Analyse des données de séquençage massif par des méthodes phylogénétiques

Dimension: px
Commencer à balayer dès la page:

Download "Analyse des données de séquençage massif par des méthodes phylogénétiques"

Transcription

1 Analyse des données de séquençage massif par des méthodes phylogénétiques Roux S., Taib N., Mangot J.F., Hugoni M., Mary I., Ravet V., Bronner G., Enault F., Debroas D. Équipe Microbiologie de l'environnement et Bioinformatique Laboratoire Micro-organismes : Génome et Environnement UMR CNRS 6023 Université Blaise Pascal

2 Caractérisation des microbiomes Majorité des espèces ( > 99% bactéries ) non cultivées. Grande richesse : bactéries sur terre, formant plus de 10 9 espèces

3 Méthodes d'analyse des séquences Recherche de similarité (BLAST, Uclust, ) Classification bayésienne (RDP Classifier, Mothur,...) Approches phylogénétiques (STAP, RAIphy,...)

4 Approches phylogénétiques Caractérisation taxonomique de l'assemblage microbien Détection de nouveaux clades Analyse de liens évolutifs

5 Approches phylogénétiques Caractérisation taxonomique de l'assemblage microbien Détection de nouveaux clades Analyse de liens évolutifs Newton et al., 2007

6 Séquençage d'amplicons Marqueur phylogénétique : petite sous unité de l ARN ribosomique (18S/16S). Universalité Régions conservées / variables

7 Séquençage aléatoire : métagénomique Séquençage massif aléatoire du pool d'adn prélevé. Approche "naïve" Informations sur différents gènes / fonctions

8 Outils bioinformatiques PANAM : A Tool for the Phylogenetic Analysis and Taxonomic Affiliation of SSU rrna Amplicons. N. Taïb et al. (BMC Bioinformatics ; en révision) METAVIR : a web server dedicated to virome analysis. S. Roux et al. (Bioinformatics ; 2011 Nov 1 ; 27(21) : )

9 Prétraitement Détection des chimères Pangea (Giongo et al ; 2010) Qualité et taille PANAM : Étapes Tri Sample 1 Sample 2 Sample 3 Sample 4 Indices de diversité Clusterisation Uclust (Edgar, 2010) Sample 1 Sample 2 Sample 3 Sample 4 Annotation phylogénétique

10 PANAM : Étapes d'affiliation Annotation phylogénétique Base de Référence PANAM USEARCH (Edgar, 2010) Sample 1 Sample 2 Sample 3 Sample 4 Séquences requêtes + Taxonomie de la séquence voisine Alignements de référence Séquences requêtes triées selon groupes phylétiques

11 PANAM : Étapes d'affiliation Annotation phylogénétique Base de Référence PANAM Alignement avec le profil correspondant (HMMER, Eddy, 1998) Alignements de référence Reconstruction Phylogénétique (FastTree, Price et al., 2010) Séquences requêtes triées selon groupes phylétiques Annotation taxonomique Clades environnementaux

12 PANAM : Restitution taxonomique Restitution taxonomique : capacité du logiciel d'affiliation à déterminer la taxonomie correcte d'une séquence connue. 100% 90% 80% 70% PANAM BLAST STAP RDP 60% 50% Kingdom Phylum Class Order Family Genus Simulations sur séquences complètes (eucaryotes) Restitution : > 90 % au niveau genre Détection de clades environnementaux (Lepère et al., 2008)

13 PANAM : Restitution taxonomique Simulations sur run de pyroséquençage (400 pb) Eucaryotes 18S Bactéries 16S 100% 100% 90% 90% 80% 70% PANAM STAP RDP 80% 70% PANAM STAP RDP 60% 60% 50% Kingdom Phylum Class Order Family Genus 50% Kingdom phylum Class order Family Genus Restitution : > 75 % au niveau genre pour le 18S > 90 % au niveau genre pour le 16S

14 PANAM : performances Hours bp 200 bp 400 bp 800 bp Sequences Simulations sur un CPU 2 GHz Xeon et 24 GB RAM

15 PANAM : performances Dynamique à court terme des petits eucaryotes lacustres 160 Hours prélèvements séquences brutes séquences nettoyées bp 200 bp 400 bp 800 bp 1017 OTUs Sequences Simulations sur un CPU 2 GHz Xeon et 24 GB RAM Temps de traitement total : 30 minutes Variations à court terme de la diversité du picoplancton eucaryote lacustre : approche par séquençage massif I. Domaizon Poster 12

16 PANAM : Perspectives Web service intégré, dédié à l'étude de la diversité des microorganismes. Calcul distribué (cluster local / grille de calcul).

17 PANAM : Perspectives Web service intégré, dédié à l'étude de la diversité des microorganismes. Calcul distribué (cluster local / grille de calcul). Epanam. N. Taib Poster 45

18 Suivi de communautés microbiennes Suivi de communautés bactériennes en réponse à un stress Impact du tébuconazole sur les communautés bactériennes : Suivi sur 21 jours en triplicat. ~ 3000 séquences par échantillon Projet SENDEFO Évaluation de l impact du tébuconazole (fongicide) sur les communautés bactériennes de lacs et de rivières par une approche de pyroséquençage de l ARNr 16S. N. Pascault Poster 38

19 Suivi de communautés microbiennes Suivi de communautés bactériennes en réponse à un stress Impact du tébuconazole sur les communautés bactériennes : Suivi sur 21 jours en triplicat. ~ 3000 séquences par échantillon Projet SENDEFO Suivi de communautés spécifiques et comparaison d'échantillons Étude des Archaea en milieu marin ADN & ARN : Diversité / Activité des Archaea 80 échantillons Observation de clades spécifiques Évolution au cours du temps (série temporelle sur 3 ans 1/2) Projet DIVAQUA Diversité spécifique et fonctionnelle des communautés archéennes oxydant l ammonium dans les écosystèmes aquatiques. M. Hugoni Poster 20

20 Suivi de communautés microbiennes Suivi de communautés bactériennes en réponse à un stress Impact du tébuconazole sur les communautés bactériennes : Suivi sur 21 jours en triplicat. ~ 3000 séquences par échantillon Projet SENDEFO Suivi de communautés spécifiques et comparaison d'échantillons Étude des Archaea en milieu marin ADN & ARN : Diversité / Activité des Archaea 80 échantillons Observation de clades spécifiques Évolution au cours du temps (série temporelle sur 3 ans 1/2) Projet DIVAQUA Suivi globale des communautés microbiennes lacustres Diversité lacustre eucaryote et procaryote : Lac Pavin / Bourget Observatoire de l'environnement Suivi sur une année, en parallèle : 16S Bactéries / 16S Archées / 18S SOERE GLACPE

21 Outils bioinformatiques PANAM : A Tool for the Phylogenetic Analysis and Taxonomic Affiliation of SSU rrna Amplicons. Najwa Taïb et al. METAVIR : a web server dedicated to virome analysis. Simon Roux et al. Bioinformatics (Nov 2011)

22 Base de données de 80 viromes publiés METAVIR

23 METAVIR : Arbres phylogénétiques à partir de différents marqueurs

24 METAVIR : Arbres phylogénétiques à partir de différents marqueurs Cap3 (Huang, 1999) contig_1 read_9 contig_2

25 METAVIR : Arbres phylogénétiques à partir de différents marqueurs Cap3 (Huang, 1999) contig_1 read_9 contig_2 Hmmer (Eddy,1998) >Chlamydia_phage_1 >Chlamydia_phage_2 >Bdellovibrio_phage >Spiroplasma_virus >contig_1 VVQST-DSVQGNLSAYALST--DTKHLFTKSFV-EHGFVIGLLSAT IPQST-DSTQGNLAAYGTAI--GSKRVFTKSFT-EHGVILGLASVR VPQSS-TTDQGNLAAFSTASEFGNKIGFSKSFV-EHGYVLGFIRAR VPQSTVEKMQGNLAAFSETM-IQNNYLVNKTFT-EHSYIIVLAVVR QST--SVQGNLSAYATST-FDT >contig_2 >read_9 DGST----QGSLGQFSGRVAATYKH TKSFT-EHGVILGLASV

26 METAVIR : Arbres phylogénétiques à partir de différents marqueurs Cap3 (Huang, 1999) contig_1 read_9 contig_2 Hmmer (Eddy,1998) Gblocks (Talavera & Castresana,2007) PhyML (Guindon & Gascuel, 2003) >Chlamydia_phage_1 >Chlamydia_phage_2 >Bdellovibrio_phage >Spiroplasma_virus >contig_1 >contig_2 >read_9 Chlamydia_phage_1 Chlamydia_phage_2 contig_1 Bdellovibrio_phage Spiroplasma_virus contig_2 Entero_phage_ID22 Entero_phage_NC28 VVQST-DSVQGNLSAYALST--DTKHLFTKSFV-EHGFVIGLLSAT IPQST-DSTQGNLAAYGTAI--GSKRVFTKSFT-EHGVILGLASVR VPQSS-TTDQGNLAAFSTASEFGNKIGFSKSFV-EHGYVLGFIRAR VPQSTVEKMQGNLAAFSETM-IQNNYLVNKTFT-EHSYIIVLAVVR QST--SVQGNLSAYATST-FDT DGST----QGSLGQFSGRVAATYKH TKSFT-EHGVILGLASV Chlamydia_phage_1 Chlamydia_phage_2 read_9 Bdellovibrio_phage Spiroplasma_virus Entero_phage_ID22 Entero_phage_NC28

27 METAVIR : composition taxonomique GAAS (Angly et al., 2009) Krona (Ondov et al., 2011) Lac du Bourget : Composition taxonomique de la fraction virale

28 METAVIR : Diversité des Microviridae Lac Bourget / Lac Pavin / Lac Limnopolar

29 Caractérisation des communautés virales Diversité des communautés virales lacustres Viromes des lacs Pavin et Bourget projet Metavir

30 Caractérisation des communautés virales Diversité des communautés virales lacustres Viromes des lacs Pavin et Bourget projet Metavir Diversité des virus d'archaea 6 viromes le long d'un gradient de salinité projet Archevir

31 Caractérisation des communautés virales Diversité des communautés virales lacustres Viromes des lacs Pavin et Bourget projet Metavir Diversité des virus d'archaea 6 viromes le long d'un gradient de salinité projet Archevir Comparaison des communautés virales de milieux extrêmes Virome(s) de la zone anoxique du lac Pavin projet DICENTIM

32 Gisèle Bronner Jean-Christophe Charvy Didier Debroas Emilie Duffaud François Enault Mylène Hugoni Isabelle Jouan Jean-François Mangot Corinne Petit-Biderre Isabelle Mary Bushra Parveen Vivane Ravet Simon Roux Najwa Taïb Agnès Vellet

33 Vincent Breton Tung Doan Engelbert Mephu Nguifo Gisèle Bronner Jean-Christophe Charvy Didier Debroas Emilie Duffaud François Enault Mylène Hugoni Isabelle Jouan Jean-François Mangot Corinne Petit-Biderre Isabelle Mary Bushra Parveen Vivane Ravet Simon Roux Najwa Taïb Agnès Vellet Hélène Agogué Agnès Bouchez Isabelle Domaizon Noémie Pascault Jean-François Humbert Julie Leloup Jonathan Colombet Agnès Robin Télèsphore Sime-Ngando Pierre Galand Ian Saulter Joan Artigas Stéphane Pesce Yvan Bettarel

ALLOCATION POST-DOCTORALE 18 mois

ALLOCATION POST-DOCTORALE 18 mois ALLOCATION POST-DOCTORALE 18 mois LIMOS LMGE (CNRS, Université Blaise Pascal) Clermont-Ferrand Étude de la biosphère rare microbienne par une approche in silico : nouvelle méthode de classification ensembliste

Plus en détail

Analyse de la diversité microbienne par séquençage massif : Méthodes et Applications

Analyse de la diversité microbienne par séquençage massif : Méthodes et Applications Najwa TAIB Analyse de la diversité microbienne par séquençage massif : Méthodes et Applications Au delà de son importance dans le fonctionnement et la régulation des écosystèmes ou du maintien de l'équilibre

Plus en détail

Master Mention Biologie et Environnement Spécialité Recherche et Professionnelle FREMAC

Master Mention Biologie et Environnement Spécialité Recherche et Professionnelle FREMAC UFR SCIENCES ET TECHNOLOGIES 24 avenue des Landais BP 80026 63171 AUBIERE Cedex Tél. 04.73.40.70.13 Fax. 04.73.40.70.12 Courriel : ScolaMaster.sciences@univ bpclermont.fr Master Mention Biologie et Environnement

Plus en détail

Utilisation de la métagénomique 16S pour la surveillance de l émergence de zoonoses bactériennes dans les populations animales

Utilisation de la métagénomique 16S pour la surveillance de l émergence de zoonoses bactériennes dans les populations animales Utilisation de la métagénomique 16S pour la surveillance de l émergence de zoonoses bactériennes dans les populations animales Réunion Rongeur 2014 CBGP Maxime Galan Métagénomique 16S: Pourquoi? Identification

Plus en détail

Journées Industrielles de la Méthanisation

Journées Industrielles de la Méthanisation Journées Industrielles de la Méthanisation Gérer les ressources microbiennes : Exemples d applications aux procédés de méthanisation Marina Moletta-Denat, Jérôme Hamelin, Kim Milferstedt et Eric Trably

Plus en détail

Najwa Taïb. Analyse de la diversité microbienne par séquençage massif : méthodes et applications.

Najwa Taïb. Analyse de la diversité microbienne par séquençage massif : méthodes et applications. Analyse de la diversité microbienne par séquençage massif : méthodes et applications Najwa Taïb To cite this version: Najwa Taïb. Analyse de la diversité microbienne par séquençage massif : méthodes et

Plus en détail

Techniques et matériels pour la production des données brutes de séquençage métagénomique

Techniques et matériels pour la production des données brutes de séquençage métagénomique 1 Techniques et matériels pour la production des données brutes de séquençage métagénomique Benoît Remenant, Stéphane Chaillou Introduction Au cours des dix dernières années, la métagénomique a permis

Plus en détail

Étude de la biodiversité fongique à l aide de techniques de pyroséquençage

Étude de la biodiversité fongique à l aide de techniques de pyroséquençage Étude de la biodiversité fongique à l aide de techniques de pyroséquençage Biodiversité fongique Biodiversité: diversité spécifique d une communauté écologique, correspondant au nombre d espèces et à leur

Plus en détail

Microbiologie BIOL 3253. L évolution, la taxinomie et la diversité microbienne

Microbiologie BIOL 3253. L évolution, la taxinomie et la diversité microbienne Microbiologie BIOL 3253 L évolution, la taxinomie et la diversité microbienne Introduction générale et vue d ensemble Taxinomie Science de la classification biologique. Constituée de 3 parties séparées

Plus en détail

Qualité des séquences produites par 454 : exemple de traitement

Qualité des séquences produites par 454 : exemple de traitement Qualité des séquences produites par 454 : exemple de traitement Eric PEYRETAILLADE Equipe d accueil CIDAM Faculté de Pharmacie, Université d Auvergne 1 La Technologie 454 (Roche) Etape 1 : Préparation

Plus en détail

Barcoding environnemental par séquençage haut débit

Barcoding environnemental par séquençage haut débit Barcoding environnemental par séquençage haut débit Potentiel et limites Jean-François Martin Échantillonnage Spécificités du barcoding environnemental Amplification (PCR) de marqueurs choisis Séquençage

Plus en détail

Cumulo Numbio 2015. La révolution next-generation sequencing et les enjeux de l'expansion de la bioinformatique pour les biologistes.

Cumulo Numbio 2015. La révolution next-generation sequencing et les enjeux de l'expansion de la bioinformatique pour les biologistes. Cumulo Numbio 2015 La révolution next-generation sequencing et les enjeux de l'expansion de la bioinformatique pour les biologistes. Human genome sequence June 26th 2000: official announcement of the completion

Plus en détail

PLAN DE FORMATION 2015

PLAN DE FORMATION 2015 PLAN DE FORMATION 2015 LMGE Laboratoire Microorganismes : Génome et Environnement UMR 6023 Télesphore Sime-Ngando Tél 04 73 40 78 36 (Directeur de l Unité) Fax 04 73 40 76 70 mail : telesphore.sime-ngando@univ-bpclermont.fr

Plus en détail

Big data et sciences du Vivant L'exemple du séquençage haut débit

Big data et sciences du Vivant L'exemple du séquençage haut débit Big data et sciences du Vivant L'exemple du séquençage haut débit C. Gaspin, C. Hoede, C. Klopp, D. Laborie, J. Mariette, C. Noirot, MS. Trotard bioinfo@genopole.toulouse.inra.fr INRA - MIAT - Plate-forme

Plus en détail

génomes Présentation La biologie à l'heure du séquençage des génomes Séquençage de génomes: Pourquoi? Comment? Annotation des génomes

génomes Présentation La biologie à l'heure du séquençage des génomes Séquençage de génomes: Pourquoi? Comment? Annotation des génomes Présentation Bioinformatique: analyse des génomes Céline Brochier-Armanet (Laurent Duret) Université Claude Bernard, Lyon 1 Laboratoire de Biométrie et Biologie évolutive (UMR 5558) Celine.brochier-armanet@univ-lyon1.fr

Plus en détail

L Équipe de Microbiologie Aquatique

L Équipe de Microbiologie Aquatique L Équipe de Microbiologie Aquatique Unité Mixte de Recherche INRA Université de Savoie Centre Alpin de Recherche sur les Réseaux Trophiques des Écosystèmes Limniques Les effectifs au 9 novembre 2005 Chercheurs

Plus en détail

MUSEUM NAT. D'HISTOIRE NATURELLE PARIS Référence GALAXIE : 4113

MUSEUM NAT. D'HISTOIRE NATURELLE PARIS Référence GALAXIE : 4113 MUSEUM NAT. D'HISTOIRE NATURELLE PARIS Référence GALAXIE : 4113 Numéro dans le SI local : Référence GESUP : 4113 Corps : Maître de conférences du Muséum national d'histoire naturelle Article : 32ou40 Chaire

Plus en détail

Intégration des approches métagénomiques dans l'étude de la diversité des coléoptères saproxyliques : progrès et perspectives

Intégration des approches métagénomiques dans l'étude de la diversité des coléoptères saproxyliques : progrès et perspectives Intégration des approches métagénomiques dans l'étude de la diversité des coléoptères saproxyliques : progrès et perspectives Rodolphe Rougerie (1), Christophe Bouget (2) & Carlos Lopez-Vaamonde (1) (1)

Plus en détail

Master research Internship. Rapport bibliographique. Comparaison massive et multiple de métagénomes non assemblés

Master research Internship. Rapport bibliographique. Comparaison massive et multiple de métagénomes non assemblés Master research Internship Rapport bibliographique Comparaison massive et multiple de métagénomes non assemblés Auteur : Guillaume Holley Encadrant : Pierre Peterlongo GenScale Résumé La nature est d une

Plus en détail

Laurie Casalot. Bacteria Archaea

Laurie Casalot. Bacteria Archaea Analyses des populations bactériennes à l aide des techniques moléculaires Bacteria Archaea Laurie Casalot Institut Méditerranéen d Océanologie (MIO) Laboratoire de Microbiologie Environnementale et Biotechnologie

Plus en détail

1ère journée des doctorants du LMGE. Résumés des différentes présentations

1ère journée des doctorants du LMGE. Résumés des différentes présentations 1ère journée des doctorants du LMGE Résumés des différentes présentations 10h45. Philippe Poirier (3 ème année): Blastocystis spp.: épidémiologie et lien potentiel avec le syndrome de l'intestin irritable

Plus en détail

Détection de mutations somatiques par NGS sur GAIIx

Détection de mutations somatiques par NGS sur GAIIx Détection de mutations somatiques par NGS sur GAIIx Aude Lamy Laboratoire de Génétique Somatique des Tumeurs CHU de Rouen Inserm U1079 Faculté de Médecine et Pharmacie de Rouen La médecine personalisée

Plus en détail

Etude de l'impact d'un biais carboné sur la diversité des bactéries : Pyroséquençage et méthodes d'analyse

Etude de l'impact d'un biais carboné sur la diversité des bactéries : Pyroséquençage et méthodes d'analyse 22 27 avril 2012 Etude de l'impact d'un biais carboné sur la diversité des bactéries : Pyroséquençage et méthodes d'analyse Samuel Mondy, ISV, CNRS, Gif sur Yvette, UPR2355 Equipe Ecologie de la Rhizosphère

Plus en détail

Génomique et GPU. Jean Michel Batto jean-michel.batto@jouy.inra.fr

Génomique et GPU. Jean Michel Batto jean-michel.batto@jouy.inra.fr Génomique et GPU Jean Michel Batto jean-michel.batto@jouy.inra.fr INRA, Laboratoire de Génétique Microbienne Centre de Recherche de Jouy en Josas (78) Forum TER@TEC, Ecole Supélec (91), 1 er Juillet 2009

Plus en détail

La génomique. Etude des génomes et de l ensemble de leurs gènes. Nécessite des outils bioinformatiques. Plusieurs étapes :

La génomique. Etude des génomes et de l ensemble de leurs gènes. Nécessite des outils bioinformatiques. Plusieurs étapes : La génomique Etude des génomes et de l ensemble de leurs gènes La structure Le fonctionnement L évolution Le polymorphisme, Plusieurs étapes : Nécessite des outils bioinformatiques 1 Chronologie sur le

Plus en détail

Modalités d exécution des prestations NGS réalisées via l UMR 8199-2013

Modalités d exécution des prestations NGS réalisées via l UMR 8199-2013 Modalités d exécution des prestations NGS réalisées via l UMR 8199-2013 I. Préparation des librairies en vue du séquençage Haut débit via HiSeq et MiSeq 1.1 Points communs à toutes préparations de librairies

Plus en détail

RNAseq et NGS. Adriana Alberti Karine Labadie

RNAseq et NGS. Adriana Alberti Karine Labadie RNAseq et NGS Séquençage et Diversité LES ORGANISMES EUCARYOTES animaux plantes champignons protistes BACTERIES ARCHEES VIRUS METAGENOMES LES SOURCES ADN GENOMIQUE ARN / cdna AMPLICONS BACs ET FOSMIDES

Plus en détail

ECUE 2 (L 1 -S 2 ) : Microbiologie générale Microbiologie générale

ECUE 2 (L 1 -S 2 ) : Microbiologie générale Microbiologie générale Unité d enseignement UE 8 : Biologie Moléculaire - Microbiologie ECUE 2 (L 1 -S 2 ) : Microbiologie générale Microbiologie générale 1h30 de cours et 1h15 de Travaux pratiques Un examen écrit ; un examen

Plus en détail

Travaux Pratiques de Métagénomique

Travaux Pratiques de Métagénomique Travaux Pratiques de Métagénomique Comparaison des métagénomes intestinaux de patients en rémission d infection chroniques de l intestin et d individus sains 1 Introduction Bérénice Batut berenice.batut@udamail.fr

Plus en détail

Etude transcriptomique de la dégradation des parois lignocellulosiques de son et paille de blé durant la croissance de Thermobacillus xylanilyticus

Etude transcriptomique de la dégradation des parois lignocellulosiques de son et paille de blé durant la croissance de Thermobacillus xylanilyticus Journées SFR condorcet Compiègne 8-9 juillet 2015 Projet Hydroseq : UMR FARE-CRRBM Etude transcriptomique de la dégradation des parois lignocellulosiques de son et paille de blé durant la croissance de

Plus en détail

Fouad Boumezbeur. doctorant en bioinformatique. fouad.boumezbeur@jouy.inra.fr

Fouad Boumezbeur. doctorant en bioinformatique. fouad.boumezbeur@jouy.inra.fr Séminaire Aristote OpenGPU : 1 an après Mercredi 8 juin 2011 Applications du GPU à l investigation métagénomique : illustration avec le projet européen MetaHIT Fouad Boumezbeur doctorant en bioinformatique

Plus en détail

Titre: Domaine scientifique : Mots clés : Directeurs de thèse : Institution des directeurs de thèse : Adresse email des directeurs de thèse :

Titre: Domaine scientifique : Mots clés : Directeurs de thèse : Institution des directeurs de thèse : Adresse email des directeurs de thèse : Titre: Détermination de l ensemble des ARNs non codants chez Ostreococcus, un modèle d algue unicellulaire marine infectée par des virus à ADN double brin Domaine scientifique : Génomique Mots clés : ARN

Plus en détail

DIAGNOSTIC PRÉNATAL NON INVASIF : LE SANG MATERNEL

DIAGNOSTIC PRÉNATAL NON INVASIF : LE SANG MATERNEL 6 LE TEST DIAGNOSTIC PRÉNATAL NON INVASIF : LE SANG MATERNEL Source : les cellules trophoblastiques Fetal cell Cell isolation Détection 5-6SA Disparition rapide après accouchement Pas de persistance après

Plus en détail

La santé des sols: Présentation LEM du 30 avril et du 1er mai 2014

La santé des sols: Présentation LEM du 30 avril et du 1er mai 2014 La santé des sols: Opportunités et applications des nouvelles technologies de biologie moléculaire et de séquençage Laboratoire d écologie microbienne (IRDA) Présentation LEM du 30 avril et du 1er mai

Plus en détail

Le séquençage à haut débit Mars 2011

Le séquençage à haut débit Mars 2011 Atelier Epigénétique Université Pierre et Marie Curie Le séquençage à haut débit Mars 2011 Stéphane Le Crom (lecrom@biologie.ens.fr) Institut de Biologie de l École normale supérieure (IBENS) de la Montagne

Plus en détail

Obtention de données génétiques à grande échelle

Obtention de données génétiques à grande échelle Obtention de données génétiques à grande échelle Stéphanie FERREIRA Ph.D. Campus de l Institut Pasteur de Lille 1, rue du Professeur Calmette 59000 LILLE Tel : 03 20 87 71 53 Fax : 03 20 87 72 64 contact@genoscreen.fr

Plus en détail

Single Molecule Real Time (SMRT) Sequencing : PacBio RS II

Single Molecule Real Time (SMRT) Sequencing : PacBio RS II Single Molecule Real Time (SMRT) Sequencing : PacBio RS II Input sample Genome DNA, Amplicons, cdna Input sample amounts according to the protocols (10ng-10µg) High Input sample quality (integrity and

Plus en détail

Plate-forme Bio-informatique. Laboratoire de Bio-informatique et de Génomique intégratives. Utilisateurs (public, privé )

Plate-forme Bio-informatique. Laboratoire de Bio-informatique et de Génomique intégratives. Utilisateurs (public, privé ) Plate-forme Bio-informatique Valorisation et soutien Laboratoire de Bio-informatique et de Génomique intégratives Recherche et développement collaboration Utilisateurs (public, privé ) Proposer des solutions

Plus en détail

Simulation multi GPU d un logiciel de métagénomique. Dany Tello, Mathieu Almeida

Simulation multi GPU d un logiciel de métagénomique. Dany Tello, Mathieu Almeida Simulation multi GPU d un logiciel de métagénomique appliqué à la flore intestinale humaine Dany Tello, Mathieu Almeida Le microbiote intestinal humain : un organe négligé 100 trillions de micro organismes;

Plus en détail

Place et avenir du séquençage haut-débit

Place et avenir du séquençage haut-débit Place et avenir du séquençage haut-débit Olivier Bouchez genomique@toulouse.inra.fr La Plateforme GeT Expertise et mise à disposition d une plateforme technologique en génomique : Séquençage Génotypage

Plus en détail

Comparaison et alignement de séquences 2

Comparaison et alignement de séquences 2 Comparaison et alignement de séquences 2 LV348 -BI Sophie Pasek sophie.pasek@upmc.fr Comment comparer une séquence contre une banque? Comparaison séquence/banque Pourquoi? : Réunir un échantillon taxonomique

Plus en détail

Compte-rendu réunion WP 2.7.2 Mardi 30/06/2015 de 10h à 16h30

Compte-rendu réunion WP 2.7.2 Mardi 30/06/2015 de 10h à 16h30 Compte-rendu réunion WP 2.7.2 Mardi 30/06/2015 de 10h à 16h30 Organisateurs/Coordinateurs: Guy Perrière et Claudine Médigue Participants (22) GENOSCOPE : Sébastien Faye, Quentin Cadarec, Eric Pelletier

Plus en détail

Corrigé Contrôle terminal : Bioanalyse (EL6BIOFM) 6 mai 2014

Corrigé Contrôle terminal : Bioanalyse (EL6BIOFM) 6 mai 2014 Corrigé Contrôle terminal : Bioanalyse (EL6BIOFM) 6 mai 2014 Exercice 1 (4,5 points) 1. Donner la définition de l acronyme BLAST. (0,5 pt) : Basic Local Alignment Search Tool 2. Expliquer les principes

Plus en détail

De GenoSol à GenoBiome, mise en place d une structure analytique pour évaluer l état biologique du sol

De GenoSol à GenoBiome, mise en place d une structure analytique pour évaluer l état biologique du sol De GenoSol à GenoBiome, mise en place d une structure analytique pour évaluer l état biologique du sol Lionel RANJARD, Samuel Dequiedt, Pierre-Alain Maron, Anne-Laure Blieux. UMR Agroécologie-plateforme

Plus en détail

BIN 1002: INTÉGRATION BIOSCIENCES/INFORMATIQUE

BIN 1002: INTÉGRATION BIOSCIENCES/INFORMATIQUE BIN 1002: INTÉGRATION BIOSCIENCES/INFORMATIQUE Plan de Cours Automne 2015 Professeurs: Sylvie Hamel, Département d Informatique et de Recherche Opérationnelle Guillaume Lettre, Institut de Cardiologie

Plus en détail

Le monde Microbien : Partie 5 : Les microbes et le cosmos : de nouvelles frontières...

Le monde Microbien : Partie 5 : Les microbes et le cosmos : de nouvelles frontières... UE Pharmacie - Microbiologie Le monde Microbien : Partie 5 : Les microbes et le cosmos : de nouvelles frontières... Professeur Emmanuel DROUET Année universitaire 2011/2012 Université Joseph Fourier de

Plus en détail

Introduction à l analyse statistique et bioinformatique des puces à ADN

Introduction à l analyse statistique et bioinformatique des puces à ADN Formation INSERM 10 février 2004 Introduction à l analyse statistique et bioinformatique des puces à ADN Gaëlle Lelandais lelandais@biologie.ens.fr 1 Première Partie Analyse d une puce à ADN : Le recherche

Plus en détail

Deux plateformes IBiSA et 3 plateaux techniques regroupés depuis 2010. Responsable scientifique Denis Milan. Coordination des nouveaux investissements

Deux plateformes IBiSA et 3 plateaux techniques regroupés depuis 2010. Responsable scientifique Denis Milan. Coordination des nouveaux investissements RNA-seq Olivier Bouchez Nathalie Marsaud Mercredi 28 mars 2012 Plateforme GeT : Génome et Transcriptome Deux plateformes IBiSA et 3 plateaux techniques regroupés depuis 2010 Responsable scientifique Denis

Plus en détail

Sommaire. A) Méthode de contrôle manuel des résultats produits par GLADX

Sommaire. A) Méthode de contrôle manuel des résultats produits par GLADX Sommaire Définitions et abréviations Résumé Introduction I. Matériel II. Méthode A) Méthode de contrôle manuel des résultats produits par GLADX B) Comparaison des résultats de l outil GLADX avec les résultats

Plus en détail

1. L ADN et l information génétique. l ADN l information génétique est contenue dans l ADN. traduction. comment fait-on une protéine?

1. L ADN et l information génétique. l ADN l information génétique est contenue dans l ADN. traduction. comment fait-on une protéine? 1. L ADN et l information génétique l ADN l information génétique est contenue dans l ADN (ADN) (ARN) 1 2 A G T C U comment fait-on une protéine? traduction l information génétique est organisée par triplets

Plus en détail

PERCIMAP. Oreochromis niloticus. Construction d une carte RH à haute densité du génome de Tilapia CNRS UMR 6061

PERCIMAP. Oreochromis niloticus. Construction d une carte RH à haute densité du génome de Tilapia CNRS UMR 6061 PERCIMAP Construction d une carte RH à haute densité du génome de Tilapia Oreochromis niloticus CIRAD UPR20 Aquaculture et gestion des ressources aquatiques, Montpellier H. D Cotta E. Pepey J.F. Baroiller

Plus en détail

La CRENO Bretagne La CRENO Bretagne : qui?

La CRENO Bretagne La CRENO Bretagne : qui? La CRENO Bretagne La CRENO Bretagne : qui? Responsable d UF Geneviève HERY-ARNAUD (MCU-PH) 1 Qui? 2 Où? 3 Pourquoi? 4 Comment? 5 Combien? 6 Quoi? Coordination médicale Nicolas ROUZIC (PH) Coordination

Plus en détail

Role du microbiota pulmonaire dans la mucoviscidose

Role du microbiota pulmonaire dans la mucoviscidose 29. März 2014 Role du microbiota pulmonaire dans la mucoviscidose Gaudenz Hafen, MD & MER1 Médecin assoicé Résponsable de l unité pneumologie et mucoviscidose pédiatrique Table des matières 1. Introduction

Plus en détail

Diversité et structure des communautés de champignons mycorhiziens le long de gradients altitudinaux en Europe.

Diversité et structure des communautés de champignons mycorhiziens le long de gradients altitudinaux en Europe. Colloque de Génomique Environnementale Session 7: Métagénomique et diversité des écosystèmes microbiens Diversité et structure des communautés de champignons mycorhiziens le long de gradients altitudinaux

Plus en détail

Le séquençage à haut débit Juin 2012

Le séquençage à haut débit Juin 2012 Atelier Epigénétique Université Pierre et Marie Curie Le séquençage à haut débit Juin 2012 Stéphane Le Crom (stephane.le_crom@upmc.fr) Laboratoire de Biologie du Développement (UPMC) de la Montagne Sainte

Plus en détail

Mise en place du NGS en routine diagnostic - Validation, Organisation, Développements

Mise en place du NGS en routine diagnostic - Validation, Organisation, Développements Mise en place du NGS en routine diagnostic - Validation, Organisation, Développements Atelier sur le Diagnostic Moléculaire de la Mucoviscidose 2014 - Lille Stratégie analytique Préparation library (1,5

Plus en détail

Ray : un logiciel parallèle performant pour le séquençage

Ray : un logiciel parallèle performant pour le séquençage Ray : un logiciel parallèle performant pour le séquençage Sébastien Boisvert, Université Laval @sebhtml http://boisvert.info 2014-01-31 10h30-10h50 amphithéâtre (1035) du pavillon JA Bombardier, Université

Plus en détail

Séquençage haut débit (Next Generation Sequencing) 12/03/2012 Pascal Le Bourgeois, M1BBT, EM8BTGM 1

Séquençage haut débit (Next Generation Sequencing) 12/03/2012 Pascal Le Bourgeois, M1BBT, EM8BTGM 1 Séquençage haut débit (Next Generation Sequencing) 1 Pyroséquençage (454) Margulies M. et al. (2005). Genome sequencing in microfabricated high-density picolitre reactors. Nature 437:376-80 Pas de banques

Plus en détail

Le séquençage haut-débit

Le séquençage haut-débit Nouveaux outils en biologie Le séquençage haut-débit DES d hématologie 16 janvier 2015 Paris Alice Marceau-Renaut Laboratoire d hématologie CHRU Lille NGS = Next-Generation Sequencing Whole-genome Whole-exome

Plus en détail

Institut Français de Bioinformatique (IFB) : mettre en place une infrastructure informatique dédiée aux sciences de la vie

Institut Français de Bioinformatique (IFB) : mettre en place une infrastructure informatique dédiée aux sciences de la vie 1 / 1 Institut Français de Bioinformatique (IFB) : mettre en place une infrastructure informatique dédiée aux sciences de la vie J-F. Gibrat Unité Mathématique, Informatique et Génome, INRA, Jouy-en-Josas

Plus en détail

Jean-Yves RICHARD (Direction Technique)

Jean-Yves RICHARD (Direction Technique) Evaluation de la faisabilité et développement du traitement biologique anaérobie des nappes phréatiques polluées par les éthylènes chlorés Projet EVASOL (ANR PRECODD) Jean-Yves RICHARD (Direction Technique)

Plus en détail

Les besoins de la communauté des sciences de la vie en termes d infrastructure informatique

Les besoins de la communauté des sciences de la vie en termes d infrastructure informatique 1 / 31 Les besoins de la communauté des sciences de la vie en termes d infrastructure informatique J-F. Gibrat Unité Mathématique, Informatique et Génome, INRA, Jouy-en-Josas Séminaire IDRIS, Orsay, 14

Plus en détail

Comparaison et alignement. de séquences 2 LV348 -BI. sophie.pasek@upmc.fr. Sophie Pasek

Comparaison et alignement. de séquences 2 LV348 -BI. sophie.pasek@upmc.fr. Sophie Pasek Comparaison et alignement de séquences 2 LV348 -BI Sophie Pasek sophie.pasek@upmc.fr Comment comparer une séquence contre une banque? Comparaison séquence/banque Pourquoi? : Réunir un échantillon taxonomique

Plus en détail

Biologie cellulaire. Perfectionnement à la culture cellulaire. Programme. ParTIe PraTIQUe. ParTIe THÉorIQUe. durée : 4 jours

Biologie cellulaire. Perfectionnement à la culture cellulaire. Programme. ParTIe PraTIQUe. ParTIe THÉorIQUe. durée : 4 jours Biologie cellulaire Perfectionnement à la culture cellulaire durée : 4 jours ingénieurs, chercheurs et chefs de projet connaissances de base en culture cellulaire ou validation du module «initiation à

Plus en détail

MASTER (LMD) PARCOURS MICROORGANISMES, HÔTES, ENVIRONNEMENTS (MHE)

MASTER (LMD) PARCOURS MICROORGANISMES, HÔTES, ENVIRONNEMENTS (MHE) MASTER (LMD) PARCOURS MICROORGANISMES, HÔTES, ENVIRONNEMENTS (MHE) RÉSUMÉ DE LA FORMATION Type de diplôme : Master (LMD) Domaine ministériel : Sciences, Technologies, Santé Mention : BIOLOGIE DES PLANTES

Plus en détail

Analyses bioinformatiques pour le PCIM

Analyses bioinformatiques pour le PCIM Analyses bioinformatiques pour le PCIM Journée de rencontre des utilisateurs du Pôle de calcul intensif pour la mer 17 janvier 2014 La bioinfo, késaco? Approche in silico de la biologie L'organisation,

Plus en détail

Olivier Bouchez, GeT-PlaGe Responsable SéquenS. olivier.bouchez@toulouse.inra.fr

Olivier Bouchez, GeT-PlaGe Responsable SéquenS. olivier.bouchez@toulouse.inra.fr Séquençage Haut-Débit sur GeT Olivier Bouchez, GeT-PlaGe Responsable SéquenS quençage Haut-débit olivier.bouchez@toulouse.inra.fr Localisation des séquenceurss Plateforme Génomique INRA Auzeville Séquenceurs

Plus en détail

Analyse informatique des données moléculaires

Analyse informatique des données moléculaires 6 - Bioinformatique F. CORPET, C. CHEVALET INRA, Laboratoire de Génétique Cellulaire, BP 27, 31326 Castanet-Tolosan cedex e-mail : chevalet@toulouse.inra.fr Analyse informatique des données moléculaires

Plus en détail

Bioinformatique en génomique évolutive

Bioinformatique en génomique évolutive Bioinformatique en génomique évolutive Elsa Petit Parcours 1997-2000: Ecole d Ingénieurs des Travaux Agricoles, Bordeaux Option pathologie végétale Eté 1999: Iowa State University, Prévision de l anthracnose

Plus en détail

Comparaison de novo de données de séquençage issues de très grands échantillons métagénomiques : application sur le projet Tara Oceans

Comparaison de novo de données de séquençage issues de très grands échantillons métagénomiques : application sur le projet Tara Oceans Comparaison de novo de données de séquençage issues de très grands échantillons métagénomiques : application sur le projet Tara Oceans Nicolas Maillet To cite this version: Nicolas Maillet. Comparaison

Plus en détail

Le séquençage Roche 454

Le séquençage Roche 454 Le séquençage Roche 454 www.454.com Stéphane Fénart, Arnaud Mouchon Roscoff, Avril 2012 Systèmes Genome Sequencers Une stratégie unique en séquençage nouvelle génération Pionniers en séquençage de nouvelle

Plus en détail

Séquençage Haut-Débit : HiSeq 2000 et HiSeq 2500 (Illumina)

Séquençage Haut-Débit : HiSeq 2000 et HiSeq 2500 (Illumina) Séquençage Haut-Débit : HiSeq 2000 et HiSeq 2500 (Illumina) avec automatisation sur robot Tecan EVO200 Préparation des librairies High Output - HiSeq 2000 ou 2500 Run : 11 jours -2 Flowcells, 8 lanes /

Plus en détail

Homéoallèles. Analyse différentielle. Normalisation. NGS Transcriptomique Python R. Blé RNA-seq

Homéoallèles. Analyse différentielle. Normalisation. NGS Transcriptomique Python R. Blé RNA-seq Présenté par Xi LIU ATCGCGCTAGCTGGTGTATCGCATCGCGCTAGCTGGTGTATCGCGCTAGCTGGTGTATCGCGCTAGCCTGGTGTATCGCCATCGCGCTAGCTGGCGCTAGCTGAATCGCGCATATG 17 Septembre 2013 Homéoallèles Génome Normalisation Analyse différentielle

Plus en détail

Plateforme de Recherche de Mutations

Plateforme de Recherche de Mutations Plateforme de Recherche de Mutations Jean-Marc Aury contact: pfm@genoscope.cns.fr 29 janvier 2009 Introduction Présentation des données produites par le GSFLX : type, qualité, Méthodes de détection de

Plus en détail

Les communautés de nématodes en tant que bioindicateurs potentiels de la santé des sols urbain

Les communautés de nématodes en tant que bioindicateurs potentiels de la santé des sols urbain Les communautés de nématodes en tant que bioindicateurs potentiels de la santé des sols urbain Rochat Guy* *Laboratoires Biologie du sol et Sol & végétation, Institut de Biologie, Université de Neuchâtel

Plus en détail

Janvier 2011 Guillaume Fernandez Mise à jour : Octobre 2011. La métagénomique

Janvier 2011 Guillaume Fernandez Mise à jour : Octobre 2011. La métagénomique Janvier 2011 Guillaume Fernandez Mise à jour : Octobre 2011 La métagénomique Mise en perspective face aux enseignements historiques de la biologie évolutive Moyens techniques en 2011 Génomique microbienne

Plus en détail

Aperçu des avancées dans le domaine de la biologie des sols forestiers

Aperçu des avancées dans le domaine de la biologie des sols forestiers Aperçu des avancées dans le domaine de la biologie des sols forestiers UROZ Stéphane, BISPO Antonio, BUEE Marc, CEBRON Aurélie, CORTET Jérôme, DECAENS Thibaud, HEDDE Mickael, PERES Guenola, VENNETIER Michel,

Plus en détail

THESE - UNIVERSITE AIX-MARSEILLE. Ecole Doctorale ED 62 Sciences de la vie et de la santé

THESE - UNIVERSITE AIX-MARSEILLE. Ecole Doctorale ED 62 Sciences de la vie et de la santé THESE - UNIVERSITE AIX-MARSEILLE Ecole Doctorale ED 62 Sciences de la vie et de la santé Pour obtenir le grade de Docteur de l Université d Aix-Marseille Spécialité Microbiologie Analyse de la biodiversité

Plus en détail

Retour d expérience, portage de code Promes dans le cadre de l appel à projets CAPS-GENCI

Retour d expérience, portage de code Promes dans le cadre de l appel à projets CAPS-GENCI , portage de code Promes dans le cadre de l appel à projets CAPS-GENCI PROMES (UPR 8521 CNRS) Université de Perpignan France 29 juin 2011 1 Contexte 2 3 4 Sommaire Contexte 1 Contexte 2 3 4 Laboratoire

Plus en détail

Séquençage. Bérénice Batut, berenice.batut@udamail.fr. DUT Génie Biologique Option Bioinformatique Année 2014-2015

Séquençage. Bérénice Batut, berenice.batut@udamail.fr. DUT Génie Biologique Option Bioinformatique Année 2014-2015 Séquençage Bérénice Batut, berenice.batut@udamail.fr DUT Génie Biologique Option Bioinformatique Année 2014-2015 Séquençage Séquençage ADN Détermination de l ordre d enchainement des nucléotides d un fragment

Plus en détail

Introduction à la Bio-Informatique IFT3295/IFT6291/BIN6000. Nadia El-Mabrouk DIRO, Université de Montréal

Introduction à la Bio-Informatique IFT3295/IFT6291/BIN6000. Nadia El-Mabrouk DIRO, Université de Montréal Introduction à la Bio-Informatique IFT3295/IFT6291/BIN6000 Nadia El-Mabrouk DIRO, Université de Montréal Qu est-ce que la Bioinformatique? Qu est-ce que la Bio-informatique? Champs multi-disciplinaire

Plus en détail

AutoGRAPH Un serveur pour automatiser et visualiser la comparaison de génomes: Application à l identification de nouveaux gènes chez le chien.

AutoGRAPH Un serveur pour automatiser et visualiser la comparaison de génomes: Application à l identification de nouveaux gènes chez le chien. AutoGRAPH Un serveur pour automatiser et visualiser la comparaison de génomes: Application à l identification de nouveaux gènes chez le chien. Thomas DERRIEN CNRS-UMR6061 Génétique et Développement Université

Plus en détail

Les virus dans les aliments : un nouveau défi pour les laboratoires de microbiologie

Les virus dans les aliments : un nouveau défi pour les laboratoires de microbiologie : un nouveau défi pour les laboratoires de microbiologie Véronique ZULIANI, Institut de la Filière Porcine Jean Christophe Augustin, ENVA, ASA Qu est ce qu un virus? Microorganisme de 15 à 40 nm Environ

Plus en détail

Génotypage et Séquençage. Pierre Mournet

Génotypage et Séquençage. Pierre Mournet Génotypage et Séquençage Pierre Mournet Plan Séquençage/Génotypage Classique (usat, Sanger) Séquençage NGS (Next Generation Sequencing) Séquenceur Préparation Pré-NGS Exemple 1 NGS Exemple 2 NGS Génotypage

Plus en détail

Transmission nosocomiale des entérovirus :

Transmission nosocomiale des entérovirus : Transmission nosocomiale des entérovirus : Intérêt du diagnostic moléculaire rapide associé au génotypage prospectif Enseignement à propos d une observation Audrey MIRAND EA3843 Laboratoire de Virologie

Plus en détail

Les nouvelles technologies de séquençage au Genoscope. Jean-Marc Aury, France Denoeud

Les nouvelles technologies de séquençage au Genoscope. Jean-Marc Aury, France Denoeud Les nouvelles technologies de séquençage au Genoscope Jean-Marc Aury, France Denoeud Introduction Présentation du Genoscope et des activités liées aux NTS Séquençage et assemblage des génomes procaryotes

Plus en détail

Data Mining et Big Data

Data Mining et Big Data Data Mining et Big Data Eric Rivals LIRMM & Inst. de Biologie Computationnelle CNRS et Univ. Montpellier 14 novembre 2015 E. Rivals (LIRMM & IBC) Big Data 14 novembre 2015 1 / 30 Introduction, contexte

Plus en détail

UTILISATION DE LA PLATEFORME WEB D ANALYSE DE DONNÉES GALAXY

UTILISATION DE LA PLATEFORME WEB D ANALYSE DE DONNÉES GALAXY UTILISATION DE LA PLATEFORME WEB D ANALYSE DE DONNÉES GALAXY Yvan Le Bras yvan.le_bras@irisa.fr Cyril Monjeaud, Mathieu Bahin, Claudia Hériveau, Olivier Quenez, Olivier Sallou, Aurélien Roult, Olivier

Plus en détail

Travaux dirigés de Microbiologie Master I Sciences des Génomes et des Organismes Janvier 2015

Travaux dirigés de Microbiologie Master I Sciences des Génomes et des Organismes Janvier 2015 Andrew Tolonen atolonen@genoscope.cns.fr Travaux dirigés de Microbiologie Master I Sciences des Génomes et des Organismes Janvier 2015 A- Généralités I- La vie sur terre telle que nous la connaissons ne

Plus en détail

Intrants médicamenteux en agriculture et en santé : les écosystèmes microbiens sont-ils un problème ou une solution?

Intrants médicamenteux en agriculture et en santé : les écosystèmes microbiens sont-ils un problème ou une solution? Les Rencontres de l Inra au Salon de l agriculture Intrants médicamenteux en agriculture et en santé : les écosystèmes microbiens sont-ils un problème ou une solution? Lundi 23 février 2015 Programme 14h30

Plus en détail

MUTATIONS et : Pandémies virales, évolution, génétique, environnement et cancer

MUTATIONS et : Pandémies virales, évolution, génétique, environnement et cancer MUTATIONS et : Pandémies virales, évolution, génétique, environnement et cancer évolution moléculaire ELEMENTS D UN ARBRE PHYLOGENETIQUE RECONSTRUCTION DE L HISTOIRE PAR COMPARAISON DE SEQUENCES (phylogénie

Plus en détail

Chapitre 10 L isolement et la manipulation de gènes. Injection d ADN étranger dans une cellule animale

Chapitre 10 L isolement et la manipulation de gènes. Injection d ADN étranger dans une cellule animale Chapitre 10 L isolement et la manipulation de gènes Injection d ADN étranger dans une cellule animale Comment amplifier un gène d intérêt? Amplification in vivo à l aide du clonage d ADN L ensemble formé

Plus en détail

ANALYSE DE L ADN FŒTAL DANS LE SANG MATERNEL: APPLICATION A LA TRISOMIE 21

ANALYSE DE L ADN FŒTAL DANS LE SANG MATERNEL: APPLICATION A LA TRISOMIE 21 ANALYSE DE L ADN FŒTAL DANS LE SANG MATERNEL: APPLICATION A LA TRISOMIE 21 JM Costa 5èmes Journées de Biologie Praticienne Mazagan, 4-5 Avril 2014 LABORATOIRE CERBA, Laboratoire du réseau DIAGNOSTIC PRÉNATAL

Plus en détail

École Doctorale «Sciences de la Vie et de la Santé»

École Doctorale «Sciences de la Vie et de la Santé» École Doctorale «Sciences de la Vie et de la Santé» Établissement principal : Université de la Méditerranée (AM II) Établissements cohabilités : Université de Provence (AM I) Université d Aix-Marseille

Plus en détail

BIODIVERSITE BACTERIENNE EN MILIEU PELAGIQUE Influence des facteurs environnementaux et rôle dans le cycle du carbone

BIODIVERSITE BACTERIENNE EN MILIEU PELAGIQUE Influence des facteurs environnementaux et rôle dans le cycle du carbone MEMOIRE D HABILITATION A DIRIGER DES RECHERCHES DE L UNIVERSITE PIERRE ET MARIE CURIE Spécialité : Ecologie Microbienne Présenté par Jean-François GHIGLIONE BIODIVERSITE BACTERIENNE EN MILIEU PELAGIQUE

Plus en détail

Résumé de thèse de David Kieffer. Titre : Études Bio-informatiques et statistiques des mécanismes de l infidélité de la transcription.

Résumé de thèse de David Kieffer. Titre : Études Bio-informatiques et statistiques des mécanismes de l infidélité de la transcription. Résumé de thèse de David Kieffer Titre : Études Bio-informatiques et statistiques des mécanismes de l infidélité de la transcription. Dans le cadre de la lutte contre le cancer, l'entreprise Genclis (Genomic

Plus en détail

CAMPAGNE D EMPLOIS ENSEIGNANTS 2012

CAMPAGNE D EMPLOIS ENSEIGNANTS 2012 CAMPAGNE D EMPLOIS ENSEIGNANTS 2012 ETABLISSEMENT : UM2 COMPOSANTE : Faculté des Sciences SITE : Campus Triolet IDENTIFICATION DU POSTE : N : Corps : Section CNU : 67 Nature demandée : Maître de Conférence

Plus en détail

Génotypage par Séquençage (GBS) : Création d une carte génétique haute densité de Tournesol Population INEDI (RILs PSC8 x XRQ)

Génotypage par Séquençage (GBS) : Création d une carte génétique haute densité de Tournesol Population INEDI (RILs PSC8 x XRQ) Génotypage par Séquençage (GBS) : Création d une carte génétique haute densité de Tournesol Population INEDI (RILs PSC8 x XRQ) Baptiste Mayjonade (IE-CDD SUNRISE) Génétique et génomique des réponses aux

Plus en détail

Notions de bioinformatique

Notions de bioinformatique Notions de bioinformatique Souvent les avancées des biotechnologies ont été possibles du fait d avancées technologiques relevant d autres domaines que la biologie. - En juillet 1995 le séquençage d Haemophilus

Plus en détail

Influence du nombre de réplicats dans une analyse différentielle de données RNAseq

Influence du nombre de réplicats dans une analyse différentielle de données RNAseq Influence du nombre de réplicats dans une analyse différentielle de données RNAseq Statisticiens: Sophie Lamarre Steve Van Ginkel Sébastien Déjean - Magali San Cristobal Matthieu Vignes Biologistes: Stéphane

Plus en détail