui porte votre nom :... 3 3. Attribuer à

Plus en détail

Bases de Données & Interfaces Web. stanislas.oger@univ-avignon.fr

Bases de Données & Interfaces Web. stanislas.oger@univ-avignon.fr Bases de Données & Interfaces Web stanislas.oger@univ-avignon.fr 1 Architecture d'un SI Web Fonctionnement Dynamique avec Base de Données 2 Idée Dynamiser les pages avec des infos venant de BDD Enregistrer

Plus en détail

La base de données dans ArtemiS SUITE

La base de données dans ArtemiS SUITE 08/14 Vous préférez passer votre temps à analyser vos données plutôt qu à chercher un fichier? La base de données d ArtemiS SUITE vous permet d administrer et d organiser confortablement vos données et

Plus en détail

VI. Domaines protéiques

VI. Domaines protéiques Chapitre 1 Structure des protéines I. Rappels Définitions II. La Protein Data Bank (PDB) III. Angles dièdres et diagramme de ramachandran IV. Structures secondaires V. Structures supersecondaires VI. Domaines

Plus en détail

ECR_DESCRIPTION CHAR(80), ECR_MONTANT NUMBER(10,2) NOT NULL, ECR_SENS CHAR(1) NOT NULL) ;

ECR_DESCRIPTION CHAR(80), ECR_MONTANT NUMBER(10,2) NOT NULL, ECR_SENS CHAR(1) NOT NULL) ; RÈGLES A SUIVRE POUR OPTIMISER LES REQUÊTES SQL Le but de ce rapport est d énumérer quelques règles pratiques à appliquer dans l élaboration des requêtes. Il permettra de comprendre pourquoi certaines

Plus en détail

Risk -- Database Access Protocol (RDAP)

Risk -- Database Access Protocol (RDAP) Risk -- Database Access Protocol (RDAP) 1 Généralités Le Risk -- Database Access Protocol (RDAP) permet à un client de se connecter à une base de données Sybase. RDAP est prévu pour être utilisé avec une

Plus en détail

1. Qu'est-ce que SQL?... 2. 2. La maintenance des bases de données... 2. 3. Les manipulations des bases de données... 5

1. Qu'est-ce que SQL?... 2. 2. La maintenance des bases de données... 2. 3. Les manipulations des bases de données... 5 1. Qu'est-ce que SQL?... 2 2. La maintenance des bases de données... 2 2.1 La commande CREATE TABLE... 3 2.2 La commande ALTER TABLE... 4 2.3 La commande CREATE INDEX... 4 3. Les manipulations des bases

Plus en détail

Les bases de données Page 1 / 8

Les bases de données Page 1 / 8 Les bases de données Page 1 / 8 Sommaire 1 Définitions... 1 2 Historique... 2 2.1 L'organisation en fichier... 2 2.2 L'apparition des SGBD... 2 2.3 Les SGBD relationnels... 3 2.4 Les bases de données objet...

Plus en détail

Jean-Michel Richer jean-michel.richer@univ-angers.fr http://www.info.univ-angers.fr/pub/richer. L3 Pro Informatique 2010-2011

Jean-Michel Richer jean-michel.richer@univ-angers.fr http://www.info.univ-angers.fr/pub/richer. L3 Pro Informatique 2010-2011 1 / 32 Développement Web - JDBC Jean-Michel Richer jean-michel.richer@univ-angers.fr http://www.info.univ-angers.fr/pub/richer L3 Pro Informatique 2010-2011 2 / 32 Plan Plan 1 Préambule 2 Utilisation de

Plus en détail

Cours Bases de données

Cours Bases de données Informations sur le cours Cours Bases de données 9 (10) séances de 3h Polycopié (Cours + TD/TP) 3 année (MISI) Antoine Cornuéjols www.lri.fr/~antoine antoine.cornuejols@agroparistech.fr Transparents Disponibles

Plus en détail

Construction d un EDD avec SQL 2008 R2. D. Ploix - M2 Miage - EDD - Création

Construction d un EDD avec SQL 2008 R2. D. Ploix - M2 Miage - EDD - Création Construction d un EDD avec SQL 2008 R2 Plan Analyse du DW construit Construction de la base DW dans SQL 2008 Construction des tables de faits et dimensions Injection des données Étapes de l injection des

Plus en détail

Pratique et administration des systèmes

Pratique et administration des systèmes Université Louis Pasteur Licence Informatique (L2) UFR de Mathématiques et Informatique Année 2007/2008 1 But du TP Pratique et administration des systèmes TP10 : Technologie LAMP Le but de ce TP est de

Plus en détail

TP Contraintes - Triggers

TP Contraintes - Triggers TP Contraintes - Triggers 1. Préambule Oracle est accessible sur le serveur Venus et vous êtes autorisés à accéder à une instance licence. Vous utiliserez l interface d accés SQL*Plus qui permet l exécution

Plus en détail

1 Création et manipulation d une base de données

1 Création et manipulation d une base de données Université Paris 13 TP Base de données Année 2013-2014 Institut Galilée SQL et ORACLE LI3 1 Création et manipulation d une base de données ans ce TP, nous allons créer la base de données de l exercice

Plus en détail

Partie II Cours 3 (suite) : Sécurité de bases de données

Partie II Cours 3 (suite) : Sécurité de bases de données Partie II Cours 3 (suite) : Sécurité de bases de données ESIL Université de la méditerranée Odile.Papini@esil.univ-mrs.fr http://odile.papini.perso.esil.univmed.fr/sources/ssi.html Plan du cours 1 Introduction

Plus en détail

SQL sous SqlServer OLIVIER D. DEHECQ Olivier http://www.entraide-info.fr 0

SQL sous SqlServer OLIVIER D. DEHECQ Olivier http://www.entraide-info.fr 0 2013 SQL sous SqlServer OLIVIER D. DEHECQ Olivier http://www.entraide-info.fr 0 Table des matières Signalétique... 2 1 Les bases du SQL... 3 2 SQL server... 6 2 Références des exercices...21 DEHECQ Olivier

Plus en détail

Base de données bibliographiques Pubmed-Medline

Base de données bibliographiques Pubmed-Medline Chapitre 1 ; Domaine 1 ; Documentation ; Champs référentiels 1.1.1, 1.1.2 et 1.1.3 Base de données bibliographiques Pubmed-Medline D r Patrick Deschamps,, 30 mai 2007 PLAN C2i métiers de la santé Introduction

Plus en détail

PRESENTATION. Document1 Serge GUERINET Page 1

PRESENTATION. Document1 Serge GUERINET Page 1 PRESENTATION Les domaines couverts par la série STG sont tous des pourvoyeurs ou exploitants des bases de données. Que l'on gère la relation aux clients, le suivi de l'activité financière, la comptabilité

Plus en détail

Bases de données et sites WEB Licence d informatique LI345

Bases de données et sites WEB Licence d informatique LI345 Bases de données et sites WEB Licence d informatique LI345 Anne Doucet Anne.Doucet@lip6.fr http://www-bd.lip6.fr/ens/li345-2013/index.php/lescours 1 Contenu Transactions en pratique Modèle relationnel-objet

Plus en détail

Comparaison de tables à distance

Comparaison de tables à distance Rapport de recherche A/375/CRI Fabien Coelho fabien@coelho.net composé avec LAT E X, révision 463 du document 1 Fabien Coelho job enseignant-chercheur à MINES ParisTech ingénieur civil 1993, docteur en

Plus en détail

Partie I du TD 1 au TD 5. Bases de données et MySQL -

Partie I du TD 1 au TD 5. Bases de données et MySQL - Système d information http://www.agroparistech.fr/systeme-d-information.html Partie I du TD 1 au TD 5 - Bases de données et MySQL - Liliana Ibănescu liliana.ibanescu@agroparistech.fr UFR d informatique

Plus en détail

Devoir Data WareHouse

Devoir Data WareHouse Université Paris XIII Institut Galilée Master 2-EID BENSI Ahmed CHARIFOU Evelyne Devoir Data WareHouse Optimisation, Transformation et Mise à jour utilisées par un ETL Mr R. NEFOUSSI Année 2007-2008 FICHE

Plus en détail

XML et Bases de données. XMLType Oracle XML DB

XML et Bases de données. XMLType Oracle XML DB Oracle XML DB Oracle XML DB Depuis la version 9i et de façon enrichie dans la version 10g, Oracle propose des outils pour gérer des documents XML Depuis la 10g il n'y a plus d'extraction car auparavant

Plus en détail

SQL. Requête la plus simple. Projection. Requête la plus simple. Différents modes d interrogation. Requêtes mécanismes d interrogation des données

SQL. Requête la plus simple. Projection. Requête la plus simple. Différents modes d interrogation. Requêtes mécanismes d interrogation des données Requêtes mécanismes d interrogation des données SQL! En entrée : une ou plusieurs tables! En sortie : une table réponse sandra.bringay@univ-montp3.fr roland.mahiques@univ-montp3.fr alexandre.pinlou@univ-montp3.fr

Plus en détail

Objectifs du TP : Initiation à Access

Objectifs du TP : Initiation à Access Objectifs du TP : Initiation à Access I. Introduction Microsoft Access fait partie de l ensemble Microsoft Office. C est un SGBDR (système de gestion de bases de données relationnelles) présentant une

Plus en détail

PHP & BD. PHP & Bases de données. Logiciels & matériels utilisés. Bases de données et Web

PHP & BD. PHP & Bases de données. Logiciels & matériels utilisés. Bases de données et Web PHP & Bases de données La quantité de données utilisée par certains sites web nécessite l'utilisation d'une base de données Il faut donc disposer d'un SGBD (mysql, postgresql, oracle, ) installé sur un

Plus en détail

A QUOI SERVENT LES BASES DE DONNÉES?

A QUOI SERVENT LES BASES DE DONNÉES? BASE DE DONNÉES OBJET Virginie Sans virginie.sans@irisa.fr A QUOI SERVENT LES BASES DE DONNÉES? Stockage des informations : sur un support informatique pendant une longue période de taille importante accès

Plus en détail

Auto-évaluation Oracle: cours de base

Auto-évaluation Oracle: cours de base Auto-évaluation Oracle: cours de base Document: F0475Test.fm 14/01/2008 ABIS Training & Consulting P.O. Box 220 B-3000 Leuven Belgium TRAINING & CONSULTING INTRODUCTION AUTO-ÉVALUATION ORACLE: COURS DE

Plus en détail

Cours Web n o 7 MySQL et PHP

Cours Web n o 7 MySQL et PHP Introduction aux bases de données Cours Web n o 7 MySQL et PHP Sandrine-Dominique Gouraud (gouraud@lri.fr) Pierre Senellart (pierre@senellart.com) Semaine du 7 novembre 2005 S.-D. Gouraud, P. Senellart

Plus en détail

Utilitaire d importation et d exportation de données pour NewWayService 4

Utilitaire d importation et d exportation de données pour NewWayService 4 Utilitaire d importation et d exportation de données pour NewWayService 4 Copyright 1996-2009 OroLogic Inc. http://www.orologic.com Révision 4.01 Table des matières I Table des matières Introduction à

Plus en détail

Encryptions, compression et partitionnement des données

Encryptions, compression et partitionnement des données Encryptions, compression et partitionnement des données Version 1.0 Grégory CASANOVA 2 Compression, encryption et partitionnement des données Sommaire 1 Introduction... 3 2 Encryption transparente des

Plus en détail

Plan Général Prévisionnel (1/2) (non contractuel) Internet et Outils L1/IO2 2006-2007 S2-IO2 Bases de données: Jointures, Transactions

Plan Général Prévisionnel (1/2) (non contractuel) Internet et Outils L1/IO2 2006-2007 S2-IO2 Bases de données: Jointures, Transactions Général Prévisionnel (1/2) (non contractuel) Internet et Outils L1/IO2 2006-2007 S2-IO2 Bases de données: Jointures, Cours Internet et Outils: [1/12] Intro, Internet, Web, XHTML (2H) [2/12] XHTML(2H) [3/12]

Plus en détail

Bases de données élémentaires Maude Manouvrier

Bases de données élémentaires Maude Manouvrier Licence MI2E- 1ère année Outils en Informatique Bases de données élémentaires Maude Manouvrier Définitions générales et positionnement du cours dans la formation Vocabulaire relatif aux bases de données

Plus en détail

Extraction d information des bases de séquences biologiques avec R

Extraction d information des bases de séquences biologiques avec R Extraction d information des bases de séquences biologiques avec R 21 novembre 2006 Résumé Le module seqinr fournit des fonctions pour extraire et manipuler des séquences d intérêt (nucléotidiques et protéiques)

Plus en détail

DROP TABLE Aeroport CASCADE CONSTRAINTS; CREATE TABLE Aeroport ( VARCHAR(60) NOT NULL, CONSTRAINT PK_aeroport primary key (codeaeroport) );

DROP TABLE Aeroport CASCADE CONSTRAINTS; CREATE TABLE Aeroport ( VARCHAR(60) NOT NULL, CONSTRAINT PK_aeroport primary key (codeaeroport) ); / Fichier: tp1-2.sql Nom: Martin Rancourt - Matricule: 14059412 Nom: Vincent Ribou - Matricule: 14042001 Description : Travail pratique #1 partie 2. Base de données qui permet de gérer les vols d une compagnie

Plus en détail

Généralités sur les bases de données

Généralités sur les bases de données Généralités sur les bases de données Qu est-ce donc qu une base de données? Que peut-on attendre d un système de gestion de bases de données? Que peut-on faire avec une base de données? 1 Des données?

Plus en détail

Modélisation PHP Orientée Objet pour les Projets Modèle MVC (Modèle Vue Contrôleur) Mini Framework

Modélisation PHP Orientée Objet pour les Projets Modèle MVC (Modèle Vue Contrôleur) Mini Framework Modélisation PHP Orientée Objet pour les Projets Modèle MVC (Modèle Vue Contrôleur) Mini Framework L'objectif de ce document est de poser des bases de réflexion sur la modélisation d'un projet réalisé

Plus en détail

1. Base de données SQLite

1. Base de données SQLite Dans ce TP, nous allons voir comment créer et utiliser une base de données SQL locale pour stocker les informations. La semaine prochaine, ça sera avec un WebService. On repart de l application AvosAvis

Plus en détail

Cours Bases de données 2ème année IUT

Cours Bases de données 2ème année IUT Cours Bases de données 2ème année IUT Cours 6 : JDBC : ou comment lier ORACLE avec Java 1ère partie Anne Vilnat http://www.limsi.fr/individu/anne/cours Plan 1 Introduction 2 les étapes de la connexion

Plus en détail

LINQ to SQL. Version 1.1

LINQ to SQL. Version 1.1 LINQ to SQL Version 1.1 2 Chapitre 03 - LINQ to SQL Sommaire 1 Introduction... 3 1.1 Rappels à propos de LINQ... 3 1.2 LINQ to SQL... 3 2 LINQ to SQL... 3 2.1 Importer des tables... 3 2.1.1 Le concepteur

Plus en détail