LANY TAMINGANA ETO AMINTSIKA

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "LANY TAMINGANA ETO AMINTSIKA"

Transcription

1 cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN D INFORMATION N 0188 DU Samedi 23 Octobre 2010 BLOCS PETROLIERS LA VENTE APRES LE NOUVEAU CODE Il faudra attendre l approbation par le Parlement A n d r y R a j o e l i n a s e r a i t e n Ny halatra sy ny fanimbazimbana tsy du nouveau code pétrolier avant de lancer l appel préparation en France p-03 amin antony no anton izany p-02 d offres sur la vente des 90 blocs p-07 OIF La situation malgache est préoccupante «La situation reste préoccupante à Madagascar», a avancé Henriette Martinez, vice-présidente de l Assemblée Parlementaire de la Francophonie (APF) qui est intervenue devant la 26eme Conférence ministérielle de la Francophonie (CMF) jeudi 21 octobre dernier. Cette intervention entre dans le cadre de la présentation des activités de l APF dans le domaine politique, mais aussi en matière de coopération parlementaire. Notons que cette entité a un mécanisme appelé «Vigie de la démocratie», lequel suit avec attention les situations de crise dans l espace francophone. D une manière générale, l APF constate que «les motifs d inquiétude n ont pas manqué ces derniers temps et notre Secrétaire général parlementaire résumait devant le dernier Conseil permanent de la Francophonie notre sentiment en citant une phrase de Jean-Marie Le Clézio : «L horizon était vague, imprécis, de brume et de couleur grise». Depuis lors, l horizon semble s éclaircir». En attendant la Déclaration de Montreux, dimanche prochain, où le cas de Madagascar devrait être largement évoqué, d ores et déjà on sait que l OIF trouve la situation du pays plus que préoccupante. Pourtant, les partisans de l actuelle transition attendent beaucoup du sommet qui s est ouvert hier. Ils espèrent que l organisation internationale regroupant les pays francophones envoie dans la Grande Ile une mission d observation des futures consultations électorales et plus par ticulièrement le référendum constitutionnel du 17 novembre prochain. FIFANAKALOZANA SY VAROTRA IVELANY Roa andro nandinihana teto Antananarivo Trano Mora Le social en prime Le Président de la HAT ne sera pas candidat aux p r o c h a i n e s é l e c t i o n s présidentielles prévues pour l année prochaine. Mais cela ne l empêche pas d annoncer, à tour de bras, des promesses dont bénéficiera la couche la plus vulnérable de la population. Ainsi, lors de la cérémonie de présentation officielle du «Tsena Mora», hier à Mahamasina, Andry Rajoelina a annoncé la mise en œuvre, dans les prochaines semaines, d un autre projet à caractère social, «Trano M a r o i r e o f i f a n a r a h a n a ara-barotra vita sonia teo amin i Madagasikara sy ireo firenena any ivelany. Ao ireo nifanaovana tamin ny firenena samy firenena, ao koa ireo nifanarahana niaraka tamim-bondrom-pirenena toa n y C O I, n y C O M E S A n a n y SADC. Midika izany fa misy tokoa ireo vokatra azon ny firenena ifanakalozana amin ny any ivelany. Saingy noho ny fivoaran izany tontolon ny fifanakalozana izany ihany koa dia miovaova araka ny Mora». Il s agirait d une opération immobilière à destination des ménages pauvres qui pourraient devenir propriétaires grâce à la vente de maisons à bas prix. On ne connaît pas encore les détails de cette autre opération. Néanmoins, celle-ci ne serait pas le premier projet de ce type dans le pays. On se souvient encore de celui de Didier Ratsiraka baptisé à l époque « logements». vanim-potoana io sehatra io. Raha ny lavanila, ohatra, no lohalaharana sy nampidi-bola be, dimampolo taona lasa izay, ankehitriny dia mivadika ny rasa ka misedra olana ara-barotra maro io vokatra io. Izany no antony ilàna ny fitadiavana vokatra sy lalam-barotra hafa, hanatevina ny harin-karena faobe. Eo anatrehan izany no isian ny fivoriana tomban ezaka toa ny natao teto Antananarivo nandritra ny telo andro tamin ity herinandro ity.

2 2 Le Journal SAMEDI 23 OCTOBRE 2010 Fomba fijery iray Mihafongana tsikelikely ireo voahary malagasy Fanondranana an-tsokotsoko sy fahasimban ny tontolo no antony Eto Madagasikara no ahitana maro ireo singan-javatra vitsy mpanana indrindra maneran-tany. Misy izany, na avy amin ny zava-maniry, na amin ny zava-manan aina. Na an-tanety na andranomasina dia manan-karena ny firenena amin ny singa tsy fahita firy raha tsy eto amin ity Nosy ity ihany. Arak izay maha maro ny karazana izay ihany koa anefa no maha maro fahavalo azy ireny. Ny olona aloha no fositra voalohany amin izany. Manaraka ao ny fahasimban ny tontolo iainan ireny zava-boahary ireny. Maro noho izany no atahorana sy ahiana ho lany tamingana, toa ireo efa marobe teo aloha, ritra sy tapitra ka tsy hitan ny taranaka aty aoriana intsony. Marina fa misy dia misy tokoa ny ezaka natao ary mbola tohizana ankehitriny, hiarovana azy ireny. Tsy kely lalana koa anefa ny ratsy ka tandindonin-doza ny harem-pirenena. Kanefa anie dia ekena fa samy manana ny tantarany ireny zava-boahary ireny. Manana ihany koa ny hery sy zava-tsoa entiny ho an ny firenena sy ny vahoaka miaina ao. Raha tsy hilaza afa-tsy ny rano isika, dia iaraha-mahita fa ny tanàna iray, ny foko iray, eny, hatramin ny faritra mihitsy aza mazàna dia velona sy teraka noho ny fisian ny rano, dia ny renirano lehibe mamelona azy. Ikopa no laharanon Analamanga, Matitana ny an ny any Atsimo-Atsinanana any, Fiherena ny an i Toliara, etsetra etsetra. Toa izany ihany koa ny tany. Tsy ny eny an-tendrombohitra ngazana no namahatra ny vahoaka sy tanàna iray fa namonjy hatrany ny lohasaha na saka sy horaka lonaka. Tsy ny tany maina sy kely rotsan-korana toa ny any Atsimo no nivelaran ny sivilizasiôna gasy matanjaka fa ny faritra mampilonadonaka ny voahary sy ny natiora. Ny tany sy ny rano tokoa no loharanon ny fiainan-draolombelona, ka raha vao ireo no voatohintohina dia marefo sy tsy zarizary ny farim-piainany, ary malemy sy tsy ampy antom-pivelomana ny firenena iray sy ny vahoaka ao aminy. Fomba maro ary no mahatonga amin izany fenitra anahiana ho ringana, na ny voahary na ny olona izany. Ao aloha ny tsy fitandremana fa manao rapadango ny tontolo manodidina, ary ao koa ny fanapotehana tsotra izao izany tontolo izany noho ny setrasetra na ny fitiavan-kely ka anondranana sy anaovana varo-boba ny harem-pirenena. Ratsiraka Roland : Tsy hampiova zavatra ny fampihaonana ataon ny CNOSC T s y h a n d r a y a n j a r a amin ny fampihaonana izay kasain ny CNOSC ho atao Atoa Ratsiraka Roland, filoha nasiônalin ny MTS. Aminy dia tsy hampiova na inona na inona intsony izany. Araka ny heviny dia vao mainka hanimba zavatra maro ny fiviliviliana, fa rehefa misy aloha ny vahaolana hita sy efa nizorana dia izay no tokony imasoana, ary mila finiavana sy fikikirana matotra ny famahana ny krizy, fa tsy kilalaon-jaza akory ka andrandramana daholo izao rehetra izao. Efa misy ny lalana mazava tokony arahan ny Malagasy amin ny famahana ny krizy, ka io aloha no tokony izoran ny rehetra, fa ajanona amin izay ny fihaonana izay efa tsy nitondra vahaolana hatramin izay. Reverà «Satrobory» : Hanangana ny «Zanak Iarivo miray» Nanao fanambarana ny Reverà Ndrianalijohn Andriamanampy, ny Alakamisy faha-21 Oktôbra teo fa hanangana ny fikambanana «Zanak Iarivo Miray», izay tsy hanavahana volon-koditra na firazanana fa andraisana ny mponina eto Iarivo rehetra, na avy aiza na avy aiza fiaviany. Nambarany koa fa hovàna ilay voambolana frantsay maneso hoe «Malgache» satria tsy misy ifandraisany amin i Madagascar f a h o «M a d a g a s c a r i e n» n a «Madagascarienne» no hapetraka asolo azy. Manao antso avo amin ny Kristianina rehetra tsy an-kanavaka ihany koa izy mba hahatsiaro tena hanohitra ny fitondrana ankehitriny. Marihana fa nivahiny nandritra ny fotoana naharitra tany Afrika ny tenany n o h o n y r e s a - p i v a v a h a n a «kibanguiste» izay tarihany eto amintsika. Ankolafy 3 : Analamahitsy no toerana nomen ny CUA «T s y a n t o n o n a a n t s i k a intsony ny eto Behor ir ika ka nangataka toerana malalaka kokoa tamin ny CUA isika mba ahazoana maneho hevitra», hoy Atoa Rakoto Andrianirina F e t i s o n. N y z a r i d a i n a n Ambohijatovo sy ny Lapan ny F a n a t a n j a h a n t e n a e t s y Mahamasina no heverin izy ireo ho ampiasaina amin izany anio Sabotsy. Tsy nomen ny fiadidiana ny CUA anefa ireo toerana ireo fa ny kianja maitso eny Analamahitsy no natolony m a l a l a k a h o a m p i a s a i n ny ankolafy 3. Hoy indrindra ny kaomisera Rabearisoa Alexandre hoe «misy toerana ahafahana maneho hevitra tokoa eto andrenivohitra ka notapahan'ny C U A fa n y k i a n j a m a i t s o e n y Analamahitsy no homena ny ankolafy 3». Araka ny vaovao voaray dia tsy nanaiky ny ho eny Analamahitsy ireto farany. Governemantan ny firaisam-pirenena : Tsy tokony soloina ireo efa ao M a n o l o a n a n y m e t y h a n a n g a n a n a n y g o v e r n e - mantan ny firaisam-pirenena ato ho ato, araka ny fandaharam-potoanan ny fitondrana t e t e z a m i t a, d i a n a n e h o n y heviny Atoa Raoldin Naivo, filoha nasiônalin ny antoko FAFI sy mpikambana ao amin ny CST, fa tsy tokony soloina intsony ny governemanta amin izao fotoana izao. Aminy dia tsotra ny fanazavana azy : «tsy misy antony tokony hanoloana ny ekipa efa nahomby». Notsindriany mafy fa tsy ny fanoloana ireo mpikambana no mahamaika amin izao fotoana izao fa ny fanatanterahana ireo tetiandron ny fifidianana mba hisian ny fankatoavana iraisampirenena. Anjaran izy ireo, hoy izy, no manao izay hahatongavana any amin ny Repoblika faha-4, fa aorian izay vao tokony hisy ny fanovana ny governemanta. A LA RECHERCHE DE L AME SŒUR Jeune femme de 22ans cherche homme entre 28 à 60 pour une relation sérieuse et plus.moi black avec un visage clair, cheveu ondulé, jolie femme, style décontracté e t c l a s s e. à v o s p o s t e s Contact : Charmante F26ans, 1m56, 50kg célibataire désire rencontrer H étranger plus de 30ans. Cont : ANNONCES DE JDM TERRAIN-MAISON Trano ahofa 7 pieces c o n f o r t a c c e s s i b l e vo i t u re t re s p ro c h e route digue Contact p r i x 300mille ariary EMPLOI-FORMATION J F 1 9 a n s, c h e rc h e e m p l o i, n i v e a u b a c Tel : Vos petites ANNONCES en direct par SMS to MAIL au

3 samedi 23 octobre 2010 Le Journal 3 International CHINE : FORTES INTEMPERIES Des vols annulés, des liaisons ferry suspendues, le sud-est de la Chine attend le typhon Megi qui a fait 36 morts aux Philippines et devrait arriver sur les côtes chinoises ce samedi 23 octobre dans la matinée personnes ont été évacuées et toute la région placée en état d alerte dont l alerte maximum dans les provinces de Fujian et de Guangdong. Des affichettes sont placardées dans toutes les résidences, sur toutes les maisons : «Fermez les portes et les fenêtres, le typhon arrive!». GUINEE : DES DOUTES SUR LES ELECTIONS I l s e r a «d i f f i c i l e» d'organiser le second tour de l'élection présidentielle g u i n é e n n e d i m a n c h e prochain comme prévu, a déclaré jeudi soir le nouveau président de la commission électorale, citant des retards «déplorables» dans l'organisation du scrutin. «Je dois s o u l i g n e r q u e l a d a t e d u 24 octobre sera difficile à tenir», a avoué Siaka Toumany Sangaré après une série de rencontres avec des responsables politiques à Conakry. NAPLES : DEDOMMAGEMENT Le chef du gouvernement italien Silvio Berlusconi a annoncé hier vendredi le déblocage de 14 millions d'euros pour dédommager la municipalité de Terzigno, p r è s d e N aples, o ù d e s affrontements opposent la police à des riverains h o s t i l e s à l ' u t i l i s a t i o n d'une décharge de déchets. «Nous espérons que la situation redeviendra normale d'ici 10 jour s», a ajouté M. Berlusconi, précisant que la décharge serait désormais gérée directement par la protection civile italienne, laquelle dépend du gouvernement. «Le gouvernement garantit la disponibilité des fonds nécessaires (...) pour un total de 14 millions d'euros en ce qui concerne Terzigno», a déclaré M. Berlusconi à la p re s s e, à l ' i s s u e d ' u n e réunion de crise avec les ministres concernés. GTT-France Un putsch en vue Selon un site d informations proche des autorités transitoires, un projet de coup d Etat contre Andry Rajoelina serait en préparation. La base arrière de ces «putschistes» serait la France notamment dans la partie méridionale où les cerveaux de l opération seraient en train de recruter des anciens militaires malgaches installés dans l Hexagone. Selon la même source, le mouvement GTT, proche de la mouvance de l ancien Chef de l Etat Marc Ravalomanana, serait derrière cette opération. Pour le moment, une telle information est difficile voire impossible à recouper. Néanmoins, dernièrement, des bruits de bottes deviennent de plus en plus persistants, certaines presses ayant relaté que des réunions sont organisées un peu partout et que des militaires notamment des hauts gradés, y seraient impliqués. L existence de ces complots a été officiellement confirmée, il y a quelques semaines, par le Directeur de la Communication de la Présidence de la HAT, Rolly Mercia, lors d une intervention sur la télévision Viva. Andry Rajoelina Aménagement de la capitale En marge de la cérémonie de présentation officielle de l opération «Tsena Mora», le Président de la HAT a promis une série de travaux à Antananarivo, pour rendre celle-ci digne de son statut de capitale de Madagascar. «La ville subira de grands changements et fera l'objet de grands réaménagements», a notamment annoncé Andry Rajoelina. Pour le moment, on ne connaît pas encore quels sont les projets qui devront être menés ni la source de financement. Néanmoins, l annonce est à mettre dans le cadre des promesses qu a faites ces derniers temps l actuel homme fort du pays notamment dans certaines villes de Régions (Mahajanga, Antsiranana, Morondava, Ambatondrazaka ou encore Maintirano). En outre, les autorités transitoires refusent de voir dans ces promesses un quelconque calcul politique en cette période où le pays va connaître deux grands scrutins majeurs, le référendum du 17 novembre et les communales du 20 décembre. noir Néanmoins, cette énième annonce de coup d Etat semble être différente des précédentes. L implication des éléments proches de Marc Ravalomanana serait avérée si on se fie à la même source. «L'on apprend ainsi de source auprès de l'un d'eux qui a été contacté que certains éléments caciques de l'ancien Président, regroupés au sein du mouvement GTT (un groupuscule activiste à la solde de Ravalomanana), procèdent actuellement à un recrutement massif d anciens militaires malgaches résidant en France, pour participer activement à cette opération, dont l'ultime objectif est en fait la destitution d Andry Rajoelina de la tête du pays», affirme le site. Mesures sévères Le site en question précise même que «le recrutement se fait surtout dans la partie sud de l'hexagone, à Toulouse et à Bordeaux ; mais apparemment, les recruteurs ont du mal à convaincre nos ex-militaires compatriotes, qui ne veulent visiblement pas être associés à des actes de mise à mort du pays. Raison pour laquelle les membres du GTT ont recours à des militaires étrangers, mais dont la physionomie du visage les ferait ressembler à des Malgaches, pour tenter de parvenir à leurs fins. Ces derniers seraient plus enthousiastes pour répondre à l'appel». Selon cette même source d informations, les autorités en charge de la sécurité nationale seraient déjà au courant de cette affaire et suivraient de près les faits et gestes des membres du GTT qui sont actuellement à Madagascar. «Quoi qu'il en soit, les autorités ne négligent pas ces informations ; et des mesures sévères seront prises à l encontre de ceux qui tenteraient de fomenter des troubles à l'approche des différentes échéances électorales, indique-t-on en haut lieu», précise encore la source. Dans tous les cas, au fur et à mesure qu avance la mise en œuvre de l accord politique d Ivato et des résolutions de la dernière conférence nationale, la vie politique malgache connaît une certaine effervescence. Ces bruits de bottes semblent à mettre dans le cadre général de cette montée de tensions sociopolitiques. Trois mouvances Autorisation refusée L a C o m m u n e u r b a i n e d Antananarivo a refusé la demande d autorisation déposée par les trois mouvances pour occuper le Palais des Sports de Mahamasina et le Jardin d Ambohijatovo pour y tenir des meetings politiques. En revanche, elle leur a accordé une autorisation pour le théâtre de verdure d Analamahitsy q u i s e t ro u v e à p rox i m i t é d Antsonjombe. Cette démarche marque un revirement dans la stratégie de l opposition au régime transitoire depuis les événements de lundi dernier. D ailleurs, ce refus est plus ou moins attendu et semble faire partie de la stratégie des Fetison Rakoto Andrianirina, Albert Zafy et autre Ange Andrianarisoa. D autant que les partisans des t ro i s m o u v a n c e s o n t d é j à annoncé qu ils réagiront si leur demande d autorisation n est pas satisfaite. Dans les prochains jours, on peut donc s attendre à une reprise des manifestations de rues sans autorisation. Cela pourrait entraîner une nouvelle montée de la tension politique, avec un risque réel d escalade. Billet «PLAN MARSHALL» Certes, le pays est en crise et les bailleurs de fonds ont fermé les robinets des financements extérieurs ; cela n empêche pas les autorités transitoires d annoncer des grands projets comparables au Plan Marshall de l après-guerre. On se souvient que Marc Ravalomanana avait agi de même en son temps mais il semble bien qu il ait échoué car, autrement, il serait encore au pouvoir. Les autorités actuelles en sont-elles conscientes? ANTIPIRATAGE : SOUTIEN DE RAJOELINA Avant-hier, une délégation d'artistes a été reçue hier par le Président de la HAT. Celui-ci leur a promis un plateau sur la chaîne de télévision nationale, aujourd hui à l'occasion du «Sabotsy mangina», une opération de sensibilisation des Malgaches contre le piratage des œuvres artistiques. Cette délégation a également rencontré la ministre de la Culture et du Patrimoine Mireille Rakotomalala pour débattre de la stratégie de lutte contre le piratage. Notons que les artistes ont décidé que durant la journée d aujourd hui, les différents médias devraient suspendre la diffusion de leurs œuvres. DIPLOMATIE : OUVERTURE VERS ISRAEL Lors de la Première République, Madagascar a entretenu des relations étroites avec l Etat d Israël. Mais pour des raisons idéologiques, la République marxo-socialiste de Didier Ratsiraka avait décidé de les suspendre. Il aura donc fallu attendre cette transition pour qu une reprise soit amorcée. Ainsi, lors du passage de l ambassadeur itinérant d Israël dans le pays, le ministre de la Santé, l e G é n é r a l P a s c a l J a c q u e s Rajaonarison, a annoncé que des échanges d'expériences entre les médecins spécialistes malgaches et leurs homologues israéliens vont se faire bientôt. EMISSAIRES ONUSIENS : FIN DE MISSION La mission d'évaluation de l'onu sous la conduite d e Jo a o H o n w a n a a q u i t t é hier Madagascar sans faire de déclaration. Lors de son séjour en terre malgache, elle a rencontré la plupart des forces politiques impliquées dans la crise et ne manquera pas de faire un rapport au Secrétariat général de l organisation.

4 Le Journal cyan magenta jaune noir 4 SAMEDI 23 OCTOBRE 2010 Société Totémisme (suite et fin) Contestation A. R. Radcliffe-Brown (Structure and Function in Primitive Society, 1952) voit dans le totémisme une classification. A partir de là, la question du totémisme a été revisitée par Claude Lévi-Strauss dans «La Pensée s a u v a g e» e t d a n s «L e Totémisme aujourd'hui» (1962) ; puis par Philippe Descola dans «Par-delà nature et culture» (2005). Claude Lévi-Strauss met en doute l'existence même du t o t é m i s m e c o m m e institution autonome et distincte ; et la dénonce comme une illusion des sociologues de la fin du XIXe siècle : «Le totémisme est d'abord la projection, hors de notre univers, et comme par un exorcisme, d'attitudes mentales incompatibles avec l'exigence de la discontinuité entre l'homme et la nature, que la pensée c hrétienne TSIKY MIARAKA AMIN I ORANGE tenait pour essentielle». P h i l i p p e D e s c o l a, à l ' i n v e r s e, p r é s e n t e l e totémisme comme l un des 4 modes universels d'identification («ontologies») dont les hommes procèdent à l'égard des autres existants non humains, animaux ou végétaux. Ce mode d'identification se fonde sur 2 critères : l'«intériorité» et la «physicalité» - rappelant la traditionnelle dualité de l'âme et du corps - chaque critère donnant lieu, soit à une fusion, soit à une discontinuité entre existants humains et non humains. Dans le totémisme, il y a fusion des intériorités et des physicalités, faisant que chez les Aborigènes, par exemple, c'est un ancêtre hybride humain/non humain - homme/kangourou - venu du «Temps des rêves», qui fournira comme descendants terrestres : un homme et un kangourou, ce dernier étant devenu du fait même son «alter ego». Les 3 autres ontologies sont l'animisme, le naturalisme et l'analogisme. Rafiringa Le nationaliste C e t t e «r é s i s t a n c e l i n g u i s t i q u e» d u F r è r e Raphaël devait l'impliquer dans l'affaire de la VVS en 1915, en même temps que deux autres personnalités religieuses, le P. Venance Manifatra et le F. Julien. Il semble que, pour rallier les catholiques à leur cause, les meneurs du mouvement se servirent de ces trois personnalités pour cautionner leur action. Tous trois furent arrêtés, subirent cinquantesix jours de détention, mais furent déclarés innocents lors du jugement rendu le 18 février 1916, lequel se solda par un non-lieu et la mise en liberté immédiate des prévenus. Tous trois avaient été les victimes de fausses accusati ons. La sentence, prononcée à leur sujet, déclare que «attendu qu'il ressort nettement des déclarations des inculpés et des témoins que les noms de ces religieux ont été mis en avant par certains affiliés de la société dans un but de propagande et aussi pour i n s p i r e r c o n f i a n c e a u x Devoir de mémoire indigènes appartenant à la religion catholique qui étaient sollicités de faire partie de la dite association...». Le procès avait usé le Frère Raphaël, physiquement et moralement. Ses supérieurs l'envoyèrent, au début de 1917, se reposer à Fianarantsoa, où les Frères des Ecoles Chrétiennes tenaient une école depuis Il consacra les deux dernières années de sa vie à la traduction d'ouvrages religieux et à étudier la formation des religieux malgaches. Outre de réels talents d'orateur, le Frère Rafiringa av a i t l e d o n d ' é c r i re l a l a n g u e m a l g a c h e a v e c é l é g a n c e. A p l u s i e u r s re p r i s e s, i l e nvoy a d e s articles aux revues de la Mission catholique «Iraka» et «Ny Tsara Fanahy» ; et l'on doit également à sa plume divers opuscules qui traitent des problèmes d e l ' é d u c a t i o n e t d e l a famille : Ilay Ingahy Mianaka, Ramanantsoa sy ny zanany, Ny Fanambadiana Kristianina

5 cyan magenta jaune noir samedi 23 octobre 2010 Le Journal 5

6 6 Le Journal SAMEDI 23 OCTOBRE 2010 METEO SERVICES Températures Ambanja 24/36 Ambatolampy 14/28 Ambatondrazaka 17/30 Ambositra 18/29 Antalaha 22/29 Antananarivo 16/29 Antsirabe 14/28 Antsiranana 22/32 Brickaville 21/29 Fenerive est 23/29 Fianarantsoa 18/30 Foulpointe 22/29 Ilakaka 21/32 Mahajanga 24/34 Manakara 21/29 Manjakandriana 16/29 Mantasoa 15/29 Moramanga 17/30 Morondava 21/33 Nosy be 22/33 Sainte marie 23/30 Sakaraha 20/32 Sambava 22/29 Taolagnaro 22/28 Toamasina 22/30 Toliara 21/32 Vatomandry 21/29 Cours de devises uro=2786,40 Ariary (-0,16%) Dollar=1995,72 Ariary (+0,42%) HUISSIERS - Maître RAKOTOBEARINOELY Clovis Lot VR 55 bis Mahazoarivo Tél : Maître RAMBELOSON Jean Fortunat 24 bis, rue Andriandahifotsy, Mandrosoa Tel : PHARMACIE DE GARDE Semaine du 16/10 au 23/10/10 - PHARMACIE FANOMEZANTSOA : Ambondrona PHARMACIE AMPANDRANA : Ampandrana PHARMACIE AMBODIVONA : Ambodivona PHARMACIE MAMY: 67Ha Nord Est / Dr RANAIVOSON Eric Lot ICA 1 Antsahasoa - Ankaraobato (Face Commune Ankaroabato - Tanjombato) Tél : Dr RAKOTONJANAHARY née RAZANARIMANANA Florence Odile Lot II J 177 HZ A Ivandry (Route vers FJKM Ivandry Firaisana) Tél : Dr RAMAHENINARISON Julien Jacques Lot II N 65 ter Analamahitsy Tél : Dr RANDRIAMIARISOA Ny Aina Andrianantenaina Lot 455 Cité Ampefiloha Tél : Numeros vert JIRAMA Telma fixe : 3547 Orange : Zain : MOUVEMENT DES AVIONS Vo l d u S a m e d i 2 3 / 1 0 / Vol origine départ destination arrivée MD 019 GUANZHOU 13:55 BANGKOK 15:55 MD 019 BANGKOK 17:30 REUNION/ST-DENIS 22:25 MD 019 REUNION/ST-DENIS 23:15 ANTANANARIVO 23:40 MD 050 ANTANANARIVO 23:55 PARIS-CDG 10:05 MD 124 ANTANANARIVO 10:35 JOHANNESBOURG 13:00 MD 125 JOHANNESBOURG 14:10 ANTANANARIVO 18:00 MD 149 MAHAJANGA 15:05 DZAOUDZI 16:00 MD 149 DZAOUDZI 16:50 ANTANANARIVO 18:30 MD 152 ANTANANARIVO 06:20 ANTANANARIVO 07:35 MD 152 ANTANANARIVO 08:25 MORONI-HAHAYA 09:10 MD 152 MORONI-HAHAYA 09:55 ANTANANARIVO 11:20 MD 186 ANTANANARIVO 13:25 MAURICE 16:05 MD 187 MAURICE 16:55 ANTANANARIVO 17:40 MD 190 ANTANANARIVO 18:50 REUNION/ST-DENIS 21:15 MD 191 REUNION/ST-DENIS 22:30 ANTANANARIVO 23:05 MD 316 ANTANANARIVO 05:45 ANTSIRANANA 07:05 MD 320 ANTANANARIVO 06:00 NOSY-BE 07:30 MD 321 NOSY-BE 07:55 ANTANANARIVO 09:25 MD 324 ANTANANARIVO 11:10 NOSY-BE 12:40 MD 326 ANTANANARIVO 19:10 NOSY-BE 20:40 MD 327 NOSY-BE 21:15 ANTANANARIVO 22:45 MD 329 NOSY-BE 13:15 MAHAJANGA 14:15 MD 335 ANTSIRANANA 07:30 MAHAJANGA 08:25 MD 400 ANTANANARIVO 13:20 ANTALAHA 14:40 MD 401 ANTALAHA 15:05 ANTANANARIVO 16:25 MD 535 ANTANANARIVO 14:55 SAINTE-MARIE 15:50 MD 535 SAINTE-MARIE 16:25 TOAMASINA 16:55 MD 535 TOAMASINA 17:30 ANTANANARIVO 18:15 MD 702 ANTANANARIVO 10:15 MORONDAVA 11:15 MD 702 MORONDAVA 11:40 ANTANANARIVO 12:40 MD 712 ANTANANARIVO 06:10 TOLIARA 07:40 MD 713 TOLIARA 08:15 ANTANANARIVO 09:45 MD 716 ANTANANARIVO 19:00 TOLAGNARO 20:15 MD 717 TOLIARA 21:55 ANTANANARIVO 23:00 MD 733 TOLAGNARO 20:40 TOLIARA 21:30 MD 821 MAHAJANGA 08:50 ANTANANARIVO 09:35 Nos contacts à Antananarivo : Réservations de places : Réservations FRET : Welcome Service IVATO : MOTS FLECHES N SOL. MOTS FLECHES N Directeur de la publication Léon Razafitrimo Rédaction Tél: Société éditrice : NPM S.A Administrateur général Mirasoa Razanamasy Régie publicité : Ultima Media Jao Rabemananjara Imprimerie : Ultima Media dépôt légal : 0188/2010 Contact pub : / / / Tirage : ex

7 cyan magenta jaune noir samedi 23 octobre 2010 Le Journal 7 Orange Madagascar Amélioration des soins L e s t e c h n o l o g i e s d e l ' i n f o r m a t i o n e t d e l a communication se révèlent aujourd hui être un outil i n c o n t o u r n a b l e d e s professionnels de la santé : elles optimisent l exécution des tâches, réduisent les coûts et améliorent les relations entre médecins et patients. Consciente de ce rôle central joué par les technologies, Orange Madagascar, dans le cadre de son projet «Responsabilité Sociale d Entreprise» (RSE), s engage à continuer le développement de l Internet, de la visiophonie, d e l a transmission de données e t d e l a t é l é m é d e c i n e ; e t a m é l i o r e r a i n s i l e s conditions de travail du secteur de la santé. Des visioconférences, avec qualité haute-définition, e n t re A n t a n a n a r i vo e t Paris, sont rendues possibles par Orange Madagascar. Grâce à cela, les patients malgaches bénéficieront du renforcement des échanges entre les équipes des médecins étrangers et malgaches, é c h a n g e s e n t r a n t d a n s le cadre du programme international RAFT-UNFM de formation continue à distance des professionnels de la santé. FAO : Appui à la lutte antiacridienne jusqu en 2012 Fin juillet 2010, l organe des Nations Unies pour l Alimentation et l Agriculture (FAO) annonçait que 52 communes malgaches s e r a i e n t e n s i t u a t i o n d insécurité alimentaire d ici la fin de l année, dont 10 communes, totalisant p e r s o n n e s, considérées comme très s é v è re m e n t a f f e c t é e s. La FAO a lancé un appel d urgence, suite auquel elle a reçu un projet dénommé «Central Emergency Response Fund» (CERF) du Fonds des Nations Unies, intitulé OSRO- MAG-003-CHA «Emergency Assistance to Control Migratory Locust Populations in Madagascar», a v e c u n m o n t a n t d e USD. C'est un projet d'urgence qui dure 3 mois, du 1er septembre au 30 novembre Ce projet consiste, d une part, à sauvegarder la sécurité alimentaire des communautés rurales touchées par la recrudescence acridienne, p a r l a p r o t e c t i o n d e s cultures et pâturages et, d autre part, à contrôler l'impact des opérations de lutte sur la santé humaine et l'environnement. La FAO a également reçu un projet TCP d'urgence de f o n d s i n t i t u l é «L u t t e d'urgence contre le criquet migrateur à Madagascar», avec un montant de U S D e t d u n e d u r é e d e 24 mois, c est-à-dire de s e p t e m b re àaout IRD : Colloque international sur l internationalisation de l environnement Un colloque international s e t i e n d r a l e s 2 5 e t 2 6 octobre 2010 sur le site de l Ecole supérieure des Sciences agronomiques (campus d Ambohitsaina, Université d Antananarivo) p o u r t r a i t e r d u t h è m e «Internationalisation de l environnement : normes, a c t e u r s, t e r r i t o i r e s à M a d a g a s c a r». C e s t l e second et dernier volet du programme «Géopolitique e t e nv i ro n n e m e n t», q u i s e s t r é u n i à l I n s t i t u t d e R e c h e r c h e p o u r l e Développement ( IRD) à Orléans en décembre D e s c h e rc h e u r s e t d e s a c t e u r s d e l a p o l i t i q u e environnementale malgache rendront compte des diverses situations d où émergent leurs questionnements. Le processus d internationalisation de l environnement se traduit en effet sur le terrain par une recomposition des relations entre pouvoir et territoire. Les interventions traiteront plus spécifiquement des interfaces entre nature, société et politique publique. Trois types de regards ont été retenus : celui des chercheurs, celui des acteurs institutionnels et celui de la société civile. Lutte contre l importation sauvage Des grandes lignes à adopter L e s i m p o r t a t i o n s sauvages, fruits de passedroits abusifs qui déstabilisent l économie du pays depuis d e s d é c e n n i e s, s e ro n t désormais la cible de la H a u t e A u t o r i t é d e l a Transition. Les grandes lignes de cette lutte contre les importations sauvages, frauduleuses et illégales seront adoptées durant une séance de travail, mardi 26 octobre prochain, entre la Présidence de la Haute Autorité de la Transition, le ministère des Finances et du Budget, celui de l Economie et de l Industrie, celui de la Santé publique, ainsi que la Direction générale des Douanes.Une rencontre a d a i l l e u r s e u l i e u c e t t e semaine au Palais d Etat d Ambohitsorohitra entre l e P r é s i d e n t d e l a H AT, Andry Nirina Rajoelina et les principaux industriels du pays. Il a été convenu, à l issue de cette rencontre qu un combat ferme sera conjointement et immédiatement mené, par l Etat et les industriels nationaux, contre les importations sauvages, frauduleuses et illégales. Ainsi, une séance de travail se tiendra mardi 26 octobre 2010 prochain dans l aprèsm i d i a u P a l a i s d E t a t d Ambohitsorohitra pour adopter les grandes lignes de cette lutte. Micro-finance Soutien de l économie Les institutions de microfinance à Madagascar ont résisté à la crise politique q u i f a i t s o u f f r i r l e p ay s depuis décembre 2008, a-t-on appris hier vendredi auprès de la Coordination nationale de Micro-finance ( C N M F ) à M a d a g a s c a r. Le coordonnateur national d e l a m i c r o - f i n a n c e à Madagascar, Blaise Francis Rajoelina, a indiqué que l e t a u x d e p é n é t r a t i o n des Malgaches auprès des institution de micro-finances atteint 18% actuellement contre 10% en 2008, alors q u e l a C N M F a p r é v u d atteindre 11% en Actuellement, la CNMF enregistre 671 points de s e r v i c e s p o u r p l u s d e c l i e n t s d e s i n s t i t u t i o n s d e m i c ro - finance. L encours de crédit e n r e g i s t r é e s t d e p l u s 160,5 milliards ariary, alors que l encours d épargne atteint plus de 98,4 milliards ariary. Le secteur soutient les activités économiques informelles parce que plus d e 9 0 % d e s e m p l o i s à Madagascar relèvent des a c t i v i t é s é c o n o m i q u e s i n f o r m e l l e s r u r a l e s e t urbaines. «Ce soutien des institutions de micro-finances p e r m e t a u x M a l g a c h e s d augmenter leurs revenus», a indiqué le coordonnateur de la CNMF. Vente des blocs pétroliers Après le nouveau code pétrolier L organe régulateur de l'extraction de pétrole à Madagascar, en l occurrence l Omnis, a relancé l'exploration dans l'ile en demandant aux entreprises de travailler ensemble pour le retraitement des données géologiques compilées dans les années «La stratégie est de faire une synergie entre les sociétés d'exploration d'uranium pour créer plus de valeur s», a d é c l a r é J o e l i Va l é r i e n Lalaharisaina, Directeur g é n é r a l d e l O m n i s. L e ministre des Mines et des H y d ro c a r b u re s, M a my Ratovomalala, a déclaré le mois dernier qu'il n'avait p a s d é l i v r é d e p e r m i s d exploration depuis le mois de septembre dernier et que le ministère accélère l'inspection des investisseurs. Ce dernier pourrait en émettre quelques-uns avant la fin de l'année, a-t-il annoncé. Concernant l appel d offres pour les blocs pétroliers, le Directeur général de l Omnis a déclaré qu il faudra d abord réviser le code pétrolier qui passera au Parlement avant de procéder à l appel d offres.

8 Le Journal cyan magenta jaune noir 8 SAMEDI 23 OCTOBRE 2010

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

JEAN-MARC CHÂTAIGNIER Défenseur de Joaquim Chissano

JEAN-MARC CHÂTAIGNIER Défenseur de Joaquim Chissano cyan magenta jaune noir PROGRAMME P.7 QUOTIDIEN GRATUIT D INFORMATION N 0103 DU Vendredi 16 Juillet 2010 L accès sans peine à l information OIF SOATOAVINA TRAFIC Soutien de la médiation internationale

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

N 015 DU 27 mars 2010 ceni Neutralité introuvable La CENI est chargée d une difficile

N 015 DU 27 mars 2010 ceni Neutralité introuvable La CENI est chargée d une difficile QUOTIDIEN D INFORMATION GRATUIT N 015 DU 27 mars 2010 ceni Neutralité introuvable La CENI est chargée d une difficile L accès sans peine à l information mission, celle de garantir la transparence BUSINESS

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent cyan magenta jaune noir PROGRAMME P.7 RENCONTRE DE VONTOVORONA POSSIBLE ECHEC Les partis et associations de GRATUIT QUOTIDIEN D INFORMATION N 0137 DU Mercredi 25 Août 2010 FIARAHAMONINA HADIHADIANA NY

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

d une solution malgachomalgache

d une solution malgachomalgache cyan magenta jaune noir PROGRAMME P.7 ECONOMIE TRANSITOIRE FANANAN-TANY DECHETS URBAINS Interventionnisme critiqué BIRAO FOTOTRA A VALORISER L inaccessibilité aux intrants notamment aux engrais induit

Plus en détail

GRATUIT. L industrie illégale de bois toute implication dans le trafic

GRATUIT. L industrie illégale de bois toute implication dans le trafic cyan magenta jaune noir BOIS DE ROSE DEMENTI D ANDRY RAJOELINA Le Président de la HAT a démenti GRATUIT QUOTIDIEN D INFORMATION N 0206 DU lundi 15 Novembre 2010 L accès sans peine à l information BOIS

Plus en détail

RESOLUTION 24/16 DU CONSEIL DES DROITS DE L HOMME SUR «LE ROLE DE LA PREVENTION DANS LA PROMOTION ET PROTECTION DES DROITS DE L HOMME»

RESOLUTION 24/16 DU CONSEIL DES DROITS DE L HOMME SUR «LE ROLE DE LA PREVENTION DANS LA PROMOTION ET PROTECTION DES DROITS DE L HOMME» RESOLUTION 24/16 DU CONSEIL DES DROITS DE L HOMME SUR «LE ROLE DE LA PREVENTION DANS LA PROMOTION ET PROTECTION DES DROITS DE L HOMME» En réponse aux questions évoquées, Madagascar a adopté des mesures

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

La Cour de Cassation contraint une direction à payer une expertise CHSCT annulée : retour sur les conditions de démarrage

La Cour de Cassation contraint une direction à payer une expertise CHSCT annulée : retour sur les conditions de démarrage La Cour de Cassation contraint une direction à payer une expertise CHSCT annulée : retour sur les conditions de démarrage Source: www.miroirsocial.com Le 15 mai dernier, la Cour de Cassation a rendu un

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

TITRE PREMIER DES GENERALITES TITRE II DE LA CLASSIFICATION DES PROJETS. CHAPITRE PREMIER Les catégories de réseaux

TITRE PREMIER DES GENERALITES TITRE II DE LA CLASSIFICATION DES PROJETS. CHAPITRE PREMIER Les catégories de réseaux Loi n 98-026 du 20 janvier 1999 portant refonte de la Charte routière TITRE PREMIER DES GENERALITES Article premier - La présente loi constitue la charte Routière à Madagascar. Elle définit les modalités

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

Délibération n 2011-61 du 7 mars 2011

Délibération n 2011-61 du 7 mars 2011 Délibération n 2011-61 du 7 mars 2011 Sexe - Emploi secteur public Recommandation La réclamante, agent de brigade municipale n a pu conserver son poste au sein de la brigade canine au motif de ses faibles

Plus en détail

CONSEIL DES DROITS DE L HOMME. Examen Périodique Universel (EPU) 20 ème session. (Octobre 2014) MADAGASCAR. Soumission conjointe de :

CONSEIL DES DROITS DE L HOMME. Examen Périodique Universel (EPU) 20 ème session. (Octobre 2014) MADAGASCAR. Soumission conjointe de : MIAMSI Mouvement International Mouvement International Mouvement Catholique Des Milieux Sociaux Indépendants des Intellectuels catholiques Caritatif International CONSEIL DES DROITS DE L HOMME Examen Périodique

Plus en détail

Dans une liberté plus grande : développement, sécurité et respect des droits de l homme pour tous

Dans une liberté plus grande : développement, sécurité et respect des droits de l homme pour tous Nations Unies A/59/2005/Add.1 Assemblée générale Distr. générale 23 mai 2005 Français Original: anglais Cinquante-neuvième session Points 45 et 55 de l ordre du jour Application et suivi intégrés et coordonnés

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

Conseil d administration du Programme des Nations Unies pour le développement et du Fonds des Nations Unies pour la population

Conseil d administration du Programme des Nations Unies pour le développement et du Fonds des Nations Unies pour la population Nations Unies DP/2005/10 Conseil d administration du Programme des Nations Unies pour le développement et du Fonds des Nations Unies pour la population Distr. générale 25 janvier 2005 Français Original:

Plus en détail

PROFIL DE POSTE INTITULE DE LA MISSION : COORDINATEUR(TRICE) SUD EST MADAGASCAR I. CONTEXTE CONTEXTE GENERAL :

PROFIL DE POSTE INTITULE DE LA MISSION : COORDINATEUR(TRICE) SUD EST MADAGASCAR I. CONTEXTE CONTEXTE GENERAL : PROFIL DE POSTE INTITULE DE LA MISSION : I. CONTEXTE CONTEXTE GENERAL : COORDINATEUR(TRICE) SUD EST MADAGASCAR Asmae est une ONG de solidarité internationale française spécialisée dans le développement

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

CAHIER DES CHARGES APPEL D'OFFRES OUTIL ONLINE DE VEILLE MEDIA, ANALYSE STATISTIQUE ET REDIFFUSION DE L INFORMATION

CAHIER DES CHARGES APPEL D'OFFRES OUTIL ONLINE DE VEILLE MEDIA, ANALYSE STATISTIQUE ET REDIFFUSION DE L INFORMATION CAHIER DES CHARGES APPEL D'OFFRES OUTIL ONLINE DE VEILLE MEDIA, ANALYSE STATISTIQUE ET REDIFFUSION DE L INFORMATION SOMMAIRE 1. Contexte 2. Objet de l'appel d'offres 3. Description de la prestation 4.

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

VI. DOCUMENT PORTANT «PRINCIPES DIRECTEURS DEVANT GUIDER L ENVOI D UNE MISSION D OBSERVATION D ÉLECTIONS» (Marrakech, décembre 1996)

VI. DOCUMENT PORTANT «PRINCIPES DIRECTEURS DEVANT GUIDER L ENVOI D UNE MISSION D OBSERVATION D ÉLECTIONS» (Marrakech, décembre 1996) VI. DOCUMENT PORTANT «PRINCIPES DIRECTEURS DEVANT GUIDER L ENVOI D UNE MISSION D OBSERVATION D ÉLECTIONS» (Marrakech, décembre 1996) Préambule Les chefs d État et de Gouvernement, réunis lors de leur sixième

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

REPUBLIQUE TUNISIENNE ************************** Ministère de l Environnement et de Développement Durable *******************

REPUBLIQUE TUNISIENNE ************************** Ministère de l Environnement et de Développement Durable ******************* REPUBLIQUE TUNISIENNE ************************** Ministère de l Environnement et de Développement Durable ******************* STRATEGIE NATIONALE EN MATIERE D EDUCATION POUR LE DEVELOPPEMENT DURABLE **************************

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

GRATUIT SERASERA. D ANDEKALEKA Selon le communiqué final, le sommet. Mivonona amin izany ny. masoivoho amerikanina

GRATUIT SERASERA. D ANDEKALEKA Selon le communiqué final, le sommet. Mivonona amin izany ny. masoivoho amerikanina cyan magenta jaune noir PROGRAMME P.7 GRATUIT QUOTIDIEN D INFORMATION N 0132 DU Jeudi 19 Août 2010 L accès sans peine à l information SADC SERASERA CENTRALE HYDROELECTRIQUE SOUTIEN AU PROCESSUS MALGACHO-MALGACHE

Plus en détail

L encadrement des sondages et l élection présidentielle (dissert.)

L encadrement des sondages et l élection présidentielle (dissert.) L encadrement des sondages et l élection présidentielle (dissert.) Table des matières Table des matières... 2 Introduction... 3 I La loi du 19 Juillet 1977 : une réglementation originelle mise en cause...

Plus en détail

Dossier de Presse. Prix de la Coopération Internationale Sensibilisation du Public

Dossier de Presse. Prix de la Coopération Internationale Sensibilisation du Public Dossier de Presse Prix de la Coopération Internationale Sensibilisation du Public HCCI 20 Fevrier 2007 1. Une approche : valoriser les ressources humaines locales 2. Une conviction : l accès à des soins

Plus en détail

Campagne Globale pour la Réforme Agraire RÉSEAU D URGENCE 0911AMDG 22.07.09

Campagne Globale pour la Réforme Agraire RÉSEAU D URGENCE 0911AMDG 22.07.09 La Vía Campesina International Operative Secretariat Jalan Mampang Prapatan XIV No 5 Jakarta Selatan 12790, Jakarta - Indonésie Tel +62 21 7991890 Fax +62 21 7993426 viacampesina@viacampesina.org Contact

Plus en détail

Décision du Défenseur des droits MLD-2015-170. Vu la loi organique n 2011-333 du 29 mars 2011 relative au Défenseur des droits ;

Décision du Défenseur des droits MLD-2015-170. Vu la loi organique n 2011-333 du 29 mars 2011 relative au Défenseur des droits ; Paris, le 2 juillet 2015 Décision du Défenseur des droits MLD-2015-170 Le Défenseur des droits, Vu l article 71-1 de la Constitution du 4 octobre 1958 ; Vu la loi organique n 2011-333 du 29 mars 2011 relative

Plus en détail

Avant projet de loi sur l enseignement obligatoire février 2010 Questions réponses Relations école famille

Avant projet de loi sur l enseignement obligatoire février 2010 Questions réponses Relations école famille L actuelle loi scolaire prévoit que l école «seconde» la famille en matière d éducation. L avant-projet lui donne un rôle «complémentaire» à celui des parents en matière d éducation. L école doit en effet

Plus en détail

Loi portant réforme de l hôpital et relative aux patients, à la santé et aux territoires

Loi portant réforme de l hôpital et relative aux patients, à la santé et aux territoires n 95.09 PB/GM Loi portant réforme de l hôpital et relative aux patients, à la santé et aux territoires Après cinq mois d intenses débats parlementaires, la loi du 21 juillet 2009 portant réforme de l hôpital

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

Elections parlementaires en Ukraine

Elections parlementaires en Ukraine Elections parlementaires en Ukraine Session d information sur les élections parlementaires en Ukraine Compte-rendu 28 août 2012 Centre Thénard Intervenants - Bernard Owen, Secrétaire Général du Centre

Plus en détail

PROTOCOLE SOMMAIRE 20 AVRIL 2012 I - DÉVELOPPER DES RÉSEAUX ET DES RELAIS PAGE 071

PROTOCOLE SOMMAIRE 20 AVRIL 2012 I - DÉVELOPPER DES RÉSEAUX ET DES RELAIS PAGE 071 PROTOCOLE ENTRE LE MINISTÈRE DE LA DÉFENSE ET DES ANCIENS COMBATTANTS ET LE MINISTÈRE DE L ENSEIGNEMENT SUPÉRIEUR ET DE LA RECHERCHE POUR LE DÉVELOPPEMENT ET LA PROMOTION DE L ESPRIT DE DÉFENSE 20 AVRIL

Plus en détail

DOSSIER DE PRESSE PLAN DE LUTTE CONTRE LES FRAUDES AU DÉTACHEMENT DE SALARIÉS EN FRANCE

DOSSIER DE PRESSE PLAN DE LUTTE CONTRE LES FRAUDES AU DÉTACHEMENT DE SALARIÉS EN FRANCE PREMIER MINISTRE DOSSIER DE PRESSE PLAN DE LUTTE CONTRE LES FRAUDES AU DÉTACHEMENT DE SALARIÉS EN FRANCE Commission nationale de lutte contre le travail illégal du 12 février 2015 Dossier de presse :

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

Mise en place du Comité Chine de la Commission nationale de la coopération décentralisée

Mise en place du Comité Chine de la Commission nationale de la coopération décentralisée MINISTÈRE DES AFFAIRES ÉTRANGÈRES COMMISSION NATIONALE DE LA COOPÉRATION DÉCENTRALISÉE Paris, le 22 mars 2007 Le Secrétaire Mise en place du Comité Chine de la Commission nationale de la coopération décentralisée

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

ANNEXE: Questions relatives aux pratiques conseillées susceptibles de promouvoir et de protéger le droit à la liberté de réunion et d association pacifiques Nous vous saurions gré de bien vouloir répondre

Plus en détail

PROJET DE LOI. de finances rectificative pour 2011. (Texte définitif)

PROJET DE LOI. de finances rectificative pour 2011. (Texte définitif) PROJET DE LOI adopté le 8 septembre 2011 N 193 SÉNAT DEUXIÈME SESSION EXTRAORDINAIRE DE 2010-2011 PROJET DE LOI de finances rectificative pour 2011. (Texte définitif) Le Sénat a adopté sans modification,

Plus en détail

ASSEMBLÉE NATIONALE PROJET DE LOI

ASSEMBLÉE NATIONALE PROJET DE LOI TEXTE ADOPTÉ n 727 «Petite loi» ASSEMBLÉE NATIONALE CONSTITUTION DU 4 OCTOBRE 1958 TREIZIÈME LÉGISLATURE DEUXIÈME SESSION EXTRAORDINAIRE DE 2010-2011 7 septembre 2011 PROJET DE LOI de finances rectificative

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

Thème 1 La Défense fait-elle partie des «savoirs fondamentaux»?

Thème 1 La Défense fait-elle partie des «savoirs fondamentaux»? Thème 1 La Défense fait-elle partie des «savoirs fondamentaux»? Atelier A : Enseignement de défense et valeurs de la République : quels acteurs?/ La formation du citoyen : du service national à l enseignement

Plus en détail

LA COLLECTIVITE TERRITORIALE DE MARTINIQUE : QUESTIONS ET REPONSES PAR. Emmanuel JOS Professeur émérite de droit public

LA COLLECTIVITE TERRITORIALE DE MARTINIQUE : QUESTIONS ET REPONSES PAR. Emmanuel JOS Professeur émérite de droit public LA COLLECTIVITE TERRITORIALE DE MARTINIQUE : QUESTIONS ET REPONSES PAR Emmanuel JOS Professeur émérite de droit public La création de la Collectivité Territoriale de Martinique pouvait-elle se faire sans

Plus en détail

N 3116 ASSEMBLÉE NATIONALE LETTRE RECTIFICATIVE

N 3116 ASSEMBLÉE NATIONALE LETTRE RECTIFICATIVE N 3116 ASSEMBLÉE NATIONALE CONSTITUTION DU 4 OCTOBRE 1958 TREIZIÈME LÉGISLATURE Enregistré à la Présidence de l Assemblée nationale le 26 janvier 2011. LETTRE RECTIFICATIVE au projet de loi (n 2494) relatif

Plus en détail

DEVIS SPÉCIFIQUE 1 INTRODUCTION ET CONTEXTE

DEVIS SPÉCIFIQUE 1 INTRODUCTION ET CONTEXTE DEVIS SPÉCIFIQUE 1 INTRODUCTION ET CONTEXTE La MRC des Laurentides est située au cœur de la région du même nom. Elle s étale sur 2 500 km 2 et compte 20 villes et municipalités locales. Sa population de

Plus en détail

Budget UE : Paris compensera la baisse de l'aide aux plus démunis «à l'euro près»

Budget UE : Paris compensera la baisse de l'aide aux plus démunis «à l'euro près» lundi 11 février 2013 395 mots Économie Budget UE : Paris compensera la baisse de l'aide aux plus démunis «à l'euro près» Le ministre chargé de l'agroalimentaire Guillaume Garot a assuré samedi que l'etat

Plus en détail

ORDONNANCE N 62-117 DU 1 er OCTOBRE 1962 relative au régime des cultes (J.O. du 26.12.62, p. 2504 ; Errata : J.O. n 277 du 09.03.63, p.

ORDONNANCE N 62-117 DU 1 er OCTOBRE 1962 relative au régime des cultes (J.O. du 26.12.62, p. 2504 ; Errata : J.O. n 277 du 09.03.63, p. ORDONNANCE N 62-117 DU 1 er OCTOBRE 1962 relative au régime des cultes (J.O. du 26.12.62, p. 2504 ; Errata : J.O. n 277 du 09.03.63, p.635) TITRE PREMIER DES PRINCIPES Article premier - L Etat garantit

Plus en détail

INFOS JURIDIQUES. Flash sur le Droit du Travail. Publication mensuelle éditée par la CSL EDITION SPÉCIALE Février 2011

INFOS JURIDIQUES. Flash sur le Droit du Travail. Publication mensuelle éditée par la CSL EDITION SPÉCIALE Février 2011 INFOS JURIDIQUES Flash sur le Droit du Travail Publication mensuelle éditée par la CSL EDITION SPÉCIALE Février 2011 La notion de cadre supérieur en droit luxembourgeois La présente publication a pour

Plus en détail

Priorité aux élections

Priorité aux élections cyan magenta jaune noir QUOTIDIEN D INFORMATION GRATUIT N 063 DU Samedi 29 Mai 2010 nouvelle constitution Consensus discutable Nommés hier, les membres du Comité L accès sans peine à l information KOLIKOLY

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

REPOBLIKAN I MADAGASIKARA Fitiavana Tanindrazana Fandrosoana

REPOBLIKAN I MADAGASIKARA Fitiavana Tanindrazana Fandrosoana MINISTERE DE LA FONCTION PUBLIQUE, DU TRAVAIL ET DES LOIS SOCIALES REPOBLIKAN I MADAGASIKARA Fitiavana Tanindrazana Fandrosoana MINISTERE DE LA JUSTICE FIN N 6017 du 11/05/2015 CF N 9817 du 13/05/2015

Plus en détail

Docteur Michel Legmann

Docteur Michel Legmann 1 Docteur Michel Legmann Président Mme Nora BERRA Secrétaire d Etat aux Aînés 55 rue Saint Dominique 75007 PARIS Nos références à rappeler sur tout échange de correspondance ML/FJ/np/Exercice professionnel

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

Synthèse de l actualité - 25 mai 2009

Synthèse de l actualité - 25 mai 2009 Service des droits des femmes et de l égalité Synthèse de l actualité - 25 mai 2009 Action gouvernementale 10 000 femmes bientôt interrogées sur l égalité salariale et professionnelle Lors de son intervention

Plus en détail

Une rencontre Nationale des cadres du Secteur du Commerce, sous la présidence de Monsieur le Ministre. Alger, le 16 septembre 2014

Une rencontre Nationale des cadres du Secteur du Commerce, sous la présidence de Monsieur le Ministre. Alger, le 16 septembre 2014 Une rencontre Nationale des cadres du Secteur du Commerce, sous la présidence de Monsieur le Ministre. Alger, le 16 septembre 2014 SOURCE EL MOUDJAHID 17-09-2014 Rencontre nationale des cadres du secteur

Plus en détail

Commentaire. Décision n 2011-224 QPC du 24 février 2012. Coordination pour la sauvegarde du bois de Boulogne

Commentaire. Décision n 2011-224 QPC du 24 février 2012. Coordination pour la sauvegarde du bois de Boulogne Commentaire Décision n 2011-224 QPC du 24 février 2012 Coordination pour la sauvegarde du bois de Boulogne (Validation législative de permis de construire) La Conseil d État a renvoyé au Conseil constitutionnel

Plus en détail

LE COMMISSARIAT AUX APPORTS

LE COMMISSARIAT AUX APPORTS LE COMMISSARIAT AUX APPORTS Institution juridique du commissariat aux apports Le commissariat aux apports est la mission en vertu de laquelle un professionnel s exprime sur la valeur attribuée à un apport

Plus en détail

Décision du Défenseur des droits n MLD/2012-50

Décision du Défenseur des droits n MLD/2012-50 Paris, le Décision du Défenseur des droits n MLD/2012-50 Le Défenseur des droits, Vu l article 71-1 de la Constitution du 4 octobre 1958 ; Vu la loi organique n 2011-333 du 29 mars 2011 rela tive au Défenseur

Plus en détail

Assemblée générale. Nations Unies A/AC.105/875

Assemblée générale. Nations Unies A/AC.105/875 Nations Unies A/AC.105/875 Assemblée générale Distr.: Générale 5 décembre 2006 Français Original: Anglais Comité des utilisations pacifiques de l espace extra-atmosphérique Table des matières Rapport de

Plus en détail

Les droits de l homme 10 décembre, Journée internationale des droits de l homme

Les droits de l homme 10 décembre, Journée internationale des droits de l homme Les droits de l homme 10 décembre, Journée internationale des droits de l homme «Tous les habitants de la planète partagent le désir de vivre à l abri des horreurs de la violence, de la famine, de la maladie,

Plus en détail

Tribunal administratif

Tribunal administratif Nations Unies AT/DEC/1195 Tribunal administratif Distr. limitée 30 septembre 2004 Français Original : anglais TRIBUNAL ADMINISTRATIF Jugement No 1195 Affaire No 1290 : NEWTON Contre : Le Secrétaire général

Plus en détail

Cahier des clauses techniques particulières. Invisibilité sociale : publics et mécanismes

Cahier des clauses techniques particulières. Invisibilité sociale : publics et mécanismes Cahier des clauses techniques particulières Observatoire National de la Pauvreté et de l Exclusion Sociale 1 Contexte du marché Cette étude est lancée par l Observatoire National de la Pauvreté et de l

Plus en détail

Les relations entre le Canada/Québec et l'asean

Les relations entre le Canada/Québec et l'asean Les relations entre le Canada/Québec et l'asean Coffi Dieudonné ASSOUVI Vincent GAGNON-LEFEBVRE Josée-Anne LABRIE Victor SANCHEZ-LOPEZ ETI-7013 Séminaire pluridisciplinaire sur l Asie Plan de la présentation

Plus en détail

Pour plus de transparence

Pour plus de transparence cyan magenta jaune noir PROGRAMME P.7 MONJA ROINDEFO Position ambigüe L ancien Premier ministre de la Transition joue actuellement le rôle de premier FANDRESENA TETIKADY SAMY MANANA maro lafy ny fomba

Plus en détail

14éme Edition de la Foire Internationale du Livre et du Matériel Didactique de Dakar (FILDAK 2013)

14éme Edition de la Foire Internationale du Livre et du Matériel Didactique de Dakar (FILDAK 2013) République du Sénégal Un peuple-un But-Une Foi ------- Ministère de la Culture et du Patrimoine 14éme Edition de la Foire Internationale du Livre et du Matériel Didactique de Dakar (FILDAK 2013) COMITE

Plus en détail

Chapitre 5: Madagascar

Chapitre 5: Madagascar Chapitre 5: Madagascar Compilé par Beate Gadinger Statistiques de contexte du pays Population: 21.3 millions d habitants (2011) PIB par habitant: 422 US$ (2010) Indice de développement humain: 0.480 Taux

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

Textes juridiques de référence sur l expression des jeunes

Textes juridiques de référence sur l expression des jeunes Textes juridiques de référence sur l expression des jeunes I. Textes fondamentaux La liberté d expression et la liberté d information des jeunes sont inscrites dans des textes fondamentaux comme la Convention

Plus en détail