LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante."

Transcription

1 ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT

2

3 L édito Mety hanaitra anao ity lohatenin ny matoan-dahatsoratry ny gazetintsika ity, fa amiko dia tohin ireo hafatra voavakinao tao anatin ny laharana voalohany «Ny Soa Toavina maha-socolait». Ity laharana ity dia hamelabelatra ny fiovam-pihetsika tsy maintsy hisalorantsika manoloana ireo mpamatsy ara-bokatra, ireo mpiombon antoka ary ireo mpanjifa ivelany. Maniry indrindra aho hitafa aminareo rehetra ato anaty andalana vitsivitsy, mahakasika ny fanavaozam-pisainana ato anatin ny orinasa, azontsika eritreretina ny hoe : hanjary mpanjifa anatiny koa ny orinasa Asaiko manokana ary ianao hamaritra NY MENDRIKA INDRINDRA amin izao fomba fijery manaraka izao, amin ny alalan ny kalitao ankapobeny, izay voafaritr ireto foto-kevitra telo ireto : fahatsaran ny vokatra, fahatomomban ny enti-mamokatra, fahalavorarian ny fifandraisana. Nampiasaiko ho anao ny fiteny mahazatra «KALITAO». Ny fidirantsika an-tsehatra amin ny fanatsarana ny vokatra dia tsy horesahina eto intsony, kanefa kosa resy lahatra ary ve isika fa mitovy amin izany ihany koa ny kalitaon ny fanatanterahana sy ny kalitaon ny fifandraisana? Araka ny efa voalaza ombieny ombieny, dia milaza miaramahita isika ny amin ireo ezaka fampandrosoana tao anatin izay taona faramparany izay mba hahafahana miaramanatratra ireo tarigetrantsika. Ny ampahany amin izany fahombiazana izany dia mifamatotra amin ny fepetra maharitra, dia ny tsy maintsy haharetana. Satria ankehitriny isika dia miaina ao anatin ny tontolo izay mivoatra faran izay haingana, anatin ny tontolon ny fifaninanana, izany dia midika fa zava-dehibe tsy azo lavina ny fanolorana fomba fiasa manara-penitra. Ny fomba fiasa hita taratra amin ny fahatsarany sy ny fahalavorariany dia singa iray anatin ny fifaninana izay ankasitrahana tokoa. Aza hadinoina fa ny kalitao dia tsy ankasitrahana amin ny fomba ivelany fotsiny, fa izy dia tsaraina indrindra koa araka ny atiny. Mba hahatrarana ny tarigetra, dia tsy maintsy mampihatra izany fepetra izany isan andro isika amin ny fomba enti-mamokatra sy enti-mifandray ato anatin ny orinasa. Hiaingantsika ary izao vinavina izao, andeha hatao hoe : ny mpiara-miasa tsy anavahana, sampan asa, na sampandraharaha hafa, na foibe dia mpanjifa koa, (izay no mahatonga ny famaritana hoe mpanjifa anatiny). Mitovy hatrany ve ny fomba fisainako? Manaiky ve aho raha ny mpivarotra na mpamatsy iray no manao fihetsika toy ny ataoko amin ny mpiara-miasa amiko? Raha mieritreritra minitra vitsy isika dia hamaly tsia avy hatrany. Ny fahamendrehana koa dia ny fananana ny fomba fisainan ny mpamatsy manoloana ireo mpiara-miasa aminy, mamatsy asa lavorary, vokatra tonga lafatra, sy raharaha manara-penitra, ary fampitam-baovao tsy misy tomika. Ny tena zava-dehibe dia mihazona hatrany izao fomba fisainana izao: Moa ve ny asa vitako na nampitaiko tamin ny mpiara-miasa amiko, tamin ny lehibe mpifehy ahy dia ahafahan izy ireo manana fahavitrihana hatrany?. Raha manana izany fahendrena izany ny rehetra dia tratrantsika ny fahamendrehana ary hampitomboantsika koa ny fahavitriantsika, izany hoe ho an ny orinasa dia hiasa amim-pahatoniana satria ireo mpiara-miasa amintsika dia hataontsika tahaka ireo mpanjifa. Mba hahatratrarana izany tanjona goavana izany, isika dia tsy maintsy : - Mampitombo ny fifandraisantsika eo anivon ny asa amin ny fahamendrehana sy fifanajana. - Manana fifandraisana maharitry ny fahamendrehana sy ny sampan asa miandraikitra ny mpanjifa anatiny sy ivelany. - Miantoka ny fahavitrihana hentitra hatrany hatrany. - Manohana ny fomba fisainana tsara rehetra. - Mihevitra fa ny fankasitrahana sy ny valisoa ho an ireo mendrika dia tanterahina ao anatin ny fifampitokisana. Ny drafitra fampiofanantsika, dia hizotra manaraka izay voalaza, ny fivoarantsika ato amin ny orinasa dia miankina amin ny fitombon ny fahavitrihana, ary ireo fanombanana dia ahafahan ny mpandray anjara mihambo Ny fahamendrehana. Nandritra ny taona maro isika dia nanana ny teny filamatra Ny kalitao, nahoana kosa ankehitriny no tsy hisafidy Ny fahamendrehana? NY FAHAMENDREHANA L EXCELLENCE Ce titre peut vous surprendre pour l éditorial de notre publication interne, pour moi il est tout simplement la suite des messages que vous avez lus dans l éditorial de notre premier numéro «LES VALEURS DE SOCOLAIT». Celui-ci traitait en partie du changement de comportement que nous devions adopter vis à vis de nos fournisseurs, partenaires et clients externes entre autres. Je souhaiterai aborder avec vous tous dans ces quelques lignes, notre changement de comportement dans l entreprise, faisons une supposition : si l entreprise devenait notre client interne... Je vous propose de définir L EXCELLENCE de la manière suivante, par la Qualité globale, qui elle même se définit en 3 thèmes : La qualité produit, la qualité opérationnelle, la qualité relationnelle. Je viens d utiliser un mot familier pour vous tous «QUALITE». Notre implication dans la qualité de nos produits, n est plus à démontrer, mais sommes nous persuadés que cela est le cas pour la qualité opérationnelle et la qualité relationnelle? Comme nous l avons évoqué à plusieurs reprises nous sommes conscients de tous les efforts développés au cours de cette dernière année pour que nous puissions atteindre tous ensemble nos résultats. Une partie de cette réussite est liée à une remise en cause permanente, qu il faut maintenir. Car aujourd hui nous sommes dans un monde qui bouge rapidement, dans un environnement toujours plus concurrentiel, ce qui signifie qu il est plus important que jamais d offrir un service de qualité. Un service reconnu pour sa qualité et son efficacité est un élément de concurrence des plus appréciables. N oubliez pas que la qualité ne s apprécie pas seulement à l extérieur, elle peut s apprécier aussi de l intérieur. Pour atteindre cet objectif, il faut que cette remise en cause nous l appliquions à nos comportements opérationnels et relationnels dans l entreprise et tous les jours. Partons de l hypothèse que tous nos collègues, qu ils soient du même service, du même département, des autres départements, de la plateforme ou du siège soient des clients, (d ou la définition de client interne). Auraije le même comportement? Est ce que j accepterai qu un commerçant ou un fournisseur se comporte envers moi comme je me comporte envers mes collègues de travail? Réfléchissons ensemble quelques minutes et la réponse sera non. L Excellence c est aussi d avoir un comportement de fournisseur envers ses collègues, je fournis un travail de qualité, un produit de qualité, un service de qualité, une information de qualité. L important est de garder en permanence à l esprit : «Est-ce que le travail que je viens de terminer ou de transmettre va permettre à mon collègue, à mon supérieur hiérarchique d être plus performant par la suite?».si tout le monde adopte cette philosophie nous atteindrons l excellence et nous augmenterons nos performances donc celles de l entreprise, nous travaillerons avec plus de sérénité car nos collègues nous considéreront nous aussi comme des clients. Pour atteindre cet ambitieux objectif nous devrons : - Développer nos relations dans le travail avec dignité et respect. - Avoir une communication permanente de l Excellence et du service client interne/externe. - Mettre en place des standards de performance de plus en plus exigeants. - Soutenir les comportements positifs. - Faire en sorte que la reconnaissance et la récompense des mérites se fassent dans un climat de confiance. Nos plans de formations, iront dans cette direction, toutes nos évolutions dans l entreprise sont et seront axées sur le développement des performances et leurs évaluations devront permettre à chaque acteur d ambitionner L EXCELLENCE. Nous avions pendant des années un maître mot «LA QUALITE», pourquoi aujourd hui ne choisirions-nous pas «L EXCELLENCE»? Philippe PENOUTY (Tale Jeneraly/Directeur Général)

4 Ny laboratoara dia sampan asa iray mahaleo-tena eo ambany fitantanan ny Talen ny kalitao. M anatontosa ny fitiliana ara-tsimika sy ara-biolojika ahafantarana ny taharo sy ny hatsaran ny ronono manomboka eo amin ny fanangonana azy mandrapahatongany ho vokatra voahodina izy. Miditra amin ny sehatr asa maro samihafa ny laboratoara ary fitaovana iray tsy azo iodovirana mba ho fiarovana ny vokatra ho ara-pahasalama tanteraka. Manome ny andinindininy ny amin ny famokarana ary mamantatra raha toa ka madio na tsia ny vokatra mandra-pahatongan ny eny amin ny mpanjifa. Mandray anjara feno amin ny antanan-tohatry ny sehatra famokarana mba ho fanaraha-maso sy fampiharana ny toro-hay momba ny fanodinana vokatra ny laboratoara. Ny tanjon ny famakafakana ataon ny laboratoara dia miantoka ny hatsaran ny vokatra. Araka ny asa iandraiketany dia izy no mason ny fanapahana amin ny lafin ny kalitao. Mamoaka ny tsoa-kevitra momban ny toro-lalana manara-penitra mifototra amin ny valin ny fitiliana. Andraikiny ny mamoaka valim-pitiliana marina sy azo antoka. Noho izany ny laboratoara dia teren ny fahalalany noho ny filàna ny traikefany. Ny fitiliana izay mitaky fanarahana toro-lalana ara-teknika mahitsy sy ara-dalana, ny fampiasana ny fitaovana nahazoan-dalana dia manampy amin ny fomba fiantohana amin ny kalitao manara penitra takin ny NF EN ISO Sommaire EDITORIAL...P.3 LABORATOIRE. P.4 DIRECTION COMMERCIALE...P.5 USINE...P.7 H.S.E..P.8 Le laboratoire est un service indépendant sous la direction qualité. I RESSOURCES HUMAINES...P.9 LA COLLECTE DU LAIT...P.10 l réalise les analyses de chimie et de microbiologie déterminant la composition et la qualité du lait à la réception ainsi que tous les produits finis. Le laboratoire intervient dans des secteurs différents, c est un outil incontournable pour la prévention d une santé saine, il donne des renseignements sur la composition des produits et consiste en outre à savoir si les denrées sont ou non propres à l usage auxquelles elles sont destinées. Il est présent dans toutes les étapes de la chaine de production pour contrôler les spécifications dans le processus de fabrication. L objectif des analyses du laboratoire est principalement d assurer la qualité des produits finis. Par rapport à son activité, le laboratoire est l œil du décisionnaire en matière de qualité, il fournit l argument sur lequel les procédures objectivent ses processus sur la base des résultats d analyses. Il a pour rôle de fournir des résultats fiables, de garantir leur qualité, de fournir des données analytiques d une exactitude et d une fiabilité adéquate. Ainsi, le laboratoire est dans l obligation de savoir à quel usage sont destinées les analyses et impose de suivre des procédures techniques précises et normalisées, d utiliser des matériels autorisés d emploi et de mettre en œuvre un système d assurance qualité conforme NF EN ISO Edité par SOCOLAIT S.A Route Mandaniresaka Antsirabe 110 MADAGASCAR Régie Publicitaire: SOCOLAIT 3ème étage Imm. DIGITAL Ivandry - Antananarivo 101 Tél.: Directeur de publication: Philippe PENOUTY Rédacteur en chef: Doria GIZY Comité de rédaction: Bruno Landrier, Vincent Lucas, Rosa Andriamifidy, Hanitriniaina Raveloarimino, Emmanuelle Rasoarahona Ont collaboré à ce numéro: Hélène Pfeiffer, Jean De Dieu Rakotondranaivo, Bakoly Andr iana solo, Ma minir ina Rasamuel, Nadia Raharison, David De La Fuente Crédit photos: Socolait Impression: Print Express Maminirina RASAMUEL (Lehibe an ny Laboratoara/ Responsable Laboratoire) Nombres d exemplaires: 350

5 Ny tohilany fampangatsiahana La chaine du froid Ny tohilany fampangatsiahana dia voafaritry ny asa fikirakirana entana (fitaterana, fibatàna, fitehirizana) izay mitsinjo ny fihazonana ny vokatra ao anatin ny mari-pana voatondro, ka hiantohana indrindra ny fihazonana ny maha arapahasalamana azy sy ny kalitaon ny tsiro. Ny tohilany fampangatsiahana dia midika ho antoka lehibe sy porofo ny maha ara-kalitao ireo vokatra Socolait eo anatrehan ny mpanjifa, ny vokatra azo avy amin ny ronono dia vokatra marefo, raha toa ka tsy ara-dalana ny tohilany fampangatsiahana, miha-mafana izy reo, ary miha-mangatsiaka indray avy eo, ka eo amin izany no ahafahan ireo «bactéries» mitombo mian-dalana. Ny fitelemana ireo «bactéries» ireo dia mety mahatonga ny fanapoizinana ara-tsakafo. Noho izany ary dia zava-dehibe tokoa ny fandraisan ny Socolait fepetra amin ny alalan ny fitaovana sy ireo mpiasa ao aminy, ho fanajana ny tohilany fampangatsiahana, sy ny fitakiana mandrakariva izany isan ambaratonga amin ireo toerana rehetra ahitana vokatra Socolait, manomboka eo amin ny fitahirizana ka hatrany amin ny mpanjifa, ampiharina koa izany fepetra izany amin ny famatsiana sy ny fitahirizana any amin ireo mpivarotra. La chaîne du froid est caractérisée par l'ensemble des opérations logistiques (transport, manutention, stockage) visant à maintenir les produits à une température donnée pour assurer le maintien de sa salubrité ou ses qualités gustatives. La chaine du froid constitue un enjeu majeur et un gage de qualité des produits Socolait pour les consommateurs, les produits laitiers sont des produits fragiles, en cas de rupture de la chaîne du froid, les produits se réchauffent, puis se refroidissent, ce qui altère la qualité du produit. L'ingestion de ces bactéries peut alors entrainer une intoxication alimentaire. Il est donc extrêmement important que Socolait, à travers son matériel et ses employés, prennent un véritable engagement de respect de cette chaine de froid, et la revendique à tous les niveaux ou nous trouvons nos produits, du stockage jusqu au consommateur final, en passant bien sur par la livraison et le stockage chez le client. Road Show Socolait niaraka tamin-drajao Road Show Socolait avec RAJAO Ny fisian ny fatra vaovao ho an ny ronono mandry dia nanamarika tokoa ny hetsika ara-barotra tamin ity volana ity. Niompana tamin ity vokatra ifaninana iray ity tokoa ny varotra nandritra ny volana maromaro, Socolait dia nanapa-kevitra nikarakara hetsika goavana iray hanakaikezana bebe kokoa ny mpanjifa, sy hanomezana lanja ny Ronono Mandry Mamy Socolait. Nandritra ny herinandro no nanatanterahana ny road show nanerana an Antananarivo, niaraka tamin ireo ekipan ny varotra sy ny haivarotra, ary koa ny mpanakanto malaza RAJAO, nitety ny tanan-dehibe nampahafantatra io vokatra vaovao io izy ireo. Nafonja sady nafana ny hetsika, ary matoky isika eo anatrehan ireo hafatra sy ny kalitaon ny Ronono Mandry Mamy izay vokarintsika, ka hanohy handresy lahatra. Ny tanjona dia ny mba hanohizana hatrany ny Road show any amin ireo tanan-dehibe hafa amin ny fotoana manaraka, hatomboka amin Antsirabe izany mazava ho azy Le développement d un nouveau format pour le lait concentré fut l évènement commercial du mois. Le marché étant sur ce produit très concurrentiel depuis des mois, Socolait a décidé d organiser un évènement majeur pour aller vers le consommateur, et promouvoir le LCS Socolait. Un road show dans tout Tana a eu lieu pendant une semaine, avec l ensemble des équipes commerciales et marketing de Tana, ainsi qu avec la star RAJAO, nous avons parcouru la ville pour lancer ce nouveau produit. L ambiance était forte et chaleureuse, et nous sommes confiants dans nos messages et dans la qualité de notre LCS pour continuer de convaincre. L objectif est de continuer ce Road Show dans d autres villes à l avenir, en commençant bien sur Vincent LUCAS par Antsirabe (Tale Ara-Barotra/Directeur Commercial & Marketing)

6 PUB PRINT EXPRESS SOCOLAIT EN IMAGES Les gagnantes d un challenge commercial organisé à l interne. Mme Sophie Femme de ménage- (photo à gauche) et Mme Vola -Supply Chain- Le «Road Show», animé par l acteur Rajao, qui s est tenu au mois de juillet dernier a drainé une foule immense sur son passage

7 Ny orinasa Socolait, ao anatin ny fanatsarana maharitra L usine Socolait, une usine en amélioration constante Telo volana taorian ny laharana voalohan ny Soco Sera dia nivoatra fanavaozana. tokoa ny zava-drehetra ato amin ny toeram-piasana Socolait Antsirabe. Trois mois après notre premier numéro Soco Sera les choses ont bien Tontosa tanteraka ity dingana ity ankehitriny ary izany dia ahafahantévolué sur notre site Socolait d Antsirabe. sika mamaritra mazava ireo asa hotanterahina ho an ny toeramcette phase est maintenant terminée et nous permet d avoir une pamokarana ary koa ireo fanatsarana ho an ny fitaovam-piasana. vision claire des travaux à entreprendre pour les bâtiments et des Izany koa dia mbola ahafahantsika mahafantatra ny sandan ireo vinaaméliorations à apporter pour les matériels. vinan asa ireo, ary koa mametrapetraka tsara ny lafiny ara-bola ilaina Elle nous permet aussi de connaitre le cout de ces projets, et de plamba handoavana ireo orinasa nanatanteraka ny nifier la trésorerie nécessaire pour payer nos enasa. treprises sous traitantes. Araka ny fandaminana, ny famokarana yaourt dia Comme prévu la production yaourt sera transférée hafindra ao amin ny toeram-pamokarana B dans le bâtiment B (Krumps) alors que le bâtiment (Krumps), ka noho izany ny toeram-pamokarana A principal sera rénové presque entièrement. A dia havaozina tanteraka. Nandritra ny volana Jona no nanomboka ny asa voalohany, toy ny: Depuis le mois de juin les premiers travaux ont commencé, il s agit : - Fanomanana ny toeram-pamokarana B, loko voatokana,sy ny rindrina ary ny valindrihana. - Préparation du bâtiment B, peinture spéciale alimentaire sol, murs et plafonds. - Conception d un sas personnel aux normes (vestiaires, toilettes) - Conception d un sas de transfert des matières premières isolées pour limiter les sources de contamination - Fabrication et pose du «lactoduc», une tuyauterie inox alimentaire qui conduira le lait sur plusieurs centaines de mètres, travaux réalisés par notre partenaire «Labomeca» - Fabrication et pose des différents circuits (inox alimentaire principalement) nécessaires à la fabrication yaourt (vapeur, eau froide, etc), idem. - Famoronana toerana fiomanana manara-penitra mialohan ny idirana anaty efitrano famokarana (trano fampirimana akanjo, trano fidiovana). - Famoronana lalana famindrana akora fanodina voaaro tsara mba hisorohana ny fototry ny fifindran ny mikraoba. - Fanamboarana sy fametrahana «lactoduc»; fantsona iray vita amin ny «inox alimentaire» izay ikorianan ny ronono an-jatony metatra maromaro, ireo dia asa notanterahin ny «Labomeca». - Fanamboarana sy fametrahana fantsona samihafa (inox alimentaire hatrany), ilaina ho amin ny famokarana yaourt (entona, rano mangatsiaka, sns ) Ny fikojakojana dia natao indrindra koa mba hanavaozana fitaovam-piasana lehibe maromaro: - «Cuverie CIP» (sinibe efatra) - Sinibe fandalovana 6000L (asina ny ronono ampiandrasina ahodina ho «yaourt») - «Pasteurisateurs» maromaro (ex : Alfa-Laval) - Famoronana sy fametrahana «agitateur» manokana ao anatin ny sinibe 5000l «yaourt» mba ahazoana fangaro ara-dalana amin ny vokatra. Ny ankamaroan ireo fitaovana ireo dia efa napetraka ao amin ny efitra izay ahafahana mamokatra sahady amin ny fiandohan ny volana oktobra. Notre Maintenance s est particulièrement appliquée à rénover plusieurs matériels clefs : - Cuverie CIP (quatre cuves) - Cuve 6000L tampon (lait en attente pour yaourt) - Plusieurs pasteurisateurs de très bonne marque (ex :Alfa-Laval) - Conception et pose d un agitateur spécial dans la cuve 5000 yaourt pour une agitation complète et homogène du produit Certains de ces éléments sont déjà posés dans la salle qui sera en état de produire début octobre probablement. Par ailleurs la rénovation de la salle principale Farilac (Hatmaker) est commencée depuis une semaine, les travaux vont bon train. Les stocks de produits sont maintenant terminés, LCS, Farilac, Fromages et l ensemble des salles sont prêtes à recevoir les équipes de rénovation. Fa ny fanavaozana ny efitrano voatokana Farilac (Hatmaker) kosa dia natomboka efa ho herinandro izao, mizotra ara-dalana ny asa rehetra. Efa voahodina avokoa ireo vokatra tahiry, Ronono Mandry Mamy, Farilac, Fromages ary ny akamaroan ny efitra dia efa vonona ho amin ny fandraisana ireo mpiara-miasa rehetra hanatanteraka ny Bruno LANDRIER (Talen Ivo-Toerana / Directeur de Site)

8 Ny Fampijoroana ny rafitra H.S.E (Hygiène-Sécurité-Environnement) Tamin ity taona ity, SOCOLAIT dia niditra ao amin ny rafipanaraha-penitra iraisam-pirenena. Noho izay tanjona izay, ny H.S.E dia paika iray afahana manara-maso ireo tranga mifandray amin ny loza mety hiseho eto anivon ny orinasa. La mise en place du système H.S.E (Hygiène-Sécurité-Environnement) SOCOLAIT est entrée cette année dans une politique de mise aux normes internationales. Dans cet objectif le dispositif H.S.E est une pratique de contrôle des aspects liés aux risques professionnels au sein de l entreprise. Ireo tranga ireo dia miompana amin ny resaka fitsipipahadiovana, ny fiarovana ny mpiasa sy ny fanajana ny tontolo iainana.ohatra iray, ao anatin ny rafitra H.S.E, ny fistipi- pahadiovana dia aseho mazava tsara, ny mpiasa tsirairay dia hampafantarina sy hofanina makasika ny loza, ny fitaovampiarovana dia soloina matetika. Voafehy arak izany, ireo loza mety hiseho. Mba ho fametrahana ny rafitra H.S.E eto anivon ny orinasa SOCOLAIT Antsirabe, ny sampan-draharaha tekinika dia namorona asa manokana iray, ny faran ny volana Aogositra lasa teo. Ny dingana lehibe natao tamin izany dia ireto avy : -Fanaraha-mason ireo asa vaovao, fanavaozana sy fanaraha-penitry ny orinasa SOCOLAIT, ohatra, ny fanamarihana ireo akora ampiasaina, ny fitondrana ireo fitaovam-piarovana, na koa ny fanarahamason ireo tambazotran herin aratra. Efa nandroso ireo ka hatratra 60% ny asa fanavaozana hatramin ny faran ny volana Septambra. -Ny fametrahana mari-pamantarana eny amin ireo faritra famokarana sy fikolokolona (lafiny fanamiana, fitsipi-piasana sy fahadiovana, fiarovana manokana ) -Ny fametrahana mari-pamantarana eny amin ireo faritra ivelany (famantarana eny an-dalàna, lalan ny mpandeha tongotra, sns ) -Ny fampiofanana mahakasika ny fanajana ireo fomba fiasa tsara mba hamerana ireo trangandoza. Ireo fanajariana ireo, izay natao mba hampandeha ny asa eo ambany rafitra H.S.E, dia tafiditra manontolo ao amin ny dingana ahatrarana ilay fanamarinana ISO, izay iompanan i SOCOLAIT ankehitriny. Eny fa na dia mifandray amin ny sapan-draharaha tekinika aza izany, dia ilaina foana ny fiaraha-miasan ireo sampana isantokony anefa no ahatrarana izany fanamby izany, manomboka any amin ny Fanangonana, Kalitao, Famokarana, Fitantanambola, Fitantam-barotra Ces aspects sont focalisés sur les règles d hygiène, la sécurité des travailleurs et le respect de l environnement. Pour exemple, en système H.S.E, les règles d hygiène sont clairement affichées, le personnel est formé et informé des dangers, les équipements de protection individuelle (E.P.I) sont mis à disposition et changés régulièrement. Ainsi les risques sont maitrisés. Un poste spécifique a été spécialement créé fin Août au sein du Département Technique pour mettre en place la politique H.S.E au sein de l usine SOCOLAIT d Antsirabe. Les grands axes de travail de l équipe sont : -La supervision des travaux neufs relatifs à la réhabilitation et la normalisation de l usine SOCOLAIT, comme par exemple la vérification des matériaux utilisés, le port des EPI ou encore le contrôle des nouvelles installations électriques. Déjà entamés, ces travaux atteindront 60% d avancement à la fin Septembre. - La mise aux normes de la signalisation dans les zones de production et de maintenance (code vestimentaire, règles de travail et d hygiène, protections spéciales ). - La mise aux normes de la signalisation dans les zones extérieures (signalisation routière, passages piétons ) - La formation des personnes aux respects des bonnes pratiques de travail afin de limiter les risques d accident ou même de contamination. Ces aménagements en vue d un fonctionnement sous le système HSE font partie intégrante du processus de certification ISO dans lequel est engagée SOCOLAIT. Cependant, bien que rattaché au Département Technique, le concours de chaque service est nécessaire afin de réussir ce challenge, notamment ceux de la Collecte, de la Qualité, de la Production, des Finances et du Marketing. David DE LA FUENTE (Tale Teknika / Directeur Technique)

9 Fanovana ho amin ny tsara kokoa Changements pour le meilleur Maro ireo fanovana nambara fa ho tanterahina eto amin ny orinasa. Ho fintinina etoana ireo ezaka vita momba ny mpiasa. FEPETRA ANKAPOBENY vaovao no mifehy antsika nanomboka tamin ny volana aogositra 2013 lasa teo. Manana lanja lehibe ao anatin izany FEPE- TRA ANKAPOBENY izany ny FAHADIOVANA, ny FIAROVANA ary ny FIFE- HEZANA. Hanao izay afany hampiaina ireo hevi-dehibe telo ireo ato anatin ny orinasa ny Tompon andraikitra. Maro ireo ezaka atao amin ny lafiny FIDIOVANA sy FIAROVANA. Efa notanterahina ny fiofanana amin ny BONNES PRATIQUES D HYGIENE. Ary misy fanatsarana maro koa entina amin ny fampitaovana ny mpiasa, hiarovana azy ireo amin ny loza. Mba hahatrarantsika ireo fenitra iraisam-pirenena, dia nankinina amin ny Tale Teknika ny fandrindrana eo amin ny FIDIOVANA, FIAROVANA ary TONTOLO IAINANA. Ary misy Assistante noraisina hanampy azy amin izany. La Direction avait annoncé plusieurs changements depuis un an. Il me revient ici de faire le point des avancements réalisés dans le domaine des Ressources Humaines. Nous disposons depuis le mois d août 2013 d un nouveau REGLEMENT INTE- RIEUR. Ce nouveau Règlement Intérieur accorde une importance particulière à l HYGIENE, la SECURITE et la DISCIPLINE. Ce sont des thèmes forts, et la Direction entend les faire vivre afin que chaque employé de la SOCOLAIT se les approprie. En matière d HYGIENE et de SECURITE, nous avons déjà mis en œuvre des formations sur les Bonnes Pratiques d Hygiène (voir numéro précédent de Soco Sera). Des améliorations sont périodiquement apportées sur les équipements individuels et collectifs de protection et d hygiène. Afin que nous puissions atteindre les meilleurs standards internationaux, et pour faire partager la culture HSE (Hygiène, Sécurité et Environnement) à l ensemble du personnel, le Directeur Technique a été chargé de piloter les activités HSE. Il sera secondé par une Assistante. Ny fitondran-tena ankapobeny sy ny fahaiza-miaina kosa no misantatra ny FIFEHEZANA. Azo bangoina amin ny teny tokana ireo hevitra ireo: FANA- JANA. Fanajana ny tena, Fanajana ny mpiara-belona, Fanajana ny Asa. Izany no antoky ny fiaraha monina mirindra. Notanterahina ny fampanantenana fanampiana amin ny fampianarana ny zanaky ny mpiasa. Araka ny voalazan ireo manampahaizana amin ny fanabeazana, dia mahazo tombony kokoa ireo ankizy mandalo amin ny garabola. Rariny sy hitsiny raha mba mahazo izany tombontsoa izany koa ny zanaky ny mpiasan ny Socolait. Izany no antony nanokafana ny fanampiana ho amin ny fianarana ho an ny ankizy feno 3 ka hatramin ny 19 taona amin ny 31 jolay Endrika roa no nanantanterahana io fanampiana ho amin ny fianarana io. - Tao ny fanomezana ara-bola, izay nampidirina tamin ny karaman ny volana aogositra Tao koa ny fanomezana fitaovampianarana, notanterahina tamin ny volana septambra 2013 Ireo tetik asa ireo no tanteraka dia noho ny fiaraha miasa matotra nisy teo amin ny Mpitantana sy ny Délégués. Antenaina ny fitohizan izany fiaraha miasa izany, ka hahafahana manatanteraka ireo tetik asa hafa : fijerena ny fahasalaman ny mpiasa sy ny ankohonany, ny fandrindrana sy ny fitovozana ireo fahaiza manao sy fahaiza miaina ilaina amin ny endrik asa vaovao izay hapetraka, ny fametrahana ny bonus ho maripankasitrahana ny ezaka vita eo amin ny fanatanterahana ny asa. Ny fanomezana risika ho an ny tsirairay eo amin ny fanatanterahana ny asa no tanjon io bonus io. Amin izany dia samy hahazo tanjona ho tratrarina ny mpiasa tsirairay. Ny tanjona rehetra, sy ny fomba andrefesana ny fahatrarana azy, dia tokony ho hazavain ny lehibeny amin ny mpiasa iandraiketany. Ireo mpiasa manantanteraka ny asany antsakany sy andavany, mahatratra ireo fanamby nomena azy sy nekeny, ary mandray andraikitra amin ny fampiroboroboana ny orinasa, dia mety hahazo bonus na mari-pankasitrahana mety ho tonga hatramin ny karama telo volana. Efa mihantra amin ireo cadres io rafi-karama misy mari-pankasitrahana io. Ary faniriana ny hametrahana izany amin ny mpiasa rehetra manomboka amin ny Les règles de conduite générale et de savoir être sont les premiers points inscrits dans le thème DISCIPLINE du Règlement Intérieur. Ce sont dès règles de bon sens, et peuvent être résumées en un seul mot : RESPECT. Respect de soimême, Respect de son prochain, Respect de son travail. C est la condition d une vie en communauté harmonieuse. Nous avons mis en place également un mécanisme d aide scolaire, destiné à soutenir les salariés dans leur effort de scolarisation de leurs enfants. Des études ont démontré que le taux de réussite scolaire des enfants ayant effectué le préscolaire est supérieur à la moyenne. Il est important que les enfants de SOCOLAIT puissent avoir cette chance. C est pourquoi, il a été décidé que le bénéfice de l aide scolaire soit ouvert aux enfants âgés de 3 à 19 ans au 31 juillet Cette aide scolaire a pris deux formes : - Une aide en numéraire, intégrée dans les fiches de paie et payée en août Une dotation en fournitures scolaires, distribuées en septembre Ces différentes avancées ont pu se faire grâce à la franche et sincère collaboration des délégués du personnel. Nous avons entamé un dialogue social qui nous permettra certainement de réaliser les autres projets en cours d étude : mise en place d une couverture médicale complémentaire pour les salariés et leurs ayants droits, Gestion Prévisionnelle des Emplois et Compétences, mise en place de bonus de performance. Annoncé depuis le début de l année, ce dernier point mérite quelques explications. Le bonus de performance vise à stimuler, motiver et récompenser individuellement les employés. Dans ce système, chaque employé se verra assigner des objectifs périodiques (mensuels, trimestriels ou annuels) par son supérieur hiérarchique direct. Chaque objectif et le système d évaluation correspondant devront être clairement expliqués à l employé. En fonction de son implication dans le travail et l atteinte de ses objectifs, un employé pourra percevoir un bonus de performance pouvant représenter jusqu à 3 mois de salaire. Ce système est actuellement en place pour l ensemble des cadres de SOCOLAIT. La Direction souhaite l étendre à l ensemble des salariés dès Doria GIZY (Talen ny Fitantanana sy ny Ara-bola / Directeur Administratif et Financier)

10 Ny Fanatsarana ny Kalitaon ny Ronono L amélioration de la qualité du lait Miisa telo ny singa ao anatin ny kalitaon ny ronono : ny tsy fisian ny zavatra hafa fanampiny, ny taharo fizika, ary ny fahabetsahan ny mikraoba misy ao aminy. Ny Orinasa Socolait dia miara-miasa amin ireo toby fanangonan-dronono mikasika ireo singa telo ireo mba ahazoany antokany ronono tena tsara, misy otrikaina ary madio. Ny sampan asa manokana ato amin ny Socolait dia voakasika mivantana amin izany satria izy no misahana ireo karazana fitiliana rehetra momba ny ronono. Manana fitaovana harifomba ahafahany manao ny fitiliana ireo ronono raisin ny Orinasa isan andro izy. Ny asa atao mba hiadiana amin ireo hosoka, izay antony voalohany mampidina ny kalitaon ny ronono, dia ny fanaraha-maso hentitra, izay miafara amin ny fanasaziana rehefa voaporofo izany hosoka izany. Ny ankapoben ny hosoka karohina eto dia ny fanampoan-drano sy zavatra simika hatao ao amin ny ronono. Raha mikasika ny fanatsarana ny taharon ny ronono indray dia tena asa irotsahana eny anivon ny mpiompy mihitsy izy io. Ny sakafo homenan ilay biby (omby vavy) dia misy fihatraikany amin ny izany. Ny omby vavy tsy ampy sakafo dia tsy mamokatra afa tsy ronono mahantra araotrikaina. Ny Socolait dia efa eo andalam-pametrahana teknisiana momba ny fiompiana izay hanoro hevitra ireo mpiompy eny antoerana mikasika ny sakafom-biby tena hilaina. Farany, ny tahan ny mikraoba ao anatin ny ronono dia tsy maintsy fehezina isan ambaratonga eo amin ny mpamokatra sy ny mpamatsy: Tsy tokony hisy azo kianina mihitsy ny momba ny fahadiovana, manomboka amin ireo olona mpikirakira, ka hatrany amin ny fitaovana ampiasaina rehetra. Tsy maintsy araha-maso ny fampangatsiahana mandritra ny fitahirizana ny ronono. Mba ahatongavana amin ireo tanjona ireo, ny Orinasa Socolait dia manome fiofanana momba ny fahadiovana, manome sosokevitra momba ny fampiasana ireo fitaovam-panadiovana matihanina, ary mametraka vata fampangatsiahana eny amin ny toby izay mbola tsy manana izany. Noho izany ny Orinasa Socolait dia mampiofana sy miara-dia amin ireo mpiaramiombonantoka aminy ao amin ny sehatry ny famokaran-dronono sy ny firosoana mankany amin ny fanatsarana ny kalitao. Noho ny ezaka vita, dia homena valisoa ireo izay manana ronono tena tsara. La qualité du lait contient trois composantes : l absence de substances ajoutées, la composition physique, la charge microbiologique. Socolait travaille avec les centres de collecte sur ces trois aspects afin de garantir un lait sain, riche et propre. Le laboratoire Socolait est fortement impliqué dans le processus puisqu il effectue toutes les analyses sur le lait. Il s est équipé en matériel automatisé de pointe pour les analyses quotidiennes sur les laits réceptionnés à l usine. Le travail effectué pour lutter contre les comportements de fraude, première cause de dégradation de la qualité du lait, consiste d autre part à effectuer des contrôles stricts aboutissant à des pénalités si la fraude est avérée. Les principales fraudes recherchées sont l ajout d eau et de stabilisants chimiques. En ce qui concerne l amélioration de la composition physique du lait, il s agit d un travail de fond auprès des éleveurs : en effet, le principal facteur jouant sur la composition du lait est l alimentation que reçoit l animal. Un animal mal alimenté produira un lait pauvre en nutriments, ainsi Socolait est en train de mettre en place un réseau de techniciens d élevage qui conseilleront sur place les éleveurs quant à l alimentation la plus adaptée. Enfin, la charge en microbes dans le lait doit être limitée à tous les niveaux du réseau de production et d approvisionnement : l hygiène doit être irréprochable, tant au niveau des personnes que du matériel. La chaîne du froid doit être respectée. Pour achever ces objectifs, Socolait dispense des formations sur l hygiène, propose des produits de nettoyage professionnels et installe des tanks à lait réfrigérés dans les centres de collecte qui n en ont pas. Les résultats de ce travail sont déjà ressentis sur la qualité du lait, par exemple la matière grasse des laits a augmenté de 9% au cours du premier semestre. Ainsi, Socolait forme et accompagne les acteurs de son réseau de production laitière dans la démarche d amélioration de la qualité. Leurs efforts sont récompensés par une prime pour les meilleurs laits. Hélène PFEIFFER (Dokotera Veterinera Lehiben ny Sampana Fanangonana / Docteur Vétérinaire Resp Collecte)

11

12

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby.

fifandraisantsika andraikitra, eo amin ny tsirairay, eo amin ny voary rehetra manan aina ary koa, eo amin ireo taranaka hoavy mandimby. S AT A M O M B A NY TANY SAVARANONANDO Tonga eo amin ny kihon-dàlan dàlanan ny tantaran ny tany isika, izao tokoa mantsy no fotoana hanapahan ny zanak olombelona hevitra amin izay mety hoaviny. Eto amin

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR

ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 SOCOLAIT 1ÈRE CERTIFIÉE À MADAGASCAR ANNEE 2 NUMERO 7 GRATUIT DECEMBRE 2014 1ÈRE SOCOLAIT ÈRE INDUSTRIE AGROALIMENTAIRE LAITIÈRE CERTIFIÉE À MADAGASCAR L édito Io lohateny io, nohon ny nahazoan ny orinasa ireo marimpakasitrahana, izay vokatra

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015

Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA. Tsimbazaza : 11 febroary 2015 Kabarin Andriamatoa Praiminisitra RAVELONARIVO Jean FANDAHARANASA HO FANATANTERAHANA NY POLITIKA ANKAPOBEN NY FANJAKANA Tsimbazaza : 11 febroary 2015 TENY FAMPIDIRANA 1 / 25 Andriamatoa Filoha, Andriamatoa

Plus en détail

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA

Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA JONA 2014 Bitsika MINISITERAN NY FITANTANAMBOLA SY NY TETIBOLA Gazetim-baovao mivoaka isam-bolana - n 0045 - Jona 2014 RAZAFINTSALAMA Ihanta Sahondra Directeur de la Solde et des Pensions Asam-panjakana

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar HUMBOLDT-UNIVERSITÄT ZU BERLIN Landwirtschaftlich-Gärtnerische Fakultät Schriftenreihe des Seminars für Ländliche Entwicklung VIH/SIDA: Un nouveau défi pour la gestion des Aires Protégées à Madagascar

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA

TATITRA ANIVON NY ANTENIMIERAM- PIRENENA TATITRA ANIVON NY ANTENIMIERAM- PIRENENA Praiminisitra Jean RAVELONARIVO 1 TATITRA MANOLOANA NY ANTENIMIERA I 21 MAY 2015 21 MAY 2015 Andininy 54.- Ny Filohan ny Repoblika no manendry ny Praiminisitra

Plus en détail

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires

Madagascar face au changement climatique, l Etat continue de ramer en avant. Echange entre le MEEF et ses partenaires Madagascar face au changement climatique, l Etat continue de ramer en avant Echange entre le MEEF et ses partenaires Fandraisana andraikitra amin ny ady amin ny fanodranana antsokosoka hazo sarobidy OCTOBRE

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser

Ô paysans, ne soyez pas difficiles Retenez les conseils Suivez les et vous verrez Votre revenu s éterniser TARATASIN NY MPAMAKY NY FEON NY MPIOMPY TRONDRO R. Mode Fédération Koloharena Ialamarina COURRIERS DES LECTEURS La Voix Des Pisciculteurs R. Mode Fédération Koloharena Ialamarina n 11 Isaky ny telo volana

Plus en détail

Life and faces of the Alaotra lake, Madagascar

Life and faces of the Alaotra lake, Madagascar http://bop-photolab.org/2015/06/life-and-faces-of-the-alaotra-lake-madagascar/ Life and faces of the Alaotra lake, Madagascar by Arnaud De Grave, June 13th, 2015 Published in Exhibitions, Reportage Life

Plus en détail

Fampianarana sy Fianarana ny Filazantsara

Fampianarana sy Fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky Torolalana ho an ireo Mpampianatra sy Mpitarika ao amin ny Seminera sy Institiota fianarana ny Filazantsara Fampianarana sy Fianarana ny Filazantsara Boky

Plus en détail

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY

FAMOLAVOLANA NY DRAFITRA FAMPANDROSOANA NY LALAM-PIHARIANA OVY NIFARIMBONANA TAMIN IREO MPIKIRA VOAKASIKA FARITRA ITASY MINISTERAN NY FAMBOLENA NY FIOMPIANA ARY NY JONO ----------------------------------- REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana ---------------------------------- MINISTERAN NY TOEKARENA

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

Note pratique. Réseau PRATIQUES

Note pratique. Réseau PRATIQUES Note pratique Ny Herin ny hafatra / Le pouvoir des messages pour la santé préventive Expérience du programme de santé materno-infantile mené par Inter Aide à Farafangana, Madagascar Notice Type de document

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME

RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 RESUME n 9512/DT RAPPORT DE SYNTHESE METHODOLOGIQUE SUR LES OPERATIONS DE LA PHASE 1 (EMPLOI) DE L'ENQUETE 1-2-3, 1995 Juin 1995 ( 1 ) RESUME Depuis la mise en oeuvre des politiques d ajustement structurel, le

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

NY FIOMPIANA KARPA AN-TANIMBARY

NY FIOMPIANA KARPA AN-TANIMBARY NY FIOMPIANA KARPA AN-TANIMBARY Financé par Union européenne Connaissez-vous un moyen simple et efficace de produire du poisson sans investissement couteux? Il s agit de la pisciculture en rizière, appelée

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

FOI et LUMIERE. FINOANA sy FAHAZAVANA

FOI et LUMIERE. FINOANA sy FAHAZAVANA 1000 Bruxelles. FOI et LUMIERE FINOANA sy FAHAZAVANA BELGIQUE-BELGIE P.P 5060 AUVELAIS P 000384 Arahabaina isika mpamaky sy sakaizan ny «Finoana sy fahazavana» fa tafahaona soamatsara eto indray ary hiara

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013

L L E. «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 I B E R A L SOMMAIRE RACCOURCI. Ambotsirohitra/élections 2013 L L E «ETRE UN LEADER N EST PAS UN REVE, C EST UN COMBAT!» I B E R A L Ambotsirohitra/élections 2013 «ELEC- TIONS LI- BRES DEMO- CRATIQUES ET TRANS- PARENTES» Page 2 Bimensuel n 09, vendredi 10 août 2012

Plus en détail

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009

BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 BOKY TOROLALANA FIANGONAN NY NAZAREANA 2005-2009 TANTARA LALAM-PANORENANA FITONDRANA FOMBA AMAM-PANAO TRANO FAMOAHAM-BOKY NAZAREANA Kansas City, Missouri

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

PROJET DE LOI N 027/2007

PROJET DE LOI N 027/2007 REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PROJET DE LOI N 027/2007 DU 25 OCTOBRE 2007 PORTANT LOI DE FINANCES POUR 2008 IMPRIMERIE NATIONALE 2007 - 2 - PROJET DE LOI N 027/2007 PORTANT

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA Public Disclosure Authorized a REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana JIRAMA JIRO SY RANO MALAGASY E1 403 VOL. 1 Public Disclosure Authorized Public Disclosure Authorized ÉVALUATION

Plus en détail

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I)

FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) FANABEAZANA OLOM-PIRENENA RECUEIL DES TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR (VOL. I) Réseau des Jeunes pour la Démocratie et la Politique RECUEIL DE TEXTES SUR LA RECHERCHE DE CONSENSUS A MADAGASCAR

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

édition spéciale 26è édition - Janvier 2013

édition spéciale 26è édition - Janvier 2013 masolavitra édition spéciale 26è édition - Janvier 2013 gratuit Chers tous, Christine Albanel, Ancien Ministre, Président Délégué de la Fondation Orange, est venue de Paris à Antananarivo pour découvrir

Plus en détail

Évaluation de l impact environnemental et social

Évaluation de l impact environnemental et social RÉPUBLIQUE DE MADAGASCAR Tanindrazana - Fahafahana - Fandrosoana PRÉSIDENCE PROJET PÔLE INTÉGRÉS DE CROISSANCE Secrétariat National Évaluation de l impact environnemental et social Cadre de politique de

Plus en détail

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby,

Mbola Manantitra ny fiarahabana tratry ny taona vaovao ho an izay efa nifanatri-tava taminay na ireo efa nifanakalo firarintsoa antariby, Foi et Lumière Finoana sy Fahazavana BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 - Janoary 2010 Matoandahatsoratra

Plus en détail

DISPOSITIONS COMMUNES

DISPOSITIONS COMMUNES ORDONNANCE N 62-074 du 29 SEPTEMBRE 19 62 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics. ( J.O. n 248 du 12.10.62 p. 2248 ) modifiée et complétée

Plus en détail

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009

Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Corporate review Telecom Malagasy SA Laharana faha-2 Janoary 2009 Ventin-kevitra Matoan-dahatsoratra Fampahafantarana an i Madagasikara 4 Ny Nosy Telma, mpandraharaha nasionaly manara-penitra iraisam-pirenena

Plus en détail

FINOANA SY FAHAZAVANA FOI ET LUMIERE

FINOANA SY FAHAZAVANA FOI ET LUMIERE FINOANA SY FAHAZAVANA FOI ET LUMIERE BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 Gazety avoakan ny Mpiaramivavaka Kristianina Malagasy eto Bénélux (M.K.M.B.) Bulletin de liaison et d information de la

Plus en détail

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES

UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES UNIVERSITE D ANTANANARIVO CENTRE DE RECHERCHE EN COMMUNICATION FACULTE DES LETTRES ET SCIENCES HUMAINES DEPARTEMENT INTERDISCIPLINAIRE DE FORMATION PROFESSIONNELLE COMMUNICATION ET DYNAMIQUE LOCALE RAPPORT

Plus en détail

Matoandahatsoratra Hery Rasoamanana

Matoandahatsoratra Hery Rasoamanana BELGIQUE-BELGIE P.P 5060 SAMBREVILLE 6/69330 destinataire 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 10, Laharana 01 Septambra 2006 Matoandahatsoratra Hery Rasoamanana AINA VAOVAO Mensuel

Plus en détail

46 Ordonnance n 62-074 du 29 septembre 1962

46 Ordonnance n 62-074 du 29 septembre 1962 Ordonnance n 62-074 du 29 septembre 1962 relative au jugement des comptes et au contrôle des collectivités publiques et établissements publics (J.O. n 248 du 12.10.62, p. 2248), modifiée et complétée par

Plus en détail

MpANAMORY RAdO RABARILALA

MpANAMORY RAdO RABARILALA ENIM-BOLANA TSY TAFATSANGANA FANJAITRA MIISA 21 NO NESORINA TAO AN-KIBON i LALAINA P.06 N 3190 L u n d i 2 9 j u i n 2 0 1 5 PRIX : Ar 400 zatovolahy NANGALATRA volamena P.06 TENY AM-pASANA : NANONOFY

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

Le malgache. L exemple d une langue sans test

Le malgache. L exemple d une langue sans test Le malgache L exemple d une langue sans test 1. Pourquoi n existe t il pas de cer:fica:on? Peu d échanges commerciaux avec l extérieur Pas d immigra:on importante de «cols blancs» Peu d étudiants étrangers

Plus en détail

Aza miandry JOURNEE SPECIALE DE LA MKMB

Aza miandry JOURNEE SPECIALE DE LA MKMB BELGIQUE-BELGE P.P 5060 SAMBREVILLE 6/69330 Destinataire: 40, Boulevard Bischoffscheim, 1000 Bruxelles. Taona faha 14, Laharana 5 -Octobre 2010 FANOLORANANA Aza miandry Mensuel - Editeur Responsable: Hery

Plus en détail

AMBATONAKANGA SY NY MISIONERA ;

AMBATONAKANGA SY NY MISIONERA ; AMBATONAKANGA SY NY MISIONERA ; Raha miteny hoe Ambatonakanga isika protestanta amin izao andro ankehitriny izao dia ny trano fiangonana vita amin ny vato no tonga ao an-tsaintsika voalohany ary vitsy

Plus en détail

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent cyan magenta jaune noir PROGRAMME P.7 RENCONTRE DE VONTOVORONA POSSIBLE ECHEC Les partis et associations de GRATUIT QUOTIDIEN D INFORMATION N 0137 DU Mercredi 25 Août 2010 FIARAHAMONINA HADIHADIANA NY

Plus en détail

ATRIKA Le journal de l ASMF

ATRIKA Le journal de l ASMF Association des Anciens du Collège St-Michel en France ATRIKA Le journal de l ASMF OCTOBRE 2010 ÉDITION : Octobre 2010, NUMÉRO 12 Éditorial 2010 ASMF bureau 2009/2010 Joël Rambatomanga(1990) Président

Plus en détail