TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

Dimension: px
Commencer à balayer dès la page:

Download "TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»"

Transcription

1 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» Nov /6

2 1. CONTEXTE La microfinance à Madagascar remonte au début des années 90 avec la mise en place des premières Institutions de MicroFinance. Depuis cette date, la microfinance a fait de grands progrès et touchent plus de personnes avec un volume de plus de 37 milliards Ariary d épargne et de 70 milliards Ariary de crédit. Cependant, c est en 2004, après la mise en place de la Coordination Nationale de la MicroFinance (CNMF), que la première Stratégie Nationale de MicroFinance (SNMF) a été mise en œuvre. Prévue à couvrir la période de 2004 à 2009, cette Stratégie Nationale de MicroFinance a été évaluée en octobre 2007 et alignée aux priorités du MAP suivant les Engagement 4-Défi 2 et Engagement 6-Défi 4 dont l objectif fixé d ici 2012 est d avoir un taux de pénétration de la microfinance de 13% contre 7,86% actuellement. La SNMF révisée et alignée au MAP couvre la période 2008 à 2012 dont la vision est de «Disposer d un secteur de la MicroFinance professionnel, viable et pérenne, intégré au secteur financier, diversifié et innovant, assurant une couverture satisfaisante de la demande du territoire et opérant dans un cadre légal, réglementaire, fiscal et institutionnel adapté et favorable». L objectif de développement étant de «Favoriser l accès à des services de microfinance diversifiés tant au niveau de l offre de produits qu au niveau des types d institutions, grâce à des institutions viables, intégrées dans le secteur financier pour une majorité de ménages à faible revenu et de micro entrepreneurs sur l ensemble du territoire malagasy d ici 2012». Cet objectif de développement se décline à son tour en trois Axes Stratégiques à savoir : - Axe Stratégique 1 : «Amélioration du cadre économique, légal et réglementaire pour un développement harmonieux et sécurisé du secteur» - Axe Stratégique 2 : «Offre viable et pérenne de produits et services adaptés, diversifiés et en augmentation, notamment dans les zones non encore couvertes par des IMF professionnelles» - Axe Stratégique 3 : «Organisation du cadre institutionnel de manière à permettre une bonne structuration du secteur, une coordination efficace du secteur et une conduite efficiente de la Stratégie Nationale de MicroFinance» Cadrant dans les actions de communication pour la visibilité et l image de la Coordination Nationale de la MicroFinance (CNMF) conformément au plan d actions du plan stratégique de communication du secteur, la CNMF lance un concours ouvert au grand public pour la création de son logo et de son slogan. Contexte spécifique au concours Mise en place en 2003 et rattachée à la Direction Générale du Trésor du Ministère des Finances et du Budget (MFB) qui est le Ministère de tutelle du secteur de la microfinance, la CNMF : - assure la coordination de la politique générale du Gouvernement en matière de microfinance et de promotion du secteur, le suivi des activités et des opérations des intervenants et évaluation des performances des programmes tout en apportant une attention particulière à la réflexion générale sur le secteur - est l organe de validation assurant la cohérence et la conformité des projets et programmes selon la stratégie et leur orientation sur les pratiques optimales. - met en place un système de concertation avec les autres Ministères et participe à tous comités ou organes de pilotage desdits programmes en plus d être parmi les destinataires de tous les rapports d évaluation des IMF. 2. MANDAT ET REGLEMENT Le mandat consiste à créer le logo de la CNMF d une part et son slogan d autre part. 2/6

3 A part les membres du personnel de la CNMF et les membres du Comité de Pilotage de la Stratégie Nationale de MicroFinance, le concours est ouvert au grand public mais à titre individuel. Les bénéficiaires des services des Institutions de MicroFinance sont fortement encouragés à y participer. Chaque concurrent peut aussi bien participer au concours de logo qu au slogan mais chaque œuvre doit être présentée séparément dans deux plis différents. Les règlements du concours sont détaillés ci-après : LOGO (Réf. LOGO) - Le logo doit refléter l image de la CNMF dans son rôle de coordination de la politique générale du Gouvernement en matière de microfinance - Quatre couleurs au plus au choix du concurrent peuvent être utilisées mais le rouge, le vert, le blanc et le bleu sont recommandés. Il serait préférable d utiliser le bleu comme couleur de fond du logo. - Un concurrent ne peut présenter qu un seul logo en son nom personnel - Le logo est à présenter sur papier A4 (21cmx29,7cm). Aucune autre mention ne doit figurer sur le papier sinon l œuvre proposée sera rejetée. - Un autre papier A4 (21cmx29,7cm) doit être joint au logo sur lequel le concurrent décrit brièvement soit en français soit en malagasy la signification de son œuvre. Sans cette description, l œuvre ne sera pas considérée - Toutes les œuvres reçues dans le cadre de ce concours resteront propriétés de la CNMF - La CNMF peut, au besoin, apporter quelques retouches à l œuvre retenue compte tenu des exigences technologiques pour sa numérisation - Le logo retenu figurera sur tous les supports de communication de la CNMF - Pour la modalité de soumission : o Le premier papier A4 contenant le logo et le second contenant la description sont à glisser ensemble dans une enveloppe sur laquelle est inscrite le nom, prénom, âge, sexe, adresse exacte, numéro de téléphone du concurrent o Cette enveloppe sera à son tour glissée dans une autre enveloppe qui sera adressée à la CNMF SLOGAN (Réf. SLOGAN) - Le slogan doit refléter l image de la CNMF dans son rôle de coordination de la politique générale du Gouvernement en matière de microfinance et ce dans le but de promouvoir et développer le secteur par la mobilisation de tous les acteurs, intervenants et partenaires - Le slogan doit être court mais expressif - Le slogan doit être rédigé en malagasy. Facultativement, le concurrent pourrait proposer une traduction en français mais seul le slogan en malagasy fera l objet d appréciation lors de la sélection. - Un concurrent ne peut présenter qu un seul slogan en son nom personnel - Le slogan est à présenter sur papier A4 (21cmx29,7cm). Aucune autre mention ne doit figurer sur le papier sinon l œuvre proposée sera rejetée - Un autre papier A4 (21cmx29,7cm) doit être joint au slogan sur lequel le concurrent décrit brièvement (soit en malagasy, soit en français, soit en malagasy et en français) la signification de son œuvre. Sans cette description, l œuvre ne sera pas considérée - Toutes les œuvres reçues dans le cadre de ce concours resteront propriétés de la CNMF - Pour la modalité de soumission : o Le premier papier A4 contenant le slogan et le second contenant la description sont à glisser ensemble dans une enveloppe sur laquelle est inscrite le nom, prénom, âge, sexe, adresse exacte, numéro de téléphone du concurrent o Cette enveloppe sera à son tour glissée dans une autre enveloppe qui sera adressée à la CNMF 3. PRIX Seules les deux meilleures œuvres de logo et les deux meilleures œuvres de slogan seront primées. LOGO 1 er prix : Un million cinq cent mille Ariary ( Ar) 2è prix : Cinq cent mille Ariary ( Ar) 3/6

4 SLOGAN 1 er prix : Un million Ariary ( Ar) 2è prix : Trois cent mille Ariary ( Ar) Conditions particulières pour le slogan - Si deux ou plusieurs slogans ont exactement le même contenu (version malagasy) alors qu ils sont parmi les primés, un tirage au sort sera effectué pour départager les concurrents. - Les deux prix seront attribués à deux slogans différents 4. REMISE DES ŒUVRES Les œuvres doivent être remises ou envoyées par voie postale à la Coordination Nationale de la MicroFinance (CNMF) à l adresse suivante : 21-23, Rue Rainitovo Antsahavola Antananarivo 101 au plus tard le vendredi 28 novembre 2008 à seize (16) heures locales, le cachet de la poste faisant foi. Préciser à l extérieur de l enveloppe la Référence de l œuvre «LOGO» ou «SLOGAN». L intégralité des Termes de Référence de ce concours peut être retirée auprès du Bureau de la Coordination Nationale de la MicroFinance (CNMF) à l adresse ci-dessus ou téléchargée à partir du site : le site officiel de la microfinance à Madagascar 4/6

5 FIFANINANANA MAMORONA SARY FAMANTARANA SY TENY FANEVA HO AN NY CNMF Ny Fandrindrana Nasionalin ny Mikraofinansy (CNMF) dia rafitra nitsangana tamin ny taona 2003 eo anivon ny Foiben ny Fitatanam-bolam-panjakana ao amin ny Ministeran ny Vola sy ny Fitatanam-bola. Azo fehezina ho telo lehibe ny andraikitry ny CNMF : - Miantoka ny fandrindrana ny fanatanterahana ny politikam-panjakana ankapobeny amin ny sehatry ny mikraofinansy, ny fanaraha-maso sy ny fanaovana tomban ezaka ireo tetik asa sy asa ho fampandrosoana ny mikraofinansy. - Rafitra mahatapaka miantoka ny fifandrindran ny asa tanterahan ireo mpiara-miombon antoka rehetra amin ny fanatanterahana ny paikadim-pirenen ny mikraofinansy sy ny fitaritana azy ireo ho amin ny traikefa mahomby - Mametraka rafitra sy sehatra ifanakalozan-kevitra miaraka amin ireo Ministera hafa, mandray anjara feno amin ny komity na rafi-pitatanana ireo tetik asa voalaza etsy ambony. Mahazo sy mandinika ireo tatitra isan-karazany momba ny tomban ezaky ny asan ireo rafitra mpampindram-bola madinika ihany koa ny CNMF Eo amin ny sehatry ny fanatanterahana ireo andraiktra napetraka aminy ireo, ny Fandrindrana Nasionalin ny Mikraofinansy (CNMF) dia mampanao fifaninanana mamorona sary famantarana iray sy teny faneva iray ho azy. Ankoatra ireo mpiasan ny CNMF sy ireo mpikambana ao amin ny Komity Mpitantana ny Paikadim-pirenena momba ny mikraofinansy dia misokatra ho an ny be sy ny maro ny fifaninanana fa amin ny anaran ny tenany manokana. Amporisihina manokana ireo mpikambana na mpahazo tombontsoa amin ireo rafitra mpampindram-bola madinika. Azon ny mpifaninanana iray atao tsara ny sady mandray anjara amin ny sary famantarana no mandray anjara amin ny teny faneva saingy tsy maintsy sarahana amin ny valopy roa samihafa ny famoronana aroso hifaninana. Vontoatin ny fifaninanana SARY FAMANTARANA (Réf. SARY) - Ny sary famantarana dia tsy maintsy maneho na mandika ny anjara andraikitry ny CNMF amin ny maha mpandrindra nasionaly ny pôlitikam-panjakana ankapobeny ny sehatry ny mikraofinansy azy - Azon ny mpifaninana atao ny mampiasa loko efatra fara fahabetsany araka ny safidiny, amporisihina kosa anefa ny fampiasana ny loko fotsy, mena, maintso ary manga. Tsara kokoa raha ny loko manga no atao lafiky ny sary famantarana. - Famoronana iray isaky ny mpifaninana ihany no azo ekena - Ny sary famantarana dia atao ambony taratasy fotsy A4 (21smx29,7sm). Tsy azo asiana marika na soratra hafa mety ahafantarana ny mpifaninana io taratasy io raha tsy izany dia ho lavina avy hatrany ny famoronana - Tsy maintsy hazavain ny mpifaninana amin ny taratasy iray hafa A4 (21smx29,7sm) kosa ny vontoati-kevitry ny sary famantarana noforoniny. Lavina avy hatrany ny famoronana tsy misy io fanazavana mitokana io. - Ny famoronana rehetra voaray amin ity fifaninanana ity dia mijanona avy hatrany ho fananan ny CNMF - Ny CNMF dia afaka mitondra fanovana kely amin ny famoronana voafidy, raha ilaina izany, noho ny antony teknika takian ny teknolojia amin ny famadihana ny sary famantarana ho azo ampiasaina amin ny solosaina - Ho ampiasain ny CNMF amin ny kirakiram-pifandraisana rehetra ampiasainy ny sary famantarana voafidy - Fomba fandraisana anjara : o Atao anaty valopy iray mihidy tsara ny taratasy misy ny sary famantarana sy ny taratasy misy ny fanazavana fohifohy ny vontoati-kevitry ny sary. Soratana mazava eo ambonin io valopy io ny anarana, fanampiny, taona, lahy sa vavy, adiresy mazava ary ny laharan ny antso an-tarobin ny mpifaninana o Rehefa izany dia arotsaka ao anaty valopy lehibe iray hafa mihidy tsara ny valopy teo aloha ary alefa mivantana any amin ny CNMF TENY FANEVA (Réf. TENY) - Ny teny faneva dia tsy maintsy maneho na mandika ny anjara andraikitry ny CNMF amin ny maha mpandrindra nasionaly ny pôlitikam-panjakana ankapobeny ny sehatry ny mikraofinansy azy mifandraika indrindra amin ny fampahafantarana sy fampandrosoana io sehatra io amin ny alalan ny fanetsehana ireo mpiara-miombon antoka rehetra - Tokony ho fohy nefa manambara hevitra ny teny faneva 5/6

6 - Tsy maintsy atao amin ny teny malagasy ny teny faneva. Azon ny mpifaninana atao ny manolotra dika amin ny teny frantsay ny teny faneva saingy ny teny malagasy ihany no itsarana ny famoronana - Famoronana iray isaky ny mpifaninana ihany no azo ekena - Ny teny faneva dia atao ambony taratasy fotsy A4 (21smx29,7sm). Tsy azo asiana marika na soratra hafa mety ahafantarana ny mpifaninana io taratasy io raha tsy izany dia ho lavina avy hatrany ny famoronana - Tsy maintsy hazavain ny mpifaninana (amin ny teny malagasy na amin ny teny frantsay na izy roa miaraka) amin ny taratasy iray hafa A4 (21smx29,7sm) kosa ny vontoati-kevitry ny teny faneva noforoniny. Lavina avy hatrany ny famoronana tsy misy io fanazavana mitokana io. - Ny famoronana rehetra voaray amin ity fifaninanana ity dia mijanona avy hatrany ho fananan ny CNMF - Ho ampiasain ny CNMF amin ny kirakiram-pifandraisana rehetra ampiasainy ny sary famantarana voafidy - Fomba fandraisana anjara : o Atao anaty valopy iray mihidy tsara ny taratasy misy ny teny faneva sy ny taratasy misy ny fanazavana fohifohy ny vontoati-kevitry ny famoronana. Soratana mazava eo ambonin io valopy io ny anarana, fanampiny, taona, lahy sa vavy, adiresy mazava ary ny laharan ny antso an-tarobin ny mpifaninana o Rehefa izany dia arotsaka ao anaty valopy lehibe iray hafa mihidy tsara ny valopy teo aloha ary alefa mivantana any amin ny CNMF Valisoa Ireo roa voalohany mendrika isaky ny sokajy (sary famantarana sy teny faneva) ihany no mahazo valisoa. SARY FAMANTARANA Voalohany : Dimy hetsy sy iray tapitrisa ariary ( Ar) Faharoa : Dimy hetsy Ariary ( Ar) TENY FANEVA Voalohany Faharoa : Iray hetsy ariary ( Ar) : Telo hetsy Ariary ( Ar) Fepetra manokana momba ny teny faneva : - Raha sendra misy teny faneva roa na maromaro mitovy tanteraka ny teny na fehezan-teny mandrafitra azy (amin ny teny malagasy), nefa isan ireo roa voalohany tokony ahazo loka, dia amin ny alalan ny antsapaka no anavahana ny mpifaninana mandresy - Ireo loka roa voalohany voalaza etsy ambony dia tsy maintsy teny faneva roa samihafa no mahazo azy Fametrahana ny famoronana Ny famoronana dia aterina an-tanana na alefa paositra any amin ny CNMF fara fahatarany ny Zoma 28 novambra 2008 amin ny efatra ora hariva any amin ny adiresy 21-23, Rue Rainitovo Antsahavola (Akaikin ny barrière Ambasady Amerikana) Antananarivo 101; ny fitomboky ny paositra no manamarina izany. Soratana eo ivelan ny valopy ny hoe «SARY» na «TENY» arakaraky ny ao anaty valopy. Azon ny mpifaninana atao ny manatona ny biraon ny CNMF ao amin ny adiresy etsy ambony maka ny vontoatiny feno momba ny fifaninanana na maka izany ao amin ny tranon-kala : : tranon-kalan ny mikraofinansy eto Madagasikara 6/6

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

DISPOSITIONS COMMUNES

DISPOSITIONS COMMUNES ORDONNANCE N 62-074 du 29 SEPTEMBRE 19 62 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics. ( J.O. n 248 du 12.10.62 p. 2248 ) modifiée et complétée

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

46 Ordonnance n 62-074 du 29 septembre 1962

46 Ordonnance n 62-074 du 29 septembre 1962 Ordonnance n 62-074 du 29 septembre 1962 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics (J.O. n 248 du 12.10.62, p. 2248), modifiée et complétée par

Plus en détail

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY MINISTERAN NY FAMBOLENA NY FIOMPIANA ARY NY JONO ----------------------------------- REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana ---------------------------------- MINISTERAN NY TOEKARENA

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana ------------

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana ------------ MINISTERE DE L ECONOMIE DES FINANCES ET BUDGET REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana ------------ ARRETE N 9620/04 précisant la définition et les modalités d application de la catégorie

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA TATITRA ANIVON NY ANTENIMIERAM- PIRENENA Praiminisitra Jean RAVELONARIVO 1 TATITRA MANOLOANA NY ANTENIMIERA I 21 MAY 2015 21 MAY 2015 Andininy 54.- Ny Filohan ny Repoblika no manendry ny Praiminisitra

Plus en détail

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar HUMBOLDT-UNIVERSITÄT ZU BERLIN Landwirtschaftlich-Gärtnerische Fakultät Schriftenreihe des Seminars für Ländliche Entwicklung VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

Dossier de participation

Dossier de participation REPOBILIKAN I MADAGASIKARA Fitiavana Tanindrazana Fandrosoana VICE PRIMATURE CHARGEE DE L ECONOMIE ET DE L INDUSTRIE Enpowered lives. Resilient nations. 13 au 18 Novembre 2012 Palais National de la Culture

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

Évaluation de l impact environnemental et social

Évaluation de l impact environnemental et social RÉPUBLIQUE DE MADAGASCAR Tanindrazana - Fahafahana - Fandrosoana PRÉSIDENCE PROJET PÔLE INTÉGRÉS DE CROISSANCE Secrétariat National Évaluation de l impact environnemental et social Cadre de politique de

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

ARRETE INTERMINISTERIEL N 41.324/2010 instituant la carte professionnelle d acheteur de bovins

ARRETE INTERMINISTERIEL N 41.324/2010 instituant la carte professionnelle d acheteur de bovins MINISTERE DE L ELEVAGE ---------------------- MINISTERE DES FORCES ARMEES ------------------------- MINISTERE DES FINANCES ET DU BUDGET ---------------------- MINISTERE DU COMMERCE ---------------------

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

LOI n 2008 030. portant protection des droits des Personnes Agées

LOI n 2008 030. portant protection des droits des Personnes Agées REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2008 030 portant protection des droits des Personnes Agées EXPOSE DES MOTIFS Le préambule de la Constitution énonce clairement le respect

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

PROJET DE LOI N 027/2007

PROJET DE LOI N 027/2007 REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PROJET DE LOI N 027/2007 DU 25 OCTOBRE 2007 PORTANT LOI DE FINANCES POUR 2008 IMPRIMERIE NATIONALE 2007 - 2 - PROJET DE LOI N 027/2007 PORTANT

Plus en détail

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent cyan magenta jaune noir PROGRAMME P.7 RENCONTRE DE VONTOVORONA POSSIBLE ECHEC Les partis et associations de GRATUIT QUOTIDIEN D INFORMATION N 0137 DU Mercredi 25 Août 2010 FIARAHAMONINA HADIHADIANA NY

Plus en détail

CONCOURS RÉGIONAL. Les sciences et les technologies, c est pour les filles aussi!

CONCOURS RÉGIONAL. Les sciences et les technologies, c est pour les filles aussi! Égalité CONCOURS RÉGIONAL Les sciences et les technologies, c est pour les filles aussi! Dossier de concours pour les établissements d enseignement supérieur Réglement du concours Le Préfet de la région

Plus en détail

- FORMATION Maîtrise d un portefeuille: Analyse de risque et recouvrement. CEFOR Module de formation interne

- FORMATION Maîtrise d un portefeuille: Analyse de risque et recouvrement. CEFOR Module de formation interne - FORMATION Maîtrise d un portefeuille: Analyse de risque et recouvrement CEFOR Module de formation interne Introduction La formation sur «La maîtrise d un portefeuille: analyse de risques et recouvrement»

Plus en détail

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA Public Disclosure Authorized a REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana JIRAMA JIRO SY RANO MALAGASY E1 403 VOL. 1 Public Disclosure Authorized Public Disclosure Authorized ÉVALUATION

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana EXPOSE DES MOTIFS Loi n 2001007 autorisant la ratification de l Accord de Crédit de Développement conclu le 22 mai 2001 entre la République de Madagascar et l Association Internationale de Développement relatif au financement

Plus en détail

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES DEPARTEMENT INTERDISCIPLINAIRE DE FORMATION PROFESSIONNELLE COMMUNICATION ET DYNAMIQUE LOCALE RAPPORT

Plus en détail

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Ventin-kevitra Matoan-dahatsoratra Fampahafantarana an i Madagasikara 4 Ny Nosy Telma, mpandraharaha nasionaly manara-penitra iraisam-pirenena

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

MpANAMORY RAdO RABARILALA

MpANAMORY RAdO RABARILALA ENIM-BOLANA TSY TAFATSANGANA FANJAITRA MIISA 21 NO NESORINA TAO AN-KIBON i LALAINA P.06 N 3190 L u n d i 2 9 j u i n 2 0 1 5 PRIX : Ar 400 zatovolahy NANGALATRA volamena P.06 TENY AM-pASANA : NANONOFY

Plus en détail

d une solution malgachomalgache

d une solution malgachomalgache cyan magenta jaune noir PROGRAMME P.7 ECONOMIE TRANSITOIRE FANANAN-TANY DECHETS URBAINS Interventionnisme critiqué BIRAO FOTOTRA A VALORISER L inaccessibilité aux intrants notamment aux engrais induit

Plus en détail

Conversations en ligne : descriptions, perspectives. Louise Ouvrard

Conversations en ligne : descriptions, perspectives. Louise Ouvrard Conversations en ligne : descriptions, perspectives Eléments théoriques La variation Quelques caractéristiques du discours électronique La langue malgache Le corpus Présentation Analyse Quels apports à

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail