Analyse des données de séquençage massif par des méthodes phylogénétiques

Dimension: px
Commencer à balayer dès la page:

Download "Analyse des données de séquençage massif par des méthodes phylogénétiques"

Transcription

1 Analyse des données de séquençage massif par des méthodes phylogénétiques Roux S., Taib N., Mangot J.F., Hugoni M., Mary I., Ravet V., Bronner G., Enault F., Debroas D. Équipe Microbiologie de l'environnement et Bioinformatique Laboratoire Micro-organismes : Génome et Environnement UMR CNRS 6023 Université Blaise Pascal

2 Caractérisation des microbiomes Majorité des espèces ( > 99% bactéries ) non cultivées. Grande richesse : bactéries sur terre, formant plus de 10 9 espèces

3 Méthodes d'analyse des séquences Recherche de similarité (BLAST, Uclust, ) Classification bayésienne (RDP Classifier, Mothur,...) Approches phylogénétiques (STAP, RAIphy,...)

4 Approches phylogénétiques Caractérisation taxonomique de l'assemblage microbien Détection de nouveaux clades Analyse de liens évolutifs

5 Approches phylogénétiques Caractérisation taxonomique de l'assemblage microbien Détection de nouveaux clades Analyse de liens évolutifs Newton et al., 2007

6 Séquençage d'amplicons Marqueur phylogénétique : petite sous unité de l ARN ribosomique (18S/16S). Universalité Régions conservées / variables

7 Séquençage aléatoire : métagénomique Séquençage massif aléatoire du pool d'adn prélevé. Approche "naïve" Informations sur différents gènes / fonctions

8 Outils bioinformatiques PANAM : A Tool for the Phylogenetic Analysis and Taxonomic Affiliation of SSU rrna Amplicons. N. Taïb et al. (BMC Bioinformatics ; en révision) METAVIR : a web server dedicated to virome analysis. S. Roux et al. (Bioinformatics ; 2011 Nov 1 ; 27(21) : )

9 Prétraitement Détection des chimères Pangea (Giongo et al ; 2010) Qualité et taille PANAM : Étapes Tri Sample 1 Sample 2 Sample 3 Sample 4 Indices de diversité Clusterisation Uclust (Edgar, 2010) Sample 1 Sample 2 Sample 3 Sample 4 Annotation phylogénétique

10 PANAM : Étapes d'affiliation Annotation phylogénétique Base de Référence PANAM USEARCH (Edgar, 2010) Sample 1 Sample 2 Sample 3 Sample 4 Séquences requêtes + Taxonomie de la séquence voisine Alignements de référence Séquences requêtes triées selon groupes phylétiques

11 PANAM : Étapes d'affiliation Annotation phylogénétique Base de Référence PANAM Alignement avec le profil correspondant (HMMER, Eddy, 1998) Alignements de référence Reconstruction Phylogénétique (FastTree, Price et al., 2010) Séquences requêtes triées selon groupes phylétiques Annotation taxonomique Clades environnementaux

12 PANAM : Restitution taxonomique Restitution taxonomique : capacité du logiciel d'affiliation à déterminer la taxonomie correcte d'une séquence connue. 100% 90% 80% 70% PANAM BLAST STAP RDP 60% 50% Kingdom Phylum Class Order Family Genus Simulations sur séquences complètes (eucaryotes) Restitution : > 90 % au niveau genre Détection de clades environnementaux (Lepère et al., 2008)

13 PANAM : Restitution taxonomique Simulations sur run de pyroséquençage (400 pb) Eucaryotes 18S Bactéries 16S 100% 100% 90% 90% 80% 70% PANAM STAP RDP 80% 70% PANAM STAP RDP 60% 60% 50% Kingdom Phylum Class Order Family Genus 50% Kingdom phylum Class order Family Genus Restitution : > 75 % au niveau genre pour le 18S > 90 % au niveau genre pour le 16S

14 PANAM : performances Hours bp 200 bp 400 bp 800 bp Sequences Simulations sur un CPU 2 GHz Xeon et 24 GB RAM

15 PANAM : performances Dynamique à court terme des petits eucaryotes lacustres 160 Hours prélèvements séquences brutes séquences nettoyées bp 200 bp 400 bp 800 bp 1017 OTUs Sequences Simulations sur un CPU 2 GHz Xeon et 24 GB RAM Temps de traitement total : 30 minutes Variations à court terme de la diversité du picoplancton eucaryote lacustre : approche par séquençage massif I. Domaizon Poster 12

16 PANAM : Perspectives Web service intégré, dédié à l'étude de la diversité des microorganismes. Calcul distribué (cluster local / grille de calcul).

17 PANAM : Perspectives Web service intégré, dédié à l'étude de la diversité des microorganismes. Calcul distribué (cluster local / grille de calcul). Epanam. N. Taib Poster 45

18 Suivi de communautés microbiennes Suivi de communautés bactériennes en réponse à un stress Impact du tébuconazole sur les communautés bactériennes : Suivi sur 21 jours en triplicat. ~ 3000 séquences par échantillon Projet SENDEFO Évaluation de l impact du tébuconazole (fongicide) sur les communautés bactériennes de lacs et de rivières par une approche de pyroséquençage de l ARNr 16S. N. Pascault Poster 38

19 Suivi de communautés microbiennes Suivi de communautés bactériennes en réponse à un stress Impact du tébuconazole sur les communautés bactériennes : Suivi sur 21 jours en triplicat. ~ 3000 séquences par échantillon Projet SENDEFO Suivi de communautés spécifiques et comparaison d'échantillons Étude des Archaea en milieu marin ADN & ARN : Diversité / Activité des Archaea 80 échantillons Observation de clades spécifiques Évolution au cours du temps (série temporelle sur 3 ans 1/2) Projet DIVAQUA Diversité spécifique et fonctionnelle des communautés archéennes oxydant l ammonium dans les écosystèmes aquatiques. M. Hugoni Poster 20

20 Suivi de communautés microbiennes Suivi de communautés bactériennes en réponse à un stress Impact du tébuconazole sur les communautés bactériennes : Suivi sur 21 jours en triplicat. ~ 3000 séquences par échantillon Projet SENDEFO Suivi de communautés spécifiques et comparaison d'échantillons Étude des Archaea en milieu marin ADN & ARN : Diversité / Activité des Archaea 80 échantillons Observation de clades spécifiques Évolution au cours du temps (série temporelle sur 3 ans 1/2) Projet DIVAQUA Suivi globale des communautés microbiennes lacustres Diversité lacustre eucaryote et procaryote : Lac Pavin / Bourget Observatoire de l'environnement Suivi sur une année, en parallèle : 16S Bactéries / 16S Archées / 18S SOERE GLACPE

21 Outils bioinformatiques PANAM : A Tool for the Phylogenetic Analysis and Taxonomic Affiliation of SSU rrna Amplicons. Najwa Taïb et al. METAVIR : a web server dedicated to virome analysis. Simon Roux et al. Bioinformatics (Nov 2011)

22 Base de données de 80 viromes publiés METAVIR

23 METAVIR : Arbres phylogénétiques à partir de différents marqueurs

24 METAVIR : Arbres phylogénétiques à partir de différents marqueurs Cap3 (Huang, 1999) contig_1 read_9 contig_2

25 METAVIR : Arbres phylogénétiques à partir de différents marqueurs Cap3 (Huang, 1999) contig_1 read_9 contig_2 Hmmer (Eddy,1998) >Chlamydia_phage_1 >Chlamydia_phage_2 >Bdellovibrio_phage >Spiroplasma_virus >contig_1 VVQST-DSVQGNLSAYALST--DTKHLFTKSFV-EHGFVIGLLSAT IPQST-DSTQGNLAAYGTAI--GSKRVFTKSFT-EHGVILGLASVR VPQSS-TTDQGNLAAFSTASEFGNKIGFSKSFV-EHGYVLGFIRAR VPQSTVEKMQGNLAAFSETM-IQNNYLVNKTFT-EHSYIIVLAVVR QST--SVQGNLSAYATST-FDT >contig_2 >read_9 DGST----QGSLGQFSGRVAATYKH TKSFT-EHGVILGLASV

26 METAVIR : Arbres phylogénétiques à partir de différents marqueurs Cap3 (Huang, 1999) contig_1 read_9 contig_2 Hmmer (Eddy,1998) Gblocks (Talavera & Castresana,2007) PhyML (Guindon & Gascuel, 2003) >Chlamydia_phage_1 >Chlamydia_phage_2 >Bdellovibrio_phage >Spiroplasma_virus >contig_1 >contig_2 >read_9 Chlamydia_phage_1 Chlamydia_phage_2 contig_1 Bdellovibrio_phage Spiroplasma_virus contig_2 Entero_phage_ID22 Entero_phage_NC28 VVQST-DSVQGNLSAYALST--DTKHLFTKSFV-EHGFVIGLLSAT IPQST-DSTQGNLAAYGTAI--GSKRVFTKSFT-EHGVILGLASVR VPQSS-TTDQGNLAAFSTASEFGNKIGFSKSFV-EHGYVLGFIRAR VPQSTVEKMQGNLAAFSETM-IQNNYLVNKTFT-EHSYIIVLAVVR QST--SVQGNLSAYATST-FDT DGST----QGSLGQFSGRVAATYKH TKSFT-EHGVILGLASV Chlamydia_phage_1 Chlamydia_phage_2 read_9 Bdellovibrio_phage Spiroplasma_virus Entero_phage_ID22 Entero_phage_NC28

27 METAVIR : composition taxonomique GAAS (Angly et al., 2009) Krona (Ondov et al., 2011) Lac du Bourget : Composition taxonomique de la fraction virale

28 METAVIR : Diversité des Microviridae Lac Bourget / Lac Pavin / Lac Limnopolar

29 Caractérisation des communautés virales Diversité des communautés virales lacustres Viromes des lacs Pavin et Bourget projet Metavir

30 Caractérisation des communautés virales Diversité des communautés virales lacustres Viromes des lacs Pavin et Bourget projet Metavir Diversité des virus d'archaea 6 viromes le long d'un gradient de salinité projet Archevir

31 Caractérisation des communautés virales Diversité des communautés virales lacustres Viromes des lacs Pavin et Bourget projet Metavir Diversité des virus d'archaea 6 viromes le long d'un gradient de salinité projet Archevir Comparaison des communautés virales de milieux extrêmes Virome(s) de la zone anoxique du lac Pavin projet DICENTIM

32 Gisèle Bronner Jean-Christophe Charvy Didier Debroas Emilie Duffaud François Enault Mylène Hugoni Isabelle Jouan Jean-François Mangot Corinne Petit-Biderre Isabelle Mary Bushra Parveen Vivane Ravet Simon Roux Najwa Taïb Agnès Vellet

33 Vincent Breton Tung Doan Engelbert Mephu Nguifo Gisèle Bronner Jean-Christophe Charvy Didier Debroas Emilie Duffaud François Enault Mylène Hugoni Isabelle Jouan Jean-François Mangot Corinne Petit-Biderre Isabelle Mary Bushra Parveen Vivane Ravet Simon Roux Najwa Taïb Agnès Vellet Hélène Agogué Agnès Bouchez Isabelle Domaizon Noémie Pascault Jean-François Humbert Julie Leloup Jonathan Colombet Agnès Robin Télèsphore Sime-Ngando Pierre Galand Ian Saulter Joan Artigas Stéphane Pesce Yvan Bettarel

ALLOCATION POST-DOCTORALE 18 mois

ALLOCATION POST-DOCTORALE 18 mois ALLOCATION POST-DOCTORALE 18 mois LIMOS LMGE (CNRS, Université Blaise Pascal) Clermont-Ferrand Étude de la biosphère rare microbienne par une approche in silico : nouvelle méthode de classification ensembliste

Plus en détail

Utilisation de la métagénomique 16S pour la surveillance de l émergence de zoonoses bactériennes dans les populations animales

Utilisation de la métagénomique 16S pour la surveillance de l émergence de zoonoses bactériennes dans les populations animales Utilisation de la métagénomique 16S pour la surveillance de l émergence de zoonoses bactériennes dans les populations animales Réunion Rongeur 2014 CBGP Maxime Galan Métagénomique 16S: Pourquoi? Identification

Plus en détail

Najwa Taïb. Analyse de la diversité microbienne par séquençage massif : méthodes et applications.

Najwa Taïb. Analyse de la diversité microbienne par séquençage massif : méthodes et applications. Analyse de la diversité microbienne par séquençage massif : méthodes et applications Najwa Taïb To cite this version: Najwa Taïb. Analyse de la diversité microbienne par séquençage massif : méthodes et

Plus en détail

Techniques et matériels pour la production des données brutes de séquençage métagénomique

Techniques et matériels pour la production des données brutes de séquençage métagénomique 1 Techniques et matériels pour la production des données brutes de séquençage métagénomique Benoît Remenant, Stéphane Chaillou Introduction Au cours des dix dernières années, la métagénomique a permis

Plus en détail

PLAN DE FORMATION 2015

PLAN DE FORMATION 2015 PLAN DE FORMATION 2015 LMGE Laboratoire Microorganismes : Génome et Environnement UMR 6023 Télesphore Sime-Ngando Tél 04 73 40 78 36 (Directeur de l Unité) Fax 04 73 40 76 70 mail : telesphore.sime-ngando@univ-bpclermont.fr

Plus en détail

Barcoding environnemental par séquençage haut débit

Barcoding environnemental par séquençage haut débit Barcoding environnemental par séquençage haut débit Potentiel et limites Jean-François Martin Échantillonnage Spécificités du barcoding environnemental Amplification (PCR) de marqueurs choisis Séquençage

Plus en détail

Big data et sciences du Vivant L'exemple du séquençage haut débit

Big data et sciences du Vivant L'exemple du séquençage haut débit Big data et sciences du Vivant L'exemple du séquençage haut débit C. Gaspin, C. Hoede, C. Klopp, D. Laborie, J. Mariette, C. Noirot, MS. Trotard bioinfo@genopole.toulouse.inra.fr INRA - MIAT - Plate-forme

Plus en détail

L Équipe de Microbiologie Aquatique

L Équipe de Microbiologie Aquatique L Équipe de Microbiologie Aquatique Unité Mixte de Recherche INRA Université de Savoie Centre Alpin de Recherche sur les Réseaux Trophiques des Écosystèmes Limniques Les effectifs au 9 novembre 2005 Chercheurs

Plus en détail

1ère journée des doctorants du LMGE. Résumés des différentes présentations

1ère journée des doctorants du LMGE. Résumés des différentes présentations 1ère journée des doctorants du LMGE Résumés des différentes présentations 10h45. Philippe Poirier (3 ème année): Blastocystis spp.: épidémiologie et lien potentiel avec le syndrome de l'intestin irritable

Plus en détail

Master research Internship. Rapport bibliographique. Comparaison massive et multiple de métagénomes non assemblés

Master research Internship. Rapport bibliographique. Comparaison massive et multiple de métagénomes non assemblés Master research Internship Rapport bibliographique Comparaison massive et multiple de métagénomes non assemblés Auteur : Guillaume Holley Encadrant : Pierre Peterlongo GenScale Résumé La nature est d une

Plus en détail

Intégration des approches métagénomiques dans l'étude de la diversité des coléoptères saproxyliques : progrès et perspectives

Intégration des approches métagénomiques dans l'étude de la diversité des coléoptères saproxyliques : progrès et perspectives Intégration des approches métagénomiques dans l'étude de la diversité des coléoptères saproxyliques : progrès et perspectives Rodolphe Rougerie (1), Christophe Bouget (2) & Carlos Lopez-Vaamonde (1) (1)

Plus en détail

La génomique. Etude des génomes et de l ensemble de leurs gènes. Nécessite des outils bioinformatiques. Plusieurs étapes :

La génomique. Etude des génomes et de l ensemble de leurs gènes. Nécessite des outils bioinformatiques. Plusieurs étapes : La génomique Etude des génomes et de l ensemble de leurs gènes La structure Le fonctionnement L évolution Le polymorphisme, Plusieurs étapes : Nécessite des outils bioinformatiques 1 Chronologie sur le

Plus en détail

Etude transcriptomique de la dégradation des parois lignocellulosiques de son et paille de blé durant la croissance de Thermobacillus xylanilyticus

Etude transcriptomique de la dégradation des parois lignocellulosiques de son et paille de blé durant la croissance de Thermobacillus xylanilyticus Journées SFR condorcet Compiègne 8-9 juillet 2015 Projet Hydroseq : UMR FARE-CRRBM Etude transcriptomique de la dégradation des parois lignocellulosiques de son et paille de blé durant la croissance de

Plus en détail

Obtention de données génétiques à grande échelle

Obtention de données génétiques à grande échelle Obtention de données génétiques à grande échelle Stéphanie FERREIRA Ph.D. Campus de l Institut Pasteur de Lille 1, rue du Professeur Calmette 59000 LILLE Tel : 03 20 87 71 53 Fax : 03 20 87 72 64 contact@genoscreen.fr

Plus en détail

De GenoSol à GenoBiome, mise en place d une structure analytique pour évaluer l état biologique du sol

De GenoSol à GenoBiome, mise en place d une structure analytique pour évaluer l état biologique du sol De GenoSol à GenoBiome, mise en place d une structure analytique pour évaluer l état biologique du sol Lionel RANJARD, Samuel Dequiedt, Pierre-Alain Maron, Anne-Laure Blieux. UMR Agroécologie-plateforme

Plus en détail

RNAseq et NGS. Adriana Alberti Karine Labadie

RNAseq et NGS. Adriana Alberti Karine Labadie RNAseq et NGS Séquençage et Diversité LES ORGANISMES EUCARYOTES animaux plantes champignons protistes BACTERIES ARCHEES VIRUS METAGENOMES LES SOURCES ADN GENOMIQUE ARN / cdna AMPLICONS BACs ET FOSMIDES

Plus en détail

Détection de mutations somatiques par NGS sur GAIIx

Détection de mutations somatiques par NGS sur GAIIx Détection de mutations somatiques par NGS sur GAIIx Aude Lamy Laboratoire de Génétique Somatique des Tumeurs CHU de Rouen Inserm U1079 Faculté de Médecine et Pharmacie de Rouen La médecine personalisée

Plus en détail

Fouad Boumezbeur. doctorant en bioinformatique. fouad.boumezbeur@jouy.inra.fr

Fouad Boumezbeur. doctorant en bioinformatique. fouad.boumezbeur@jouy.inra.fr Séminaire Aristote OpenGPU : 1 an après Mercredi 8 juin 2011 Applications du GPU à l investigation métagénomique : illustration avec le projet européen MetaHIT Fouad Boumezbeur doctorant en bioinformatique

Plus en détail

La santé des sols: Présentation LEM du 30 avril et du 1er mai 2014

La santé des sols: Présentation LEM du 30 avril et du 1er mai 2014 La santé des sols: Opportunités et applications des nouvelles technologies de biologie moléculaire et de séquençage Laboratoire d écologie microbienne (IRDA) Présentation LEM du 30 avril et du 1er mai

Plus en détail

Titre: Domaine scientifique : Mots clés : Directeurs de thèse : Institution des directeurs de thèse : Adresse email des directeurs de thèse :

Titre: Domaine scientifique : Mots clés : Directeurs de thèse : Institution des directeurs de thèse : Adresse email des directeurs de thèse : Titre: Détermination de l ensemble des ARNs non codants chez Ostreococcus, un modèle d algue unicellulaire marine infectée par des virus à ADN double brin Domaine scientifique : Génomique Mots clés : ARN

Plus en détail

Le séquençage à haut débit Mars 2011

Le séquençage à haut débit Mars 2011 Atelier Epigénétique Université Pierre et Marie Curie Le séquençage à haut débit Mars 2011 Stéphane Le Crom (lecrom@biologie.ens.fr) Institut de Biologie de l École normale supérieure (IBENS) de la Montagne

Plus en détail

Simulation multi GPU d un logiciel de métagénomique. Dany Tello, Mathieu Almeida

Simulation multi GPU d un logiciel de métagénomique. Dany Tello, Mathieu Almeida Simulation multi GPU d un logiciel de métagénomique appliqué à la flore intestinale humaine Dany Tello, Mathieu Almeida Le microbiote intestinal humain : un organe négligé 100 trillions de micro organismes;

Plus en détail

Place et avenir du séquençage haut-débit

Place et avenir du séquençage haut-débit Place et avenir du séquençage haut-débit Olivier Bouchez genomique@toulouse.inra.fr La Plateforme GeT Expertise et mise à disposition d une plateforme technologique en génomique : Séquençage Génotypage

Plus en détail

Le séquençage Roche 454

Le séquençage Roche 454 Le séquençage Roche 454 www.454.com Stéphane Fénart, Arnaud Mouchon Roscoff, Avril 2012 Systèmes Genome Sequencers Une stratégie unique en séquençage nouvelle génération Pionniers en séquençage de nouvelle

Plus en détail

DIAGNOSTIC PRÉNATAL NON INVASIF : LE SANG MATERNEL

DIAGNOSTIC PRÉNATAL NON INVASIF : LE SANG MATERNEL 6 LE TEST DIAGNOSTIC PRÉNATAL NON INVASIF : LE SANG MATERNEL Source : les cellules trophoblastiques Fetal cell Cell isolation Détection 5-6SA Disparition rapide après accouchement Pas de persistance après

Plus en détail

Deux plateformes IBiSA et 3 plateaux techniques regroupés depuis 2010. Responsable scientifique Denis Milan. Coordination des nouveaux investissements

Deux plateformes IBiSA et 3 plateaux techniques regroupés depuis 2010. Responsable scientifique Denis Milan. Coordination des nouveaux investissements RNA-seq Olivier Bouchez Nathalie Marsaud Mercredi 28 mars 2012 Plateforme GeT : Génome et Transcriptome Deux plateformes IBiSA et 3 plateaux techniques regroupés depuis 2010 Responsable scientifique Denis

Plus en détail

1. L ADN et l information génétique. l ADN l information génétique est contenue dans l ADN. traduction. comment fait-on une protéine?

1. L ADN et l information génétique. l ADN l information génétique est contenue dans l ADN. traduction. comment fait-on une protéine? 1. L ADN et l information génétique l ADN l information génétique est contenue dans l ADN (ADN) (ARN) 1 2 A G T C U comment fait-on une protéine? traduction l information génétique est organisée par triplets

Plus en détail

Analyses bioinformatiques pour le PCIM

Analyses bioinformatiques pour le PCIM Analyses bioinformatiques pour le PCIM Journée de rencontre des utilisateurs du Pôle de calcul intensif pour la mer 17 janvier 2014 La bioinfo, késaco? Approche in silico de la biologie L'organisation,

Plus en détail

MASTER (LMD) PARCOURS MICROORGANISMES, HÔTES, ENVIRONNEMENTS (MHE)

MASTER (LMD) PARCOURS MICROORGANISMES, HÔTES, ENVIRONNEMENTS (MHE) MASTER (LMD) PARCOURS MICROORGANISMES, HÔTES, ENVIRONNEMENTS (MHE) RÉSUMÉ DE LA FORMATION Type de diplôme : Master (LMD) Domaine ministériel : Sciences, Technologies, Santé Mention : BIOLOGIE DES PLANTES

Plus en détail

Le séquençage à haut débit Juin 2012

Le séquençage à haut débit Juin 2012 Atelier Epigénétique Université Pierre et Marie Curie Le séquençage à haut débit Juin 2012 Stéphane Le Crom (stephane.le_crom@upmc.fr) Laboratoire de Biologie du Développement (UPMC) de la Montagne Sainte

Plus en détail

Séquençage Haut-Débit : HiSeq 2000 et HiSeq 2500 (Illumina)

Séquençage Haut-Débit : HiSeq 2000 et HiSeq 2500 (Illumina) Séquençage Haut-Débit : HiSeq 2000 et HiSeq 2500 (Illumina) avec automatisation sur robot Tecan EVO200 Préparation des librairies High Output - HiSeq 2000 ou 2500 Run : 11 jours -2 Flowcells, 8 lanes /

Plus en détail

Homéoallèles. Analyse différentielle. Normalisation. NGS Transcriptomique Python R. Blé RNA-seq

Homéoallèles. Analyse différentielle. Normalisation. NGS Transcriptomique Python R. Blé RNA-seq Présenté par Xi LIU ATCGCGCTAGCTGGTGTATCGCATCGCGCTAGCTGGTGTATCGCGCTAGCTGGTGTATCGCGCTAGCCTGGTGTATCGCCATCGCGCTAGCTGGCGCTAGCTGAATCGCGCATATG 17 Septembre 2013 Homéoallèles Génome Normalisation Analyse différentielle

Plus en détail

Séquençage haut débit (Next Generation Sequencing) 12/03/2012 Pascal Le Bourgeois, M1BBT, EM8BTGM 1

Séquençage haut débit (Next Generation Sequencing) 12/03/2012 Pascal Le Bourgeois, M1BBT, EM8BTGM 1 Séquençage haut débit (Next Generation Sequencing) 1 Pyroséquençage (454) Margulies M. et al. (2005). Genome sequencing in microfabricated high-density picolitre reactors. Nature 437:376-80 Pas de banques

Plus en détail

Aperçu des avancées dans le domaine de la biologie des sols forestiers

Aperçu des avancées dans le domaine de la biologie des sols forestiers Aperçu des avancées dans le domaine de la biologie des sols forestiers UROZ Stéphane, BISPO Antonio, BUEE Marc, CEBRON Aurélie, CORTET Jérôme, DECAENS Thibaud, HEDDE Mickael, PERES Guenola, VENNETIER Michel,

Plus en détail

Bioinformatique en génomique évolutive

Bioinformatique en génomique évolutive Bioinformatique en génomique évolutive Elsa Petit Parcours 1997-2000: Ecole d Ingénieurs des Travaux Agricoles, Bordeaux Option pathologie végétale Eté 1999: Iowa State University, Prévision de l anthracnose

Plus en détail

Retour d expérience, portage de code Promes dans le cadre de l appel à projets CAPS-GENCI

Retour d expérience, portage de code Promes dans le cadre de l appel à projets CAPS-GENCI , portage de code Promes dans le cadre de l appel à projets CAPS-GENCI PROMES (UPR 8521 CNRS) Université de Perpignan France 29 juin 2011 1 Contexte 2 3 4 Sommaire Contexte 1 Contexte 2 3 4 Laboratoire

Plus en détail

Biologie cellulaire. Perfectionnement à la culture cellulaire. Programme. ParTIe PraTIQUe. ParTIe THÉorIQUe. durée : 4 jours

Biologie cellulaire. Perfectionnement à la culture cellulaire. Programme. ParTIe PraTIQUe. ParTIe THÉorIQUe. durée : 4 jours Biologie cellulaire Perfectionnement à la culture cellulaire durée : 4 jours ingénieurs, chercheurs et chefs de projet connaissances de base en culture cellulaire ou validation du module «initiation à

Plus en détail

Le séquençage haut-débit

Le séquençage haut-débit Nouveaux outils en biologie Le séquençage haut-débit DES d hématologie 16 janvier 2015 Paris Alice Marceau-Renaut Laboratoire d hématologie CHRU Lille NGS = Next-Generation Sequencing Whole-genome Whole-exome

Plus en détail

AutoGRAPH Un serveur pour automatiser et visualiser la comparaison de génomes: Application à l identification de nouveaux gènes chez le chien.

AutoGRAPH Un serveur pour automatiser et visualiser la comparaison de génomes: Application à l identification de nouveaux gènes chez le chien. AutoGRAPH Un serveur pour automatiser et visualiser la comparaison de génomes: Application à l identification de nouveaux gènes chez le chien. Thomas DERRIEN CNRS-UMR6061 Génétique et Développement Université

Plus en détail

CAMPAGNE D EMPLOIS ENSEIGNANTS 2012

CAMPAGNE D EMPLOIS ENSEIGNANTS 2012 CAMPAGNE D EMPLOIS ENSEIGNANTS 2012 ETABLISSEMENT : UM2 COMPOSANTE : Faculté des Sciences SITE : Campus Triolet IDENTIFICATION DU POSTE : N : Corps : Section CNU : 67 Nature demandée : Maître de Conférence

Plus en détail

THESE - UNIVERSITE AIX-MARSEILLE. Ecole Doctorale ED 62 Sciences de la vie et de la santé

THESE - UNIVERSITE AIX-MARSEILLE. Ecole Doctorale ED 62 Sciences de la vie et de la santé THESE - UNIVERSITE AIX-MARSEILLE Ecole Doctorale ED 62 Sciences de la vie et de la santé Pour obtenir le grade de Docteur de l Université d Aix-Marseille Spécialité Microbiologie Analyse de la biodiversité

Plus en détail

Les nouvelles technologies de séquençage au Genoscope. Jean-Marc Aury, France Denoeud

Les nouvelles technologies de séquençage au Genoscope. Jean-Marc Aury, France Denoeud Les nouvelles technologies de séquençage au Genoscope Jean-Marc Aury, France Denoeud Introduction Présentation du Genoscope et des activités liées aux NTS Séquençage et assemblage des génomes procaryotes

Plus en détail

Institut Français de Bioinformatique (IFB) : mettre en place une infrastructure informatique dédiée aux sciences de la vie

Institut Français de Bioinformatique (IFB) : mettre en place une infrastructure informatique dédiée aux sciences de la vie 1 / 1 Institut Français de Bioinformatique (IFB) : mettre en place une infrastructure informatique dédiée aux sciences de la vie J-F. Gibrat Unité Mathématique, Informatique et Génome, INRA, Jouy-en-Josas

Plus en détail

Travaux dirigés de Microbiologie Master I Sciences des Génomes et des Organismes Janvier 2015

Travaux dirigés de Microbiologie Master I Sciences des Génomes et des Organismes Janvier 2015 Andrew Tolonen atolonen@genoscope.cns.fr Travaux dirigés de Microbiologie Master I Sciences des Génomes et des Organismes Janvier 2015 A- Généralités I- La vie sur terre telle que nous la connaissons ne

Plus en détail

Génotypage et Séquençage. Pierre Mournet

Génotypage et Séquençage. Pierre Mournet Génotypage et Séquençage Pierre Mournet Plan Séquençage/Génotypage Classique (usat, Sanger) Séquençage NGS (Next Generation Sequencing) Séquenceur Préparation Pré-NGS Exemple 1 NGS Exemple 2 NGS Génotypage

Plus en détail

Les besoins de la communauté des sciences de la vie en termes d infrastructure informatique

Les besoins de la communauté des sciences de la vie en termes d infrastructure informatique 1 / 31 Les besoins de la communauté des sciences de la vie en termes d infrastructure informatique J-F. Gibrat Unité Mathématique, Informatique et Génome, INRA, Jouy-en-Josas Séminaire IDRIS, Orsay, 14

Plus en détail

Janvier 2011 Guillaume Fernandez Mise à jour : Octobre 2011. La métagénomique

Janvier 2011 Guillaume Fernandez Mise à jour : Octobre 2011. La métagénomique Janvier 2011 Guillaume Fernandez Mise à jour : Octobre 2011 La métagénomique Mise en perspective face aux enseignements historiques de la biologie évolutive Moyens techniques en 2011 Génomique microbienne

Plus en détail

Séquençage. Bérénice Batut, berenice.batut@udamail.fr. DUT Génie Biologique Option Bioinformatique Année 2014-2015

Séquençage. Bérénice Batut, berenice.batut@udamail.fr. DUT Génie Biologique Option Bioinformatique Année 2014-2015 Séquençage Bérénice Batut, berenice.batut@udamail.fr DUT Génie Biologique Option Bioinformatique Année 2014-2015 Séquençage Séquençage ADN Détermination de l ordre d enchainement des nucléotides d un fragment

Plus en détail

Groupe de travail : Bioinformatique, plateformes, séquençage et génotypage

Groupe de travail : Bioinformatique, plateformes, séquençage et génotypage Groupe de travail : Bioinformatique, plateformes, séquençage et génotypage Les questions biologiques auxquelles s intéresse l ITMO ont traditionnellement fait appel à la génétique, à la génétique des populations,

Plus en détail

ANALYSE DE L ADN FŒTAL DANS LE SANG MATERNEL: APPLICATION A LA TRISOMIE 21

ANALYSE DE L ADN FŒTAL DANS LE SANG MATERNEL: APPLICATION A LA TRISOMIE 21 ANALYSE DE L ADN FŒTAL DANS LE SANG MATERNEL: APPLICATION A LA TRISOMIE 21 JM Costa 5èmes Journées de Biologie Praticienne Mazagan, 4-5 Avril 2014 LABORATOIRE CERBA, Laboratoire du réseau DIAGNOSTIC PRÉNATAL

Plus en détail

UTILISATION DE LA PLATEFORME WEB D ANALYSE DE DONNÉES GALAXY

UTILISATION DE LA PLATEFORME WEB D ANALYSE DE DONNÉES GALAXY UTILISATION DE LA PLATEFORME WEB D ANALYSE DE DONNÉES GALAXY Yvan Le Bras yvan.le_bras@irisa.fr Cyril Monjeaud, Mathieu Bahin, Claudia Hériveau, Olivier Quenez, Olivier Sallou, Aurélien Roult, Olivier

Plus en détail

Intrants médicamenteux en agriculture et en santé : les écosystèmes microbiens sont-ils un problème ou une solution?

Intrants médicamenteux en agriculture et en santé : les écosystèmes microbiens sont-ils un problème ou une solution? Les Rencontres de l Inra au Salon de l agriculture Intrants médicamenteux en agriculture et en santé : les écosystèmes microbiens sont-ils un problème ou une solution? Lundi 23 février 2015 Programme 14h30

Plus en détail

SERVICES DE SÉQUENÇAGE DE NOUVELLE GÉNÉRATION

SERVICES DE SÉQUENÇAGE DE NOUVELLE GÉNÉRATION 2015-09-29 SERVICES DE SÉQUENÇAGE DE NOUVELLE GÉNÉRATION Centre d innovation Génome Québec et Université McGill Guide de l utilisateur: Technologies de séquençage Illumina Version 5.6 Copyright 2015 Centre

Plus en détail

Master de Bioinformatique et Biologie des Systèmes Toulouse http://m2pbioinfo.biotoul.fr Responsable : Pr. Gwennaele Fichant

Master de Bioinformatique et Biologie des Systèmes Toulouse http://m2pbioinfo.biotoul.fr Responsable : Pr. Gwennaele Fichant Master de Bioinformatique et Biologie des Systèmes Toulouse http://m2pbioinfo.biotoul.fr Responsable : Pr. Gwennaele Fichant Parcours: Master 1 : Bioinformatique et biologie des Systèmes dans le Master

Plus en détail

DÉFIS DU SÉQUENÇAGE NOUVELLE GÉNÉRATION

DÉFIS DU SÉQUENÇAGE NOUVELLE GÉNÉRATION DÉFIS DU SÉQUENÇAGE NOUVELLE GÉNÉRATION PRINCIPES DE BASE SUR LES DONNEES ET LE CALCUL HAUTE PERFORMANCE Lois de Gray sur l ingénierie des données 1 : Les calculs scientifiques traitent des volumes considérables

Plus en détail

L'analyse protéomique et les sciences -omiques: des données massives à interpréter et sauvegarder

L'analyse protéomique et les sciences -omiques: des données massives à interpréter et sauvegarder L'analyse protéomique et les sciences -omiques: des données massives à interpréter et sauvegarder Christine CARAPITO, Alexandre BUREL, Patrick GUTERL, Alexandre WALTER, Jérôme PANSANEL, Fabrice VARRIER,

Plus en détail

Allocations de recherche doctorale (ARED) Fiche projet 2015

Allocations de recherche doctorale (ARED) Fiche projet 2015 - Date de la demande (15 /.03../.2015..) : 1- Identification du projet (en langue française) - Acronyme du projet (8 caractères maximum) : MicroObs - Intitulé du projet (en langue française) : Effet des

Plus en détail

TD1 : Traitement d'un Fichier Brut de Séquences Transcrites.

TD1 : Traitement d'un Fichier Brut de Séquences Transcrites. TD1 : Traitement d'un Fichier Brut de Séquences Transcrites. Dans le cadre de cette formation, nous allons utiliser des données Illumina (75-bases 'pair-ends') issues du transcriptome de plusieurs individus

Plus en détail

EPIDEMIOLOGIE MOLECULAIRE ET METAGENOMIQUE A HAUT DEBIT SUR LA GRILLE

EPIDEMIOLOGIE MOLECULAIRE ET METAGENOMIQUE A HAUT DEBIT SUR LA GRILLE EPIDEMIOLOGIE MOLECULAIRE ET METAGENOMIQUE A HAUT DEBIT SUR LA GRILLE T.T. Doan To cite this version: T.T. Doan. EPIDEMIOLOGIE MOLECULAIRE ET METAGENOMIQUE A HAUT DEBIT SUR LA GRILLE. Distributed, Parallel,

Plus en détail

Influence du nombre de réplicats dans une analyse différentielle de données RNAseq

Influence du nombre de réplicats dans une analyse différentielle de données RNAseq Influence du nombre de réplicats dans une analyse différentielle de données RNAseq Statisticiens: Sophie Lamarre Steve Van Ginkel Sébastien Déjean - Magali San Cristobal Matthieu Vignes Biologistes: Stéphane

Plus en détail

APPEL A PROJETS DATE LIMITE : 18 JUIN 2009

APPEL A PROJETS DATE LIMITE : 18 JUIN 2009 Conseil Scientifique Appel d offres 2009 Programmes pluridisciplinaires APPEL A PROJETS DATE LIMITE : 18 JUIN 2009 1. Présentation 2. Procédure 3. Dossier de candidature PRESENTATION En complément à la

Plus en détail

e-biogenouest CNRS UMR 6074 IRISA-INRIA / Plateforme de Bioinformatique GenOuest yvan.le_bras@irisa.fr Programme fédérateur Biogenouest co-financé

e-biogenouest CNRS UMR 6074 IRISA-INRIA / Plateforme de Bioinformatique GenOuest yvan.le_bras@irisa.fr Programme fédérateur Biogenouest co-financé e-biogenouest Coordinateur : Olivier Collin Animateur : Yvan Le Bras CNRS UMR 6074 IRISA-INRIA / Plateforme de Bioinformatique GenOuest yvan.le_bras@irisa.fr Programme fédérateur Biogenouest co-financé

Plus en détail

Nous vous prions d agréer, Madame, Monsieur, l expression de nos sentiments les meilleurs.

Nous vous prions d agréer, Madame, Monsieur, l expression de nos sentiments les meilleurs. DOSSIER DE CANDIDATURE MASTER BIOLOGIE ET ENVIRONNEMENT M2 Spécialité : Microbiologie : Génome, Écologie et Biotechnologies (MGEB) Date limite de dépôt des dossiers : 10 juin 2015 Madame, Monsieur, Vous

Plus en détail

Vue d ensemble de la vie microbienne

Vue d ensemble de la vie microbienne Vue d ensemble de la vie microbienne C HAPITRE D EUX I Structure cellulaire et évolution 22 2.1 Les structures cellulaires et virales 22 2.2 L organisation de l ADN dans les cellules microbiennes 24 2.3

Plus en détail

RÉPERTOIRE RELÈVE SCIENTIFIQUE AU SERVICE DES ENTREPRISES AGROALIMENTAIRES. 2 e édition

RÉPERTOIRE RELÈVE SCIENTIFIQUE AU SERVICE DES ENTREPRISES AGROALIMENTAIRES. 2 e édition RELÈVE SCIENTIFIQUE AU SERVICE 2 e édition Juin 2011 Réalisé par : Partenaire financier du CQVB : Objectif : Ce répertoire vise à faciliter le maillage entre les étudiants-chercheurs universitaires et

Plus en détail

Etude fonctionnelle de la communauté microbienne de la peau par une approche métagénomique

Etude fonctionnelle de la communauté microbienne de la peau par une approche métagénomique THÈSE Présentée pour l obtention du titre de DOCTEUR DE L UNIVERSITÉ DE LYON Délivré par l ÉCOLE CENTRALE DE LYON École doctorale : EEA Spécialité : Génomique microbienne Par Alban Mathieu Etude fonctionnelle

Plus en détail

SyMeTRIC. projet régional pour le développement de la Médecine Systémique. alban.gaignard@univ-nantes.fr

SyMeTRIC. projet régional pour le développement de la Médecine Systémique. alban.gaignard@univ-nantes.fr SyMeTRIC projet régional pour le développement de la Médecine Systémique alban.gaignard@univ-nantes.fr portage scientifique : Jérémie Bourdon (LINA), Richard Redon (Inst. du Thorax) Systems Medicine Développer

Plus en détail

Présentation ADN Fishbase. Jolien Bamps

Présentation ADN Fishbase. Jolien Bamps Présentation ADN Fishbase Jolien Bamps Les lois de Mendel et la transmission de l hérédité Gregor Mendel Moine et botaniste hongrois (1822-1884), en charge de maintenir le potager de son monastère Considéré

Plus en détail

Réunion du réseau de génétique du Département EFPA

Réunion du réseau de génétique du Département EFPA 17 19 novembre 2014 Centre INRA de Nancy Lorraine Programme Lundi 17 novembre Salle Tilleul 13:00 Bus pour l'inra depuis la gare de Nancy 14:00 14:30 Introduction de la réunion tour de table 14:30 14:45

Plus en détail

5. Matériaux en contact avec l eau

5. Matériaux en contact avec l eau Monitoring de la qualité Microbiologique de l eau potable dans les réseaux de distributions Intérêt de l utilisation d un kit de mesure rapide de la flore totale UTLISATIONS 1. Surveillance de Réseau mixte

Plus en détail

!"#$%&'(& )*!$"+*","-*(&-(.($/,(! "#$"%"#$&!

!#$%&'(& )*!$+*,-*(&-(.($/,(! #$%#$&! "#$%'( )*$"+*","-*(-(.($/,( "#$"%"#$ Directrice du Cours Chantal LE BOUGUENEC Chef de Travaux Christophe BELOIN 0$"-$/))( /1123415637859:573;;

Plus en détail

CHAPITRE 3 LA SYNTHESE DES PROTEINES

CHAPITRE 3 LA SYNTHESE DES PROTEINES CHAITRE 3 LA SYNTHESE DES ROTEINES On sait qu un gène détient dans sa séquence nucléotidique, l information permettant la synthèse d un polypeptide. Ce dernier caractérisé par sa séquence d acides aminés

Plus en détail

Université de la Méditerranée Aix-Marseille II Faculté des sciences de Luminy THESE. Pour obtenir le grade de

Université de la Méditerranée Aix-Marseille II Faculté des sciences de Luminy THESE. Pour obtenir le grade de Université de la Méditerranée Aix-Marseille II Faculté des sciences de Luminy N o attribué par la bibliothèque _ _ _ _ _ _ _ _ _ _ THESE Pour obtenir le grade de DOCTEUR DE L UNIVERSITE DE LA MEDITERRANEE

Plus en détail

Gènes Diffusion - EPIC 2010

Gènes Diffusion - EPIC 2010 Gènes Diffusion - EPIC 2010 1. Contexte. 2. Notion de génétique animale. 3. Profil de l équipe plateforme. 4. Type et gestion des données biologiques. 5. Environnement Matériel et Logiciel. 6. Analyses

Plus en détail

Séquençage haut débit 5 mars 26 mars (14h) C. Gaspin, C. Klopp, J. Mariette & G. Salin

Séquençage haut débit 5 mars 26 mars (14h) C. Gaspin, C. Klopp, J. Mariette & G. Salin Séquençage haut débit 5 mars 26 mars (14h) C. Gaspin, C. Klopp, J. Mariette & G. Salin Plan de la session Bioinformatique & séquençage haut débit Date Intervenant (s) Libellé 05/03 G. Salin Introduction

Plus en détail

MABioVis. Bio-informatique et la

MABioVis. Bio-informatique et la MABioVis Modèles et Algorithmes pour la Bio-informatique et la Visualisation Visite ENS Cachan 5 janvier 2011 MABioVis G GUY MELANÇON (PR UFR Maths Info / EPI GRAVITE) (là, maintenant) - MABioVis DAVID

Plus en détail

BIG DATA une évolution, une révolution, une promesse pour le diagnostic

BIG DATA une évolution, une révolution, une promesse pour le diagnostic Journées One Health d Ile-de-France BIG DATA une évolution, une révolution, une promesse pour le diagnostic 27 novembre 2014 de 13h30 à 17h30 Amphithéâtre 3 du Campus Centre UPEC Le séminaire sera suivi

Plus en détail

L analyse métagénomique ciblée au service de la microbiologie des aliments : applications concrètes

L analyse métagénomique ciblée au service de la microbiologie des aliments : applications concrètes L analyse métagénomique ciblée au service de la microbiologie des aliments : applications concrètes Bernard Taminiau, Carine Nezer, Laurent Delhalle, Ysabelle Adolphe, Pedro Imazaki, Amélie Darcis, Antoine

Plus en détail

exemple de végétaux exposés au benzène atmosphérique Sylvain Dumez sylvain.dumez@univ-lille2.fr

exemple de végétaux exposés au benzène atmosphérique Sylvain Dumez sylvain.dumez@univ-lille2.fr Approches écotoxicogénomiques et application à la biosurveillance exemple de végétaux exposés au benzène atmosphérique Sylvain Dumez sylvain.dumez@univ-lille2.fr Laboratoire des Sciences végétales et fongiques,

Plus en détail

Atelier 5/11/2013. Structure de la chromatine et marques épigénétiques

Atelier 5/11/2013. Structure de la chromatine et marques épigénétiques Atelier 5/11/2013 Structure de la chromatine et marques épigénétiques La chromatine ADN ADN + Histones = Nucleosome ADN + Protéines + ARNs = Chromatine Niveau extrême de condensation = Chromosome métaphasique

Plus en détail

4 : MÉTHODES D ANALYSE UTILISÉES EN ÉCOLOGIE MICROBIENNE

4 : MÉTHODES D ANALYSE UTILISÉES EN ÉCOLOGIE MICROBIENNE 4 : MÉTHODES D ANALYSE UTILISÉES EN ÉCOLOGIE MICROBIENNE L écologie microbienne (ou étude des micro-organismes de l environnement) étudie : les relations entre les différentes populations de micro-organismes

Plus en détail

Cours d introduction à la génétique de la souris Notion de Souche

Cours d introduction à la génétique de la souris Notion de Souche Cours d introduction à la génétique de la souris Notion de Souche Introduction: - Réponse d un animal à l expérimentation (diapo 1) Facteurs environnementaux et propres à l animal - Notion d animal standardisé

Plus en détail

L IRSN et la surveillance de l environnement. Etat des lieux et perspectives

L IRSN et la surveillance de l environnement. Etat des lieux et perspectives L IRSN et la surveillance de l environnement Etat des lieux et perspectives Didier CHAMPION et Jean-Marc PERES Journées SFRP Paris 23-24 septembre 2009 Objectifs de la surveillance de l environnement 2

Plus en détail

Mort subite : les généticiens nantais à la pointe du diagnostic préventif

Mort subite : les généticiens nantais à la pointe du diagnostic préventif Mort subite : les généticiens nantais à la pointe du diagnostic préventif Inserm-Patrice Latron Inserm-Jean-Christophe Lambry Inaugurations du séquenceur haut-débit et du centre de prise en charge de la

Plus en détail

Les progrès de la Microbiologie : de Louis Pasteur à la «Microbiomique»

Les progrès de la Microbiologie : de Louis Pasteur à la «Microbiomique» Les progrès de la Microbiologie : de Louis Pasteur à la «Microbiomique» par le Professeur Daniel PORTETELLE 46 e Congrès pluraliste des Sciences Août 2008 1 Qu est ce que la microbiologie? Science qui

Plus en détail

CERTIFICAT DE COMPÉTENCES EN BIO-INFORMATIQUE

CERTIFICAT DE COMPÉTENCES EN BIO-INFORMATIQUE CERTIFICAT DE COMPÉTENCES EN BIO-INFORMATIQUE Organisé par l équipe pédagogique : Statistique bioinformatique du département IMATH Responsable de la formation : Pr. Jean-François Zagury Coordinateur des

Plus en détail

Dépistage Prénatal Non Invasif

Dépistage Prénatal Non Invasif Dépistage Prénatal Non Invasif Dr Mélanie JIMENEZ POCQUET Biologiste - Cytogéneticien L ABOcaryo+ L ABO+ - Chambray les Tours Les patientes connectées Les forums La presse Le presse DPNI : pourquoi

Plus en détail

A la rencontre du séquençage haut-débit nouvelle génération. Infosys Building, Kuwait

A la rencontre du séquençage haut-débit nouvelle génération. Infosys Building, Kuwait A la rencontre du séquençage haut-débit nouvelle génération Infosys Building, Kuwait 2001 : Aboutissement du projet Génome Humain Ancêtres & Renouveau 2010 Hélicos, Ion torrent, Pacbio, Oxford Nanopore

Plus en détail

Optimisation des performances du programme mpiblast pour la parallélisation sur grille de calcul

Optimisation des performances du programme mpiblast pour la parallélisation sur grille de calcul Optimisation des performances du programme mpiblast pour la parallélisation sur grille de calcul Mohieddine MISSAOUI * Rapport de Recherche LIMOS/RR-06-10 20 novembre 2006 * Contact : missaoui@isima.fr

Plus en détail

ARN et bioinformatique: PDF processed with CutePDF evaluation edition www.cutepdf.com

ARN et bioinformatique: PDF processed with CutePDF evaluation edition www.cutepdf.com ARN et bioinformatique: Partie 1 PDF processed with CutePDF evaluation edition www.cutepdf.com Sommaire Principes biologiques : Transcription/traduction, types d ARN, formes primaires/secondaires. Zuker

Plus en détail

Mise en place de serveurs Galaxy dans le cadre du réseau CATI BBRIC

Mise en place de serveurs Galaxy dans le cadre du réseau CATI BBRIC Mise en place de serveurs Galaxy dans le cadre du réseau CATI BBRIC {Sebastien.Carrere, Ludovic.Legrand,Jerome.Gouzy}@toulouse.inra.fr {Fabrice.Legeai,Anthony.Bretaudeau}@rennes.inra.fr CATI BBRIC 35 bioinformaticiens

Plus en détail

Dr E. CHEVRET UE2.1 2013-2014. Aperçu général sur l architecture et les fonctions cellulaires

Dr E. CHEVRET UE2.1 2013-2014. Aperçu général sur l architecture et les fonctions cellulaires Aperçu général sur l architecture et les fonctions cellulaires I. Introduction II. Les microscopes 1. Le microscope optique 2. Le microscope à fluorescence 3. Le microscope confocal 4. Le microscope électronique

Plus en détail

PLATEFORME GÉNOME TRANSCRIPTOME DE BORDEAUX

PLATEFORME GÉNOME TRANSCRIPTOME DE BORDEAUX PLATEFORME GÉNOME TRANSCRIPTOME DE BORDEAUX Catalogue des prestations et services CONTACTS Site internet de la Plateforme : https://www4.bordeaux-aquitaine.inra.fr/pgtb Direction : Pascal SIRAND-PUGNET

Plus en détail

La PCR en temps réel

La PCR en temps réel La PCR en temps réel Hôpital La Rabta Tunis 6 juin 2013 Dr Sabine Favre-Bonté Maître de Conférences, Université Claude Bernard Lyon 1 UMR CNRS 5557 Ecologie Microbienne Equipe Multi-résistance environnementale

Plus en détail

l Initiative canadienne du microbiome

l Initiative canadienne du microbiome l Initiative canadienne du microbiome Rapport de l atelier 16 et 17 juin, 2008 Fairmont Royal York Hotel, Toronto Rédigé par: Dre Judith Bray, PhD, Directrice Adjointe, IMII Plans de conception graphique

Plus en détail

Transformée de Burrows-Wheeler et mapping de données RNA-seq

Transformée de Burrows-Wheeler et mapping de données RNA-seq Transformée de Burrows-Wheeler et mapping de données RNA-seq MAPPI, journée indexation 6 juin 2011 Introduction Indexation But : Recherche rapide d'une information dans de grands volumes de données Indexation

Plus en détail

Tutoriel Cloud IFB - Initiation -

Tutoriel Cloud IFB - Initiation - Tutoriel Cloud IFB - Initiation - Christophe BLANCHET Institut Français de Bioinformatique - IFB French Institute of Bioinformatics - ELIXIR-FR CNRS UMS3601 - Gif-sur-Yvette - FRANCE Ecole Cumulo NumBio

Plus en détail

Brest (29) Lessay (50), 12-13 Mars 2012

Brest (29) Lessay (50), 12-13 Mars 2012 Conclusions Projet Aquamanche Aquatic management of catchments for health and environment Gestion des eaux des bassin versants pour la santé et l environnement Brest (29) Lessay (50), 12-13 Mars 2012 Les

Plus en détail

LES OUTILS DE BIOLOGIE MOLECULAIRE ET LEUR UTILISATION DANS LE DOMAINE DE LA GESTION DES SITES POLLUES

LES OUTILS DE BIOLOGIE MOLECULAIRE ET LEUR UTILISATION DANS LE DOMAINE DE LA GESTION DES SITES POLLUES LES OUTILS DE BIOLOGIE MOLECULAIRE ET LEUR UTILISATION DANS LE DOMAINE DE LA GESTION DES SITES POLLUES Janvier 2015 Étude réalisée pour le compte de l'ademe par : Jean-Michel Monier 1 et Sébastien Cécillon

Plus en détail

Le diagnostic approfondi du groupe santé

Le diagnostic approfondi du groupe santé Le diagnostic approfondi du groupe santé Axe 1 : La pollution de l air - Prélèvements et analyse bactériologique de l air réalisé par S Prim et les élèves de BTS Dans le cadre des travaux pratiques de

Plus en détail