FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

Dimension: px
Commencer à balayer dès la page:

Download "FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina."

Transcription

1

2 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA: Fandraisana fanapahan-kevitra momba ny volavolampandaharam-potoana vokatry ny «Conférence des Présidents» natao ny Alarobia 11 Febroary 2015 tamin ny 3 ora, tolak andro ho amin ny vaninandron ny Alakamisy 12 Febroary Rehefa avy niarahaba ny mpivory, Andriamatoa Filoha, dia niangavy ny Mpitantsoratra hanao ny fiantsoana anarana. Nanatanteraka izany, Andriamatoa LIAHOSOA Malement. Nambaran Andriamatoa Filoha ny fandaharam-potoana taorian izay ary mbola niangavy an Andriamatoa LIAHOSOA Malement, indray izy hamaky ny famintinana ny fivorian ny «Conférence des Présidents», ka toy izao no fivakin izany. Nivory ny Alarobia faha-11 Febroary 2015, nanomboka tamin ny 3 ora, tolak andro, ny «Conférence des Présidents». Andriamatoa Filohan ny Antenimierampirenena, RAKOTOMAMONJY Jean Max, no nitarika ny fivoriana. Ireto avy ireo mpikambana ao amin ny «Conférence des Présidents» sy ny solotenan ny Governemanta tonga nanatrika izany, Andriamatoa sy Ramatoa isany: (Jereo ny tovana «Fiche de Présence») Fiarahabana ireo mpivory tonga nanatrika izao fivoriana izao no nanombohan Andriamatoa Filoha, ny fitenenana. Rehefa izany dia novakiany ary narahiny fanazavana ny volavolam-pandaharam-potoana tapaka tao amin ny fivorian ny Birao Maharitra ny Alarobia faha-11 Febroary Nambarany tamin izany fa lahadinika tokana no voalazan ity fandaharam-potoana ity dia ny fanoloran ny Praiminisitra ny fandaharan asany momba ny fampiharana ny Politika Ankapoben ny Fanjakana amin ny Antenimiera izay afaka manome tolo-kevitra. Mikasika izay indrindra dia tapaka teo anivon ny «Conférence des Présidents» fa aorian ny fanoloran Andriamatoa Praiminisitra ny fandaharan asany dia ireo Filohan ny Vondrona Parlemantera na ny solotenany no hanolotra ireo soso-kevitra avy amin ny Antenimierampirenena.

3 2 Iangaviana araka izany ireo Solombavambahoaka manana soso-kevitra mba hampita izany any amin ny Filohan ny Vondrona Parlemantera misy azy avy. Lany tsy nisy nitsipaka, tsy nisy tsy nilaza ny heviny ny volavolam-pandaharam-potoana ka ho entina eo anivon ny fivoriambe handraisana fanapahan-kevitra farany. (jereo ny tovana) ANNEXE 1 BUREAU PERMANENT N d ordre NOMS ET PRENOMS FONCTION 1 RAKOTOMAMONJY Jean Max Président 2 MAHAZOASY Mananjara Freddie Richard Vice-Président 3 RAZAFINDRAVELO Hermann Vice-Président 4 VANOVASON Jean Adrien Deuxième Questeur 5 LIAHOSOA Malement Rapporteur Général 6 RABETAFIKA N. Roberthine Rapporteur Général Adjoint PRESIDENTS DES COMMISSIONS N d ordre COMMISSIONS PERMANENTES 7 Commission de Finances et du Budget 8 Commission de l Economie et de la Planification 9 Commission de l Aménagement du Territoire et de la Gestion foncière 10 Commission de l Enseignement Technique et de la Formation Professionnelle 11 Commission de la Santé Publique 12 Commission des Ressources Halieutiques et de la Pêche NOM ET PRENOMS RAZAFIMILY Constance NDREMANJARY Odilon RAVELONANOSY Mamy Tiana Télésphore Gérard RANDRIANANTENAINA Olivier Antonny José RAJAOBELINA Lova Herizo KATHY ENTITE Leader Fanilo Mouvance RAVALOMANANA Mouvance RAVALOMANANA

4 3 13 Commission de la Jeunesse et des Sports 14 Commission de la Fonction Publique, du Travail et des Lois sociales 15 Commission de la population et de la Protection Sociale 16 Commission de la Culture du Patrimoine et de la Promotion Artistique RANDRIANASOLO Pauline Volatiana RAHERISOA Vololona Victorine MASY GOULAMALY Marie Jeanne d Arc RAVELOARIVONJY Behavana GPS Indépendant PRESENTANTS DES GROUPES PARLEMENTAIRES N Groupes Parlementaires NOMS ET PRENOMS d ordre 17 VPM-MMM II ANDRIANTSIZEHENA Benja Urbain 18 III FAMINDRA Justin 19 II RAZAHA Tondraha 20 LEADER FANILO DINAH Romuald 21 VPM-MMM SEBANY Mouhamed 22 RAZAFITSIANDRAOFA Jean Brunel Représentant du Gouvernement M Nivo RATIARISON, Directeur de Cabinet MCRI M Bien Aimé RAJOELINA, Directeur des Relations avec les Institutions Publiques. M RABETOKOTANY Charles R, Chef de Service SRI (Primature) ORDRE DU JOUR Pour la période du Mercredi 11 février 2015 au Jeudi 22 février 2015 MERCREDI 11 FEVRIER H30: Réunion des membres du Bureau Permanent (Salle BP) 15h 00: Conférence des Présidents (Salle BP) (Les membres du Bureau Permanent, les Présidents des Commissions et les Présidents des Groupes Parlementaires)

5 4 09h 00: Adoption de l ordre du jour JEUDI 12 FEVRIER 2015 SEANCES PLENIERES (Salle des Séances) 10h 00: Présentation par le Premier Ministre de son programme de mise en œuvre de la Politique Générale de l Etat 17h 00: Clôture de la deuxième session extraordinaire de l année 2015 de l Assemblée nationale. Nambaran Andriamatoa Filoha, fa misokatra ny adihevitra rehefa izany. Nanambara Andriamatoa VELONTSARA Paul Bert, rehefa nomena fitenenana fa misy zavatra tsy mety, kanefa isika milaza fa Lapan ny Demokrasia ato amin ny Antenimierampirenena. Nahagaga ahy ny nahita fa misoratra sahady ao amin ny tabilao, hoy izy, ny fandaharampotoana mbola tsy nolaniana tato amin ny fivoriambe. Namaly, Andriamatoa Filoha, fa mahagaga koa raha tsy hosoratana ny zavatra tokony hiadiana hevitra. Andriamatoa RAHOLIDINA RANAIVO Herinantsoina, kosa nilaza fa tokony ho fafana io soratra ao amin ny tabilao io satria mbola tsy lany ny hahatongavan ny Praiminisitra hanolotra ny fandaharan asany eto anatrehan ny Solombavambahoaka. Mahagaga anay izany, aleo ho vita tsara ny atao ato vao ilazana ry zareo. Tsy voatery holanianay ity na dia aroso eto aza. Nanambara, Andriamatoa Filoha, fa gaga koa izy manoloana ny teny nataon ny Solombavambahoaka niteny teo; nomarihiny fa manana solotena manatrika ny Conférence des Présidents ny Governemanta araka ny voafaritry ny lalàna. Izay mahalala avy hatrany ny zavatra tapaka tao ny Govenemanta. Taorian izay, nisy vitsivitsy ireo Solombavambahoaka nangataka «point d ordre», ka nomena fitenenana. Andriamatoa ANDRIANJANAHARY Fanomezantsoa Mangataka, aleo atao arak izay lanintsika eto no arahana ho fizotry ny raharaha. Io no efa tapaka tany amin ny Conférence des Présidents ka tokony harahana. Andao andraisana fanapahan-kevitra aloha dia hita eo, rehefa lany, aroso ny fandaharam-potoana. Andriamatoa ANDRIANIRINA Josoa Marohajaniaina Fivoriambe azon ny rehetra atrehana ity ka izay tapaka eto no tokony hatao. Tsy hisy fandroahana na iza na iza, fa ny voalazan ny fitsipka no arahana. Manarak izay aleo raisina aloha ny fanapahan-kevitra aorian izay manao fanamarihana izay te-hanao izany.

6 5 Andriamatoa DINAH Romuald Ato amin ny Antenimierampirenena no fanehoana ny fandaharanasan ny Governemanta izay ataon ny Praiminisitra, araka ny voalazan ny Lalàmpanorenana, rariny noho izany ny fandaharam-potoana nataon ny Conférence des Présidents satria efa antomotra koa ny fotoana voalazan ny lalàna hanaovany izany. Andriamatoa ANDRIANTSIZEHENA Benja Urbain Mitodika amintsika Lehiben ny Vondrona Parlemantera: rehefa antsoina any amin ny Conférence des Présidents isika, miangavy, tongava mivory ary any isika no tokony hitabataba fa tsy eto amin ny fivoriambe toy izao. Andriamatoa MARA Niarisy Ny fangatahana point d ordre, Andriamatoa Filoha, fandaminana fivoriana fa tsy fandraisana fitenenana, koa aleo izay no arahana. Tsy satroka ny ahy fa fitenenana satria efa tsy manara-dalàna isika: miondrika eo anatrehan ny fanapahan-kevitry ny HCC izahay na tsy ara-dalàna izany satria tsy azo iadiankevitra ny didy avoakany. Noho izany, horaisinay eto amin ny Antenimierampirenena ihany ny Praiminisitra androany, na manam-pahaizana iraisam-pirenena aza no mitsipaka indray ny teny nataony tany aloha. Ny ordre du jour matoa soratana ao amin ny tabilao, zavatra efa ekena izay. Ny fahazoako azy efa ofisialy no soratana ao, izany hoe rehefa lany izany vao tokony hosoratana amin ny tabilao. Raha zavatra mbola ho laniana tsy tokony hatao amin ny tabilao aloha, rehefa lany vao soratana. Marina fa efa ho tapitra ny 30 andro voalazan ny Lalàmpanorenana, na nisy Conférence des Présidents na tsy nisy tsy maintsy raisina androany ny Praiminisitra. Ataovy mazava ny resaka hoe: ianao ve Andriamatoa Filoha, no hilaza aminay fa ho azonay ny fiara 4x4 sa Andriamatoa Praiminisitra no hamaly izany, fa horaisinay izy androany. Rahoviana no ho azo, miandry ny loi de finances manaraka ve sa rahoviana. Holanianay ity ordre du jour ity ary horaisinay ny Praiminisitra. Nandray fitenenana, Andriamatoa Filoha, fa ny tompon andraikitra no hamaly ny fanontaniana momba ny fiara 4x4. Taorian izay dia niroso tamin ny fandraisana fanapahan-kevitra momba ny volavolampandaharam-potoana ny mpivory. Rehefa natao ny tsangan-tànana dia: - Solombavambahoaka miisa 91 no nandany - - Solombavambahoaka miisa 4 no nitsipaka - - Solombavambahoaka iray no tsy nilaza ny heviny -

7

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

Noely 2009 Taom-baovao 2010

Noely 2009 Taom-baovao 2010 FMM Fiombonana Miara-mivavaka eto Münich. Noely 2009 Taom-baovao 2010 Fa Zaza no teraka ho antsika, Zazalahy no omena antsika, ary ny anarany atao hoe Mahagaga, Mpanolon-tsaina, Andriamanitra Mahery, Rain

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

LANY TAMINGANA ETO AMINTSIKA

LANY TAMINGANA ETO AMINTSIKA cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

Conversations en ligne : descriptions, perspectives. Louise Ouvrard

Conversations en ligne : descriptions, perspectives. Louise Ouvrard Conversations en ligne : descriptions, perspectives Eléments théoriques La variation Quelques caractéristiques du discours électronique La langue malgache Le corpus Présentation Analyse Quels apports à

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA TATITRA ANIVON NY ANTENIMIERAM- PIRENENA Praiminisitra Jean RAVELONARIVO 1 TATITRA MANOLOANA NY ANTENIMIERA I 21 MAY 2015 21 MAY 2015 Andininy 54.- Ny Filohan ny Repoblika no manendry ny Praiminisitra

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

MpANAMORY RAdO RABARILALA

MpANAMORY RAdO RABARILALA ENIM-BOLANA TSY TAFATSANGANA FANJAITRA MIISA 21 NO NESORINA TAO AN-KIBON i LALAINA P.06 N 3190 L u n d i 2 9 j u i n 2 0 1 5 PRIX : Ar 400 zatovolahy NANGALATRA volamena P.06 TENY AM-pASANA : NANONOFY

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

Février - mars 2016 n 47 TRAIT D UNION

Février - mars 2016 n 47 TRAIT D UNION Février - mars 2016 n 47 TRAIT D UNION Le journal en ligne de la RNS Train Manakara-Fianarantsoa Éditorial 2 Lyon et ses incontournables 3 La tribune du coordinateur 4 Itinéraire d un sportif gâté 5 Lalaina

Plus en détail

d une solution malgachomalgache

d une solution malgachomalgache cyan magenta jaune noir PROGRAMME P.7 ECONOMIE TRANSITOIRE FANANAN-TANY DECHETS URBAINS Interventionnisme critiqué BIRAO FOTOTRA A VALORISER L inaccessibilité aux intrants notamment aux engrais induit

Plus en détail

Ny Vaovao Mahafaly. La Bonne Nouvelle

Ny Vaovao Mahafaly. La Bonne Nouvelle Ny Vaovao Mahafaly La Bonne Nouvelle Ary tamin ny fahenim-bolana dia nirahin Andriamanitra ny anjely Gabriela ho any an-tanàna anankiray any Galilia atao hoe Nazareta, ho any amin ny virijina anankiray,

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

«Je suis optimiste quant à l avenir de Madagascar» dixit Jonas Mfouatie

«Je suis optimiste quant à l avenir de Madagascar» dixit Jonas Mfouatie Affaire Andohatapenaka internationalepage 3 Une tournure Ils tirent à bou Quel que soit votre travail, faites-le de tout votre coeur comme pour le Seigneur... Col 3:23 Quotidien d informations et d actualités

Plus en détail

ATRIKA Le journal de l ASMF

ATRIKA Le journal de l ASMF Association des Anciens du Collège St-Michel en France ATRIKA Le journal de l ASMF OCTOBRE 2010 ÉDITION : Octobre 2010, NUMÉRO 12 Éditorial 2010 ASMF bureau 2009/2010 Joël Rambatomanga(1990) Président

Plus en détail

DISPOSITIONS COMMUNES

DISPOSITIONS COMMUNES ORDONNANCE N 62-074 du 29 SEPTEMBRE 19 62 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics. ( J.O. n 248 du 12.10.62 p. 2248 ) modifiée et complétée

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar HUMBOLDT-UNIVERSITÄT ZU BERLIN Landwirtschaftlich-Gärtnerische Fakultät Schriftenreihe des Seminars für Ländliche Entwicklung VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES DEPARTEMENT INTERDISCIPLINAIRE DE FORMATION PROFESSIONNELLE COMMUNICATION ET DYNAMIQUE LOCALE RAPPORT

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

FINOANA SY FAHAZAVANA FOI ET LUMIERE

FINOANA SY FAHAZAVANA FOI ET LUMIERE FINOANA SY FAHAZAVANA FOI ET LUMIERE BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 Gazety avoakan ny Mpiaramivavaka Kristianina Malagasy eto Bénélux (M.K.M.B.) Bulletin de liaison et d information de la

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

FANILO MIAMPITA. TÉLÉPHONIE FIXE La honte. Encore sous le monopole Après le drame libanais, voilà que resurgit

FANILO MIAMPITA. TÉLÉPHONIE FIXE La honte. Encore sous le monopole Après le drame libanais, voilà que resurgit cyan magenta jaune noir PROGRAMME P.7 L accès sans peine à l information QUOTIDIEN D INFORMATION GRATUIT N 080 DU Vendredi 18 Juin 2010 AFFAIRE LILA FANILO MIAMPITA TÉLÉPHONIE FIXE La honte TONGA NY ORA

Plus en détail

46 Ordonnance n 62-074 du 29 septembre 1962

46 Ordonnance n 62-074 du 29 septembre 1962 Ordonnance n 62-074 du 29 septembre 1962 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics (J.O. n 248 du 12.10.62, p. 2248), modifiée et complétée par

Plus en détail

Note pratique. Réseau PRATIQUES

Note pratique. Réseau PRATIQUES Note pratique Ny Herin ny hafatra / Le pouvoir des messages pour la santé préventive Expérience du programme de santé materno-infantile mené par Inter Aide à Farafangana, Madagascar Notice Type de document

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent cyan magenta jaune noir PROGRAMME P.7 RENCONTRE DE VONTOVORONA POSSIBLE ECHEC Les partis et associations de GRATUIT QUOTIDIEN D INFORMATION N 0137 DU Mercredi 25 Août 2010 FIARAHAMONINA HADIHADIANA NY

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

JEAN-MARC CHÂTAIGNIER Défenseur de Joaquim Chissano

JEAN-MARC CHÂTAIGNIER Défenseur de Joaquim Chissano cyan magenta jaune noir PROGRAMME P.7 QUOTIDIEN GRATUIT D INFORMATION N 0103 DU Vendredi 16 Juillet 2010 L accès sans peine à l information OIF SOATOAVINA TRAFIC Soutien de la médiation internationale

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE -----------------------

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- MINISTERE DES TRANSPORTS ET DE LA METEOROLOGIE -------------- RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- I. CONTEXTE Malgré

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail