Noely 2009 Taom-baovao 2010

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "Noely 2009 Taom-baovao 2010"

Transcription

1 FMM Fiombonana Miara-mivavaka eto Münich. Noely 2009 Taom-baovao 2010 Fa Zaza no teraka ho antsika, Zazalahy no omena antsika, ary ny anarany atao hoe Mahagaga, Mpanolon-tsaina, Andriamanitra Mahery, Rain ny mandrakizay, Andrian ny fiadanana. (Isaia 9 5 ) Ho aminareo mandrakariva anie ny fiadanan ny Tompo Jesoa. Ny Fiombonana Miaramivavaka eto Münich (FMM) dia faly manasa antsika rehetra hankalaza ny Noely 2009 sy Taom-baovao 2010 izay hatao ao amin ny Evangelische Lutherische Friedens Kirche Dachau amin ny faha 31 Janoary ora tolakandro. Hisy ny fandraisana ny Fanasan ny Tompo. Ny fotoana dia eo ambany fitarihan ny Mpitandrina ny FPMA Paris Pasteur RASOLONDRAIBE Seta. Ao aorian ny fotoana dia hisy fiaraha-misakafo sy fialana hetaheta. Manatitra etoana ny fisaorana tompoko ary manao veloma amin ny anaran i Jesosy. Ny Tompon andraikitry ny FMM. Hanta SAUERER *Iangavina isika izay tonga hanotrona mba hampilaza ny tompon andraikitra mialoha ny faha-20 ny volana Janoary. Mail : Tel : *Mipaingotra amin ity fanasana ity ny fandaharam-potoana sy ny plan.

2 - Fanasana : NY MOFO IZAY VAKIANTSIKA DIA FIRAISANA AMIN NY TENAN I JESO KRISTY TOMPONTSIKA. NY KAPOAKY NY FISAORANA IZAY ISAORANTSIKA DIA FIRAISANA AMIN NY RAN I JESO KRISTY TOMPONTSIKA. HOY NY TOMPO : ANDEHA, EFA VOAVOTRA AVOKOA NY ZAVATRA REHETRA! - FANDRAISANA : 107 ( Maniry mafy aho") and.1,2,3 - Teny fampaherezana (mitsangana) : JESO KRISTY TOMPONTSIKA IZAY VOAHOMBO TAMIN NY HAZO FIJALIANA KA NITSANGANA TAMIN NY MATY NO EFA NANOME ANAREO NY TENANY SY NY RANY IZAY NANAVOTANY ANAREO TAMIN NY FAHOTANA REHETRA, IZY ANIE HAMPAHERY SY HIARO ANAREO AMIN IZANY AMIN NY FINOANA MARINA HO FAHASAMBARANA MANDRAKIZAY. HO AMINAREO ANIE NY FIADANANA! : AMENA FMM Fiombonana Miara-mivavaka eto Münich Krismasy 2009 Taom - baovao 2010 Alahady 31 Janoary Hira : 266 («Ry Jeso Tompo, Hianao») - Vavaka fisaorana sy fangatahana - Hira : 16, ("Avia, ry vazantany ô!)and. 1, 2 : HO AMINAREO ANIE NY TOMPO. : ARY HO AMIN NY FANAHINAO. : Tsodrano : AMENA! AMENA! AMENA! HALELOIA! - Hira : 68, ("Avia, ry voavonjy ô! ) and. 3, 4 HAFATRA SY TSODRANO : VONINAHITRA HO AN ANDRIAMANITRA RAY SY ZANAKA ARY FANAHY MASINA IZAY HATRAMIN NY TALOHA INDRINDRA KA HO MANDRAKIZAY. AMENA. MANDEHANA AMIN NY FIADANANA, KA MANOMPOA NY TOMPO! : ISAORANA ANIE ANDRIAMANITRA! - Feon orga firavana - Feon orga - Hira : 67 ("Avia ry mino hifaly sy hihoby") - Vavaka fihaonana FIFAMPIARAHABANA - FIANTSOANA SITRAPON ANDRIAMANITRA FIAIKEN-KELOKA : (Vavaka) : «RY RAINAY BE FAMINDRAM-PO Ô, MITALAHO AMINAO IZAHAY ; MAMELÀ NY HELOKAY ; DIOVY IZAHAY HO AFA-PAHOTANA ; SASAO IZAHAY HO AFA-KELOKA ; ARY HAVAOZY NY FANAHINAY MBA HO VONON-KANOMPO ANAO. NY FITIAVAN I JESOSY KRISTY ZANAKAO MPAMONJY ANAY NO ANGATAHANAY AMINAO. AMENA.» - Hira : Ry Andriamanitra Tompo Ray any an-danitra ô, mamindrà fo aminay! Ry Jesosy Tompo Mpamonjy izao tontolo izao, mamindrà fo aminay! Ry Fanahy Masina Tomponay Mpampionona ô, mamindrà fo aminay! Fiombonana Miara-Mivavaka eto Münich Fanompoam-pivavahana : Evangelische Lutherische Friedens Kirche Dachau Herzog-Albrecht Str Dachau TENY FAMELAN-KELOKA SY FIHAVANANA : (Teny famelan-keloka) : AMEN FANKALAZANA : VONINAHITRA ANY AMIN NY AVO INDRINDRA HO AN ANDRIAMANITRA : ARY FIADANANA HO ETY AMBONIN NY TANY AMIN NY OLONA ANKASITRAHANY. - Hira : 61 ("Tany Betlehema fahiny )and.1,2,3

3 - Hira : 63, ("Tany finaritra") and. 1, 2 : HO AMINAREO ANIE NY TOMPO : ARY HO AMIN NY FANAHINAO : Vavaka noho ny Teny - TESTAMENTA TALOHA : Isa. 9, EPISTILY : Heb. 1, Hira : 63, ("Teny naely, hiran anjely") and. 3 - FILAZANTSARA : Lio. 2, 1-20 FAMAKIANA NY TENIN ANDRIAMANITRA : ISAORANA ANIE NY TOMPO NOHO NY FILAZANTSARA! - Hira : 79 ("Sambasamba Zanahary") - Feon orga - Filazan-draharaha - Hira : 62 ( He teraka any Betlehema ) - Hira fanolorana : Ry Tompon ny harena ô, Fanatitra an-tsitrapo Atolotray Anao izao ; Mba raiso ka tahionao. Amena. FANEKEM-PINOANA TORITENY RAKITRA FANDRAISANA NY FANASAN NY TOMPO - Hira : 254, ("Avia, ry mangetaheta ô!") and 1,2,3 : HO AMINAREO ANIE NY TOMPO! AOKA HIZARA NY FIADANANA ISIKA : - HO AMINAO ANIE NY TOMPO! - ARY HO AMINAO KOA - Sursum Corda (Mitsangana) : ASANDRATO NY FONAREO HO EO AMIN NY TOMPO : ASANDRATRAY NY FONAY HO EO AMIN NY TOMPO : AOKA HO DERAINTSIKA NY TOMPO ANDRIAMANITRA : MENDRIKA HO DERAINA IZY - Préface (Mitsangana) : ENY TOKOA TOMPO Ô, RAY MASINA, ANDRIAMANITRA MANDRAKIZAY, MAHEFA NY ZAVATRA REHETRA, METY SY MAHAVONJY NY ISAORANAY ANAO AMIN NY FOTOANA REHETRA SY AMIN NY TOERANA REHETRA AMIN NY ALALAN I JESOA KRISTY TOMPONAY, IZAY TIA ANAY SY NANOLO-TENA HAMONJY ANAY ; AMIN NY ALALANY KOA NO IDERAN NY ANJELY NY FIANDRIANANAO SY ITSAOHAN NY FANAPAHANA SY NY FAHEFANA REHETRA ANAO AMIN NY TAHOTRA ARY IARAHAN NY FIANGONANA ANY AN-DANITRA SY ETY AN-TANY MIDERA NY ANARANAO AMIN NY FIHOBIANA ARY IZAHAY KOA ANKEHITRINY MIARA-MANANDRATRA NY FEONAY AMINY, KA AMIN NY FANAJANA LEHIBE NO IDERANAY HOE : - Hira : Antema 1 ( Sanctus ) Masina! Masina! Masina Jehovah Tompo! Feno ny voninahitrao izao rehetra izao ry Tompo ô! Amena - Vavaka ( Fisaorana, Anamnèse, Epiclèse ) (Mipetraka) : RY KRISTIANA MALALA, AOKA ISIKA HAHATSIARO AN I JESOA KRISTY IZAY MATY NISOLO ANTSIKA SY NITSANGANA HO FANAMARINANA ANTSIKA, DIA FANATI-PIHAVANANA NATOLOTR ANDRIAMANITRA ANTSIKA, ARY AOKA ISIKA HIARA-MISAOTRA SY HIVAVAKA : MISAOTRA ANAO IZAHAY ANDRIAMANITRA RAINAY, TOMPON NY LANITRA SY NY TANY, FA NOHO NY FAMINDRAM- PONAO AMINAY MPANOTA MAHANTRA, DIA NOMENAO NY ZANAKAO LAHY TOKANA, MBA TSY HO VERY IZAY REHETRA MINO AZY FA HANANA FIAINANA MANDRAKIZAY. : EFA MATY KRISTY, EFA NITSANGANA KRISTY ARY HO AVY AMIM-BONINAHITRA. : NOHO IZANY RY TOMPO, RAINAY ANY AN-DANITRA Ô, INDRETO IZAHAY MANAO ETO ANATREHANAO NY FAHATSIAROVANA NY FAHATONGAVAN NY ZANAKAO HO OLONA, NY FIJALIANY SY NY FAHAFATESANY, NY FITSANGANANY TAMIN NY MATY ARY NY FIAKARANY TAMIM-BONINAHITRA SY NY FIFONANY MANDRAKIZAY HO ANAY, KA MIANDRY SY MITALAHO NY FIVERENANY IZAHAY. : AMENA, AVIA JESOA TOMPO! : ANKEHITRINY, RAY Ô, AIDINO NY FANAHY MASINA MBA HAMENO NY FONAY KA HANDRAISANAY TOKOA NY TOMPONAY AMIN NY FINOANA VELONA AMIN IZAO IZY MANATONA ANAY AMIN IZAO FANASANA IZAO. FA NY FANAHY MASINA NO AHARIANAO, AMELOMANAO, ANAMASINANAO ARY ANOMEZANAO ANAY NY ZAVA-TSOA REHETRA. : AMENA, AVIA FANAHY MASINA! : MISAOTRA ANAO IZAHAY RY JESO KRISTY TOMPO Ô! MIDERA NY ANARANAO IZAHAY RY ZANAK ANDRIAMANITRA LAHY TOKANA MPAMONJY ANAY! ANKALAZAINA ANIE HIANAO NOHO NY FITIAVANAO IZAY MAHERY NOHO NY FAHAFATESANA. ARY IZAHAY IZAY TONGA ETO ANATREHANAO HIOMBONA AMIN NY LATABATRAO DIA MANGATAKA MBA HAMPIRAISONAO AMINAO, OHATRIN NY SAMPANA AMIN NY VOALOBOKA. AMPIANARO HIFANKATIA TAHAKA NY NITIAVANAO ANAY IZAHAY, ARY AOKA IZAHAY HIARA-MANANA AMIN NY FIANGONANA MASINA MANONTOLO NY FIONONANA SY NY FIFALIANA AMINAO, DIA HIANAO IZAY MIARA-MANJAKA AMIN NY RAY SY NY FANAHY MASINA HATRAMIN NY TALOHA INDRINDRA KA HO MANDRAKIZAY. : AMENA! - Teny Fanorenana sy Fanamasinana (Mitsangana) : JESO KRISTY TOMPO TAMIN NY ALINA IZAY NAMADIHANA AZY DIA NANDRAY NY MOFO, ARY REHEFA NISAOTRA IZY DIA NOVAKIANY KA HOY IZY : «RAISO, HANO, ITY NY TENAKO IZAY OMENA HO ANAREO, IZAO NO ATAOVY HO FAHATSIAROVANA AHY.» ARY TOY IZANY KOA NY KAPOAKA REHEFA NIHINANA, DIA HOY IZY : «MISOTROA AMIN ITY HIANAREO REHETRA, FA ITY NO RAKO DIA NY AMIN NY FANEKENA VAOVAO IZAY ALATSAKA HO AN NY REHETRA HO FAMELAN-KELOKA. KOA NA OVIANA NA OVIANA NO MISOTRO HIANAREO, DIA IZAO NO ATAOVY HO FAHATSIAROVANA AHY.» MISAOTRA NY RAY, IZAY NAMPAHAMENDRIKA ANTSIKA HANANA ANJARA AMIN NY LOVAN NY OLONA MASINA EO AMIN NY MAZAVA. AMENA. - Hira : 310 ( Misy maro ao an-tsaha mitaraina ) and. 1,2,3 EFA NANDRAY NY FANAHY MAHA-ZANAK ANDRIAMANITRA ANTSIKA ISIKA, KOA IZANY NO HAHAFAHANTSIKA MANATONA NY RAY, HOE (Vavaka nampianarin ny Tompo)

4 tinéraire vers Herzog-Albrecht-Strasse 8, Dachau Itinéraire vers Herzog-Albrecht-Strasse 8, Dachau Temps total: 4 min, Distance totale: 0.7 km Distance 1. Partez de BAHNHOFSPLATZ, DACHAU en vous dirigeant vers FRÜHLINGSTRASSE 2. Obliquez à gauche sur BAHNHOFSTRASSE roulez 0.2 km 3. Tournez à droite sur MÜNCHNER STRASSE(ST2047) roulez 0.2 km 4. Tournez à gauche sur AM UNTEREN MARKT 5. Obliquez à droite sur HERZOG-ALBRECHT-STRASSE roulez 0.1 km 6. Arrivée à HERZOG-ALBRECHT-STRASSE 8, DACHAU, à droite Durée: 4 min, Distance: 0.7 km Lorsque vous utilisez un itinéraire ou une carte généré(e) par Yahoo! Maps, il est conseillé de tenir compte des «conditions réelles» et de déterminer si la route est praticable, si des travaux sont en cours, si vous devez envisager des mesures de sécurité particulières, etc. Les outils Yahoo! Maps doivent être considérés comme de simples aides pour organiser vos déplacements. sur 1 30/12/ :28

5 tinéraire vers Herzog-Albrecht-Strasse 8, Dachau Itinéraire vers Herzog-Albrecht-Strasse 8, Dachau Temps total: 4 min, Distance totale: 0.7 km Distance 1. Partez de BAHNHOFSPLATZ, DACHAU en vous dirigeant vers FRÜHLINGSTRASSE 2. Obliquez à gauche sur BAHNHOFSTRASSE roulez 0.2 km 3. Tournez à droite sur MÜNCHNER STRASSE(ST2047) roulez 0.2 km 4. Tournez à gauche sur AM UNTEREN MARKT 5. Obliquez à droite sur HERZOG-ALBRECHT-STRASSE roulez 0.1 km 6. Arrivée à HERZOG-ALBRECHT-STRASSE 8, DACHAU, à droite Durée: 4 min, Distance: 0.7 km Lorsque vous utilisez un itinéraire ou une carte généré(e) par Yahoo! Maps, il est conseillé de tenir compte des «conditions réelles» et de déterminer si la route est praticable, si des travaux sont en cours, si vous devez envisager des mesures de sécurité particulières, etc. Les outils Yahoo! Maps doivent être considérés comme de simples aides pour organiser vos déplacements. sur 1 30/12/ :28

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

Ny Vaovao Mahafaly. La Bonne Nouvelle

Ny Vaovao Mahafaly. La Bonne Nouvelle Ny Vaovao Mahafaly La Bonne Nouvelle Ary tamin ny fahenim-bolana dia nirahin Andriamanitra ny anjely Gabriela ho any an-tanàna anankiray any Galilia atao hoe Nazareta, ho any amin ny virijina anankiray,

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

EDITORIAL. Un bon projet ALAHADY 26 SEPTAMBRA 2010. Fanompoampivavahana voalohany amin ny taona 2010-2011.

EDITORIAL. Un bon projet ALAHADY 26 SEPTAMBRA 2010. Fanompoampivavahana voalohany amin ny taona 2010-2011. BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 1 - Septembre 2010 EDITORIAL Un bon projet Mensuel - Editeur Responsable:

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

FINOANA SY FAHAZAVANA FOI ET LUMIERE

FINOANA SY FAHAZAVANA FOI ET LUMIERE FINOANA SY FAHAZAVANA FOI ET LUMIERE BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 Gazety avoakan ny Mpiaramivavaka Kristianina Malagasy eto Bénélux (M.K.M.B.) Bulletin de liaison et d information de la

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

Note pratique. Réseau PRATIQUES

Note pratique. Réseau PRATIQUES Note pratique Ny Herin ny hafatra / Le pouvoir des messages pour la santé préventive Expérience du programme de santé materno-infantile mené par Inter Aide à Farafangana, Madagascar Notice Type de document

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg 0 UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail

Plus en détail

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. "Dieu qualifie ceux qui sont appelés", hoy Rakotolehibe Mamy, Talen ny FMMB

FIKAMBANAN NY MPIARA-MAMAKY NY BAIBOLY. Dieu qualifie ceux qui sont appelés, hoy Rakotolehibe Mamy, Talen ny FMMB Taniketsa - Laharana faha 58 - Septambra 2014 1 Gazetin ny Sampana Sekoly Alahady FJKM Andrainarivo Taniketsa Miseho isan-telo volana. Laharana faha 58. Septambra 2014. Vidiny: 400 Ariary. Tranokala: www.sa-andrainarivo.mg

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

M o t d u P rov i n c i a l Temps de grâces

M o t d u P rov i n c i a l Temps de grâces Mot du Provincial Temps de grâces Plusieurs événements de la province et de l Église à Madagascar constituent nos sources d action de grâce à adresser au Seigneur. La visite fraternelle et édifiante du

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES DEPARTEMENT INTERDISCIPLINAIRE DE FORMATION PROFESSIONNELLE COMMUNICATION ET DYNAMIQUE LOCALE RAPPORT

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

AMBATONAKANGA SY NY MISIONERA ;

AMBATONAKANGA SY NY MISIONERA ; AMBATONAKANGA SY NY MISIONERA ; Raha miteny hoe Ambatonakanga isika protestanta amin izao andro ankehitriny izao dia ny trano fiangonana vita amin ny vato no tonga ao an-tsaintsika voalohany ary vitsy

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

Hafatra fisaorana avy amin-dramatoa Mialy Rajoelina, filohan ny fikambanana Fitia

Hafatra fisaorana avy amin-dramatoa Mialy Rajoelina, filohan ny fikambanana Fitia Le rideau est tombé sur la levée de fonds et de dons organisée par l association Fitia, fondée et présidée par l épouse du président de la Haute Autorité de la Transition de Madagascar. Cette opération

Plus en détail

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE -----------------------

RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- MINISTERE DES TRANSPORTS ET DE LA METEOROLOGIE -------------- RAPPORT SUR LA REMISE OFFICIELLE D EQUIPEMENTS DE MESURE DU TAUX D ALCOOLEMIE AUX FORCES DE L ORDRE ----------------------- I. CONTEXTE Malgré

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

Le malgache. L exemple d une langue sans test

Le malgache. L exemple d une langue sans test Le malgache L exemple d une langue sans test 1. Pourquoi n existe t il pas de cer:fica:on? Peu d échanges commerciaux avec l extérieur Pas d immigra:on importante de «cols blancs» Peu d étudiants étrangers

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

Février - mars 2016 n 47 TRAIT D UNION

Février - mars 2016 n 47 TRAIT D UNION Février - mars 2016 n 47 TRAIT D UNION Le journal en ligne de la RNS Train Manakara-Fianarantsoa Éditorial 2 Lyon et ses incontournables 3 La tribune du coordinateur 4 Itinéraire d un sportif gâté 5 Lalaina

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

MpANAMORY RAdO RABARILALA

MpANAMORY RAdO RABARILALA ENIM-BOLANA TSY TAFATSANGANA FANJAITRA MIISA 21 NO NESORINA TAO AN-KIBON i LALAINA P.06 N 3190 L u n d i 2 9 j u i n 2 0 1 5 PRIX : Ar 400 zatovolahy NANGALATRA volamena P.06 TENY AM-pASANA : NANONOFY

Plus en détail

Madagascar. Pourquoi Hery Rajaonarimampianina doit partir au plus vite Dimanche, 18 Septembre :09 - Mis à jour Mardi, 20 Septembre :03

Madagascar. Pourquoi Hery Rajaonarimampianina doit partir au plus vite Dimanche, 18 Septembre :09 - Mis à jour Mardi, 20 Septembre :03 Me Nicole Andrianarivoson, personne choisie par le président de la république et Rahantanirina Lalao dite Nina, Député de Madagascar élue à Mahajanga. Mais c'est la première qui dicte sa loi à Madagascar

Plus en détail

«IZY NO HAMBARAN NY MPAMINANY REHETRA FA AMIN NY ANARANY NO

«IZY NO HAMBARAN NY MPAMINANY REHETRA FA AMIN NY ANARANY NO AIX-MARSEILLE «Ary raha namafy izy, ny sasany dia voafafy teny amoron-dàlana ; dia avy ny vorona ka nandany azy. Ary ny sasany dia voafafy teny amin ny tany marivo ambony vatolampy ; dia nalaky nitrebona

Plus en détail

Conversations en ligne : descriptions, perspectives. Louise Ouvrard

Conversations en ligne : descriptions, perspectives. Louise Ouvrard Conversations en ligne : descriptions, perspectives Eléments théoriques La variation Quelques caractéristiques du discours électronique La langue malgache Le corpus Présentation Analyse Quels apports à

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

TRAIT D UNION. 23 mars 2016 n 48. Le journal en ligne de la RNS. Éditorial 2. Itinéraire Tombola d un sportif gâté 9 5

TRAIT D UNION. 23 mars 2016 n 48. Le journal en ligne de la RNS. Éditorial 2. Itinéraire Tombola d un sportif gâté 9 5 23 mars 2016 n 48 TRAIT D UNION Le journal en ligne de la RNS Commune de Vohiposa, nord-est de Haute-Matsiatra, projet AGIRE, Grand Lyon Métropole de Lyon Les Lyonnais rencontrent les Malgaches 2 Discours

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

ATRIKA Le journal de l ASMF

ATRIKA Le journal de l ASMF Association des Anciens du Collège St-Michel en France ATRIKA Le journal de l ASMF OCTOBRE 2010 ÉDITION : Octobre 2010, NUMÉRO 12 Éditorial 2010 ASMF bureau 2009/2010 Joël Rambatomanga(1990) Président

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

Antananarivo. Hausse de 6 milliards du budget 2014 de la Commune urbaine Jeudi, 09 Janvier :01 - Mis à jour Jeudi, 09 Janvier :39

Antananarivo. Hausse de 6 milliards du budget 2014 de la Commune urbaine Jeudi, 09 Janvier :01 - Mis à jour Jeudi, 09 Janvier :39 L'hôtel de Ville d'antananarivo, incendié en 1972, a été entièrement reconstruit grâce à la volonté du Maire, Andry Rajoelina, 38 ans plus tard. Voilà ce que retiendra l'histoire. Le reste n'est mensonges

Plus en détail

Mbola itý re aho Rakilónga

Mbola itý re aho Rakilónga Mbola itý re aho Rakilónga 1. Ny tena fahamarinana ve? 2. Zava-masina noho ny masina ny atáo hoe fahamarinana, araka ny efa namakianáo azy tamin ny lahatsoratra hafa izáy natolotro anáo. 3. Hoy ny Tompo

Plus en détail

Am-pitiavana no hitsidihako ny isan-tokan-tranonareo amin izao takariva izao.

Am-pitiavana no hitsidihako ny isan-tokan-tranonareo amin izao takariva izao. A la veille du premier tour de l élection présidentielle du 25 octobre 2013, le Président de la Transition de Madagascar, Andry Rajoelina, a adressé un message à la Nation, transmis en direct et simultanément

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

LANY TAMINGANA ETO AMINTSIKA

LANY TAMINGANA ETO AMINTSIKA cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN

Plus en détail

Visite de la caserne des pompiers de Tuléar

Visite de la caserne des pompiers de Tuléar Visite de la caserne des pompiers de Tuléar Date : mercredi 13 novembre 2013 Heure : de 8h30 à 10h30 Classe : CE1 Objectifs : - Comprendre et appliquer quelques règles simples en situation de danger, se

Plus en détail

Io lohaten ity lahatsoratra ity dia nalaina tao amin ilay hira malazan i Mamy Gotso Misy fomba

Io lohaten ity lahatsoratra ity dia nalaina tao amin ilay hira malazan i Mamy Gotso Misy fomba Hellville, Nosy Be, volana Jona 2015. Fampanantenana tsy nisy toa izany! Hery sy Voahangy Mivady mihitsy no tonga tany. Ho rakotra afaka telo volana i Madagasikara iray manontolo. Dia ahoana izao ny tohiny?

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

REPOBLIKAN I MADAGASIKARA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN I MADAGASIKARA Fitiavana Tanindrazana Fandrosoana ----------------------------------- MINISTERE DE L AGRICULTURE ----------------------------------- FEDERATION DES CHAMBRES DE COMMERCE ET D

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail