THESE DE DOCTORAT L UNIVERSITE SAINT-JOSEPH DE BEYROUTH L'UNIVERSITE PARIS 6 - PIERRE ET MARIE CURIE

Dimension: px
Commencer à balayer dès la page:

Download "THESE DE DOCTORAT L UNIVERSITE SAINT-JOSEPH DE BEYROUTH L'UNIVERSITE PARIS 6 - PIERRE ET MARIE CURIE"

Transcription

1 Université Saint-Joseph de Beyrouth THESE DE DOCTORAT Pour obtenir les titres de Docteur de L UNIVERSITE SAINT-JOSEPH DE BEYROUTH Discipline: Sciences de la Vie ET DE L'UNIVERSITE PARIS 6 - PIERRE ET MARIE CURIE ECOLE DOCTORALE iviv (ED387)- Interdisciplinaire pour le Vivant Discipline: Sciences de la Vie Présentée par Farah AMMAR Titre ANALYSE DES MECANISMES D'INHIBITION DE L'INTEGRASE DU VIRUS DE L IMMUNODEFICIENCE HUMAINE DE TYPE 1 SOUTENUE LE 5 Juillet 2013 Jury : Pr. Germain TRUGNAN Pr. Soulaima CHAMAT Pr. Ali SAIB Dr. Serge FERMANDJIAN Dr. Zeina HOBAIKA Pr. Richard MAROUN Dr. Dominique RAINTEAU Président Rapporteur Rapporteur Examinateur Examinateur Co-Directeur de thèse Co-Directeur de thèse

2 A mes parents, A mes soeurs, A mon neveu et ma nièce adorés. 2

3 REMERCIEMENTS C est sans doute un des moments les plus émouvants que j ai dû vivre en gravant dans ma mémoire la contribution de toutes celles et de tous ceux qui ont rendu possible mon cheminement de Doctorante. Il ne s agit certainement pas de la fin, ni même du début C est simplement un procédé d appartenance à une alliance scientifique, Un destin graduellement réfléchi. Je tiens, en tout premier lieu, à adresser mes très vifs remerciements à tous les membres examinateurs qui ont accepté de faire partie du jury de ma thèse. Professeur Germain Trugnan, Directeur de l école doctorale iviv- Interdisciplinaire pour le Vivant qui m'a fait l'honneur d'en être le président: connaissant ses nombreuses occupations, je l en remercie vivement. Je tiens également à exprimer ma profonde reconnaissance à Madame Soulaima Chamat, Professeur à l Université Libanaise et au Professeur Ali Saib, Recteur de l Académie de Caen pour avoir accepté d être rapporteurs de ce travail. Je remercie aussi Docteur Dominique Rainteau pour avoir accepté d'être directeur de cette thèse. Mes remerciements vont aussi aux équipes des deux laboratoires à l Ecole Normale Su périeure de Cachan et à l Université Saint-Joseph de Beyrouth- qui m ont accueillie pour mener ce travail de recherche. Leur professionnalisme, leur endurance et leurs qualités humaines m ont surtout aidé e à tenir le cap et à honorer cette ambition. Je tiens à remercier très particulièrement Professeur Toufik Rizk, Doyen de la Faculté des sciences de l USJ pour avoir toujours soutenu et encouragé la recherche à la Faculté. Je remercie surtout et très chaleureusement les Professeurs Serge Fermandjian et Richard Maroun qui m'ont accueillie dans leurs laboratoires et m'ont confié ce passionnant sujet de thèse. Monsieur Serge Fermandjian, il m'est particulièrement difficile de trouver les mots justes pour vous remercier. Vous avez, tout au long de ces années, déployé tous les moyens nécessaires pour une excellente conduite. Vous n avez économisé aucun effort d analyse destiné à préciser ou à améliorer telle idée ou explication. Je pense à tous vos conseils, à toutes vos précisions et à tous vos encouragements. Vous avez été plus qu'un directeur de thèse. Vous ne pouvez imaginer à quel point c'était agréable de travailler avec vous. Merci pour tout! 3

4 Monsieur Richard Maroun, je ne vous remercierai jamais assez. C'est vous qui m'avez dès le début orientée vers cette voie! C est vous qui m avez donné le goût de la recherche. Vous avez été un véritable guide lors de ces quatre dernières années malgré vos nombreuses occupations. Votre encadrement, votre suivi et votre incontestable ouverture d'esprit m'ont permis de profiter de vos idées et de votre admirable expérience transformant les difficultés rencontrées en un quotidien parfaitement enrichissant. Ce sont vos qualités humaines et votre personnalité exceptionnelle qui ont fait de cette thèse une très belle expérience. Je suis très fière d'avoir travaillé avec vous. Beaucoup de doctorants et d'étudiants m'envient pour ça. Merci encore! Au moment où cette thèse s'achève, je ressens aussi bien le plaisir et l honneur que la nécessité d avoir suivi ce parcours avec vous. Tel est le grand privilège de ma thèse en cotutelle. Au terme de ce travail, je vous prie d accepter mon témoignage de gratitude et d émotions envers chaque minute investie et chaque réflexion menée. C est aussi votre jour de succès : Que vous y trouviez l expression de ma plus profonde considération. Dr. Zeina Hobaika, la passion qui vous anime me laisse sans voix. Je tiens à vous remercier pour tous les précieux conseils, et pour le temps que vous m avez consacré, malgré un emploi du temps plus que chargé. Je tiens aussi à remercier l Agence Universitaire de la Francophonie (AUF) et le CNRS libanais ainsi que le conseil de la recherche de l Université Saint-Joseph et le programme franco-libanais CEDRE pour avoir financé ce projet de thèse. Je suis, aussi, redevable à Dr. Loussinée Zargarian qui consacrait continûment un considérable intervalle de temps pour l avancement de mes recherches. C'est avec beaucoup d'émotions que je m'addresse à toi Loussisso. Ton précieux soutien m a permis de clarifier davantage plusieurs points d interprétation. Je regrette que tu ne puisses être présente parmi nous pour cette soutenance. Très chère Loussisso, je te suis très spécialement reconnaissante. Merci pour tout ce que tu as fait pour moi au labo et en dehors du labo. Merci aussi à Dr. Mireille Kallassy Awad qui m'a si aimablement donné des conseils lors de la purification de ma protéine. Merci à Dr. Alessia Zamborlini, à Guillaume et à Joris pour leur accueil et leur aide lors de la préparation du core catalytique. Je remercie aussi Dr. Ahmed Haouz avec qui nous avons 4

5 collaboré pour les manipes de cristallisation ainsi que Dr. Malcolm Buckle et Dr. Hervé Leh pour les expériences de plasmon de résonance. Je ne peux conclure sans adresser des remerciements, de même ordre, à toutes les personnes qui m ont entourée durant de longs mois. Mes premiers remerciements vont à mes parents et ma famille qui n ont cessé de me témoigner de leur affection et de leur confiance, faute de quoi mon désir d avancer se serait éclipsé. Quand Dieu a créé les familles, il m'a donné la meilleure: Maman toujours douce, tendre et affectueuse, Papa attentif et compréhensif, Mouzayan et Salam, mes deux soeurs très chères, Mohammad, mon cher beau-frère et mes deux neveux adorables Ali et Nour, ma tante Mona et mes cousines: Je suis là aujourd'hui grâce à vous. Pour une famille comme vous, il n'y a pas suffisamment de façons pour dire merci. Je ne saurai terminer ces quelques lignes sans remercier mes amis et mes camarades de promotion. Je tiens à souligner votre soutien amical pendant mon parcours. Vous avez animé, par votre inestimable présence, mes années de formation au Liban et en France. Christelle, my nescafe mate, you are ''2 in 1'': la plus gentille soeur et amie avec qui je suis d'accord sur la plupart des choses. Ali, Merci pour ton constante attention! Ton amitié est l'une des meilleures choses qui me sont arrivées ces trois dernières années. «Le Bazzi», Merci pour ton amitié et ta présence. Merci aussi pour le temps que tu as su trouver pour m aider dans les attributions de la RMN. Nada, peu de choses à dire que tu ne saches déjà! Merci d'avoir toujours été là pour moi depuis 23 ans déjà! Naamat, toujours proche malgré la distance, je te souhaite simplement ce que je souh aite pour moi-même! Joycita, "my bossy", full of attitude: Le bureau des doctorants n'est pas pareil sans toi. Hiba, adorable comme tu es, je te souhaite bonne chance pour ta thèse. Merci aussi à Rita, Farah et Nour, Rana Nassif et Rana Elias, Dayana, Christelle, Joanna, Rhoda, Jad... En conclusion, je dédie mon travail à tous ceux qui ont aidé, de près ou de loin, à accéder au grade de Docteur. Je vous remercie tous d être et d avoir toujours été là! Farah Ammar 5

6 Sommaire

7 Sommaire Liste des Abréviations 11 Liste des Figures et Tableaux 15 A. Introduction 18 A.I. L épidémie mondiale de SIDA 19 A.II. Infection par le VIH 20 A.II.1. Découverte du VIH 20 A.II.2. Origine du VIH 21 A.II.3. Diversité génétique des VIH-1 et VIH-2 22 A.II.4. Le VIH 23 A.II.4.1. Classification au sein du monde viral 23 A.II.4.2. La particule virale 24 A.II.4.3. Organisation du génome du VIH-1 25 A.II.4.4. Les gènes et les protéines du VIH-1 27 A.II.4.5. Le cycle de réplication virale 29 A.II L entrée virale 29 A.II Le transport cytoplasmique du VIH-1 30 A.II La transcription inverse 30 A.II La décapsidation 30 A.II L intégration 31 A.II L expression génique 31 A.II L assemblage et le bourgeonnement 32 A.II La maturation des particules virales 32 A.III. L'Intégrase 33 A.III.1. Structures et fonctions des domaines de IN 34 A.III.1.1. Le domaine N-terminal 34 A.III.1.2. Le core catalytique 35 A.III.1.3. Le domaine C-terminal 37 A.III.2. Structure oligomérique de IN 38 A.III.3. Structures cristallographiques de l'intasome de PFV 39 A.III.4. Le mécanisme d'intégration 40 A.III.4.1. Le 3 -processing (maturation ou 3 P) 41 A.III.4.2. Le transfert de brins 41 A.III.4.3. La réparation post-intégration 43 A.III.5. Activités catalytiques de IN in vitro 43 A.III.5.1. L intégration in vitro 43 A.III.5.2. La désintégration 45 A.III.6. Les cofacteurs métalliques de IN 45 A.III.7. Interactions IN-ADN viral 45 A.III.7.1. Les résidus de IN 45 A.III.7.2. Les nucléotides de l'adn viral 48 A.III Rôle de la séquence 48 A.III Rôle de la structure 49 A.III.7.3. Les sites d intégration dans l ADN cellulaire 49 7

8 Sommaire A.III.8. Les partenaires cellulaires de IN du VIH-1 50 A. IV. Thérapies anti-sida 52 A.IV.1. Les inhibiteurs de la transcriptase inverse 53 A.IV.1.1. Les Analogues nucléosidiques ou nucléotidiques de la transcriptase inverse (INTI) 53 A.IV.1.2. Les inhibiteurs non-nucléosidiques de la transcriptase inverse (INNTI) 53 A.IV.2. Les inhibiteurs de protéase (IP) 54 A.IV.3. Les inhibiteurs de IN 54 A.IV.4. Les inhibiteurs d entrée 55 A.IV.4.1. Les inhibiteurs de fusion 55 A.IV.4.2. Les inhibiteurs de la liaison CD4-gp A.IV.4.3. Les antagonsites de CCR5 et de CXCR4 56 A.V. Les inhibiteurs de IN 57 A.V.1. Les inhibiteurs de IN non sélectifs du ST 57 A.V.2. Les inhibiteurs sélectifs du ST 58 A.V.2.1. Les DKA et leurs dérivés ou molécules apparentées 58 A.V.2.2. Les INSTI utilisés contre le SIDA: Raltegravir, Elvitegravir et Dolutegravir 61 A.V Liaison des INSTI et mécanisme d inhibition 61 A.V Mécanis me d action de RAL et de EVG 62 A.V Mode de liaison des autres INSTI 64 A.V Résistances de VIH-1 à RAL et EVG 66 A.V Dolutegravir et INSTI de deuxième génération: Profil de résistance amélioré 67 A.V.3. Les inhibiteurs peptidiques 70 A.V.3.1. Les peptides dérivés de IN 70 A.V.3.2. Les peptides dérivés des cofacteurs viraux ou cellulaires de IN 72 A.V.4. Les anticorps anti-in 73 A.VI. Le projet proprement dit: «Analyse des mécanismes d'inhibition de IN de VIH-1» 75 A.VI.1. Premier centre d'intérêt 78 A.VI.2. Deuxième centre d'intérêt 78 B. Matériels et Méthodes 80 B.I. Matériels 81 B.I.1. Oligonucléotides 81 B.I.2. Peptides 82 B.I.3. Inhibiteurs 84 B.I.4. Anticorps et Fab 85 B.I.5. IN et CCD 85 B.II. Méthodes 86 B.II.1. Spectroscopie d absorption 86 B.II.2. Dichroïsme circulaire (DC) 87 B.II.2.1. Principe du DC 87 B.II.2.2. Principaux domaines d utilisation du DC 88 B.II.2.3. Conditions d acquisition et de traitement de données. 90 8

9 Sommaire B.II.3. Spectroscopie de fluorescence 92 B.II.3.1. Principe de la technique 92 B.II.3.2. Les fluorophores 94 B.II.3.3. Atténuation de fluorescence 94 B.II Principe 94 B.II Conditions expérimentales 94 B.II.3.4. L Anisotropie de Fluorescence 95 B.II Principe 95 B.II Conditions expérimentales 97 B.II Mesure indirecte de l'affinité des ligands non marqués: déplacement du ligand marqué 98 B.II.4. Dynamique moléculaire 100 B.II.5. Calculs des énergies libres de liaison 101 B.II.6. ELISA 102 B.II.7. Dot Blot 103 B.II.8. Western blot 103 B.II.9. Résonance Plasmonique de Surface 105 B.II.9.1. Principe 105 B.II.9.2. Etude des interactions anticorps-peptides 107 C. Résultats et Discussion 109 C.I. Analyse des Mécanismes d'inhibition de IN par deux INSTI: RAL et TB C.I.1. «Unprocessed viral DNA could be the primary target of the HIV-1 integrase inhibitor raltegravir» by Ammar, F.F. et al. PlosOne (2012). 111 C.I.2. «Understand Mechanisms of Integrase Inhibitors: raltegravir versus TB11» by Ammar, F.F. et al. (2013) soumis à Plos One. 128 C.II. Analyse des Mécanismes d'inhibition de IN par des Anticorps Monoclonaux spécifiques 171 C.II.1. «Monoclonal antibodies that recognize important functional elements of the HIV-1 integrase enzyme» by Maroun, R.G. et al. Retrovirology (2012). 174 C.II.2. «Aspects Structuraux et Dynamiques de la Reconnaissance de IN de VIH-1 par des Anticorps Monoclonaux spécifiques» 176 C.II.2.1. Pureté des anticorps 176 C.II.2.2. Prédiction des structures secondaires des peptides 177 C.II.2.3. Caractérisation et délimitation des épitopes 178 C.II Epitope de 4C6 178 C.II Impact de la conformation de l'épitope sur la reconnaissance par 4C6 180 C.II Epitope de 4F4 181 C.II Identification des résidus impliqués dans la reconnaissance des anticorps: Effet des mutations ponctuelles 182 C.II.2.4. Reconnaissance de IN et du CCD par les anticorps 183 C.II ELISA 183 C.II Western Blot 184 C.II Dot Blot 185 C.II.2.5. Inhibition de l'interaction IN- anticorps par l ADN viral 186 C.II.2.6. Interactions anticorps-peptide par DC 187 9

10 Sommaire C.II.2.7. Constantes d'affinité des interactions anticorps -peptides 192 C.II Résonance plasmonique de surface (SPR) 192 C.II Anisotropie de Fluorescence 198 D. Conclusions et Perspectives 203 D.I. Inhibition de IN par les INSTI 204 D.II. Inhibition de IN par les anticorps monoclonaux spécifiques 206 E. Références

11 Liste des Abréviations 3'P: 3'-Processing (maturation en 3') 5CITEP: 1-(5-ChloroIndol-3-yl)-3-hydroxy-3-(2H-TEtrazol-5-yl)-Propenone ACPYPE: AnteChamber PYthon Parser interface ADN: Acide DésoxyriboNucléique ADNc: Acide DésoxyriboNucléique Complémentaire ARN: Acide RiboNucléique ARNm: Acide RiboNucléique Messager ARV: AntiRétroViraux CA: Protéines de la CApside CADA: CyclotriAzoDisulfonAmide CC50: Cytotoxic Concentration 50 CCR5: C-C chemokine Receptor type 5 CDC: Centers for Disease Control and Prevention CPI: Complexe de Pré-Intégration CRE: camp Responsive Element CRF: Circulating Recombinant Form CXCR4: C-X-C chemokine Receptor type 4 DC: Dichroïsme Circulaire DKA: DiKetoAcid DTG: DoluTeGravir EC50: 50% Effective Concentration (concentration efficace médiane) EDC: 1-Ethyl-3-(3-Dimethylaminopropyl) Carbodiimide hydrochloride ELISA: Enzyme-Linked ImmunoSorbent Assay

12 Liste des Abréviations Env: Envelope ESP: Electrostatic Potential EVG: ElViteGravir FDA: U.S. Food and Drug Administration Fmoc: 9-FluoroMéthOxyCarbonyl G03: Gaussian03 GAFF: General Amber Force Field Gag: Group-Specific Antigen HAART: Highly Active AntiRetroviral Therapy HPLC: High-Performance Liquid Chromatography IBD: IN Binding Domain IC50: Inhibitory Concentration 50 IN: Integrase INI: Integrase Inhibitor INNTI: Inhibiteurs Non-Nucléosidiques de la Transcriptase Inverse INSTI: Integrase Strand Transfer Inhibitor INTI: Inhibiteurs Nucléosidiques de la Transcriptase Inverse IP: Inhibiteurs de la Protéase IPTG: Isopropyl β-d-1-thiogalactopyranoside KLH: Keyhole Limpet Hemocyanin LAV: Lymphadenopathy Associated Virus LEDGF: Lens Epithelium Derived Growth Factor LTR: Long Terminal Repeats M: Main MA: Protéine de la MAtrice MAb: Monoclonal AntiBody 12

13 Liste des Abréviations MMWR: Morbidity and Mortality Weekly Report N: New NC: Protéines de la NucléoCapside Nef: Negative Regulatory Factor NHS: N-HydroxySuccinimide NK: Natural Killer O: Outlier pb : paire de bases PCP : Pneumonie à Pneumocystis carinii PFV: Prototype Foamy Virus PIC: Protease Inhibitor Cocktail Pol: Polymerase PR: PRotéase virale Pr55Gag : PRécurseur polyprotéique Gag Prgp160: PRécurseur Gag-Pol RAL: RALtegravir RESP: Restrained Electrostatic Potential Rev: Regulator of Virion Expression RRE: Rev Responsive Element RTC: Complexes de Rétrotranscription SASA: Solvent Accessible Surface Area SDS-PAGE: Sodium Dodecyl Sulfate PolyAcrylamide Gel Electrophoresis SFv: Single-Chain variable antibody Fragment SIDA: Syndrome d Immunodéficience Acquise SPR: Résonance à Plasmons de Surface SPRi: Imagerie par Résonance de Plasmon de Surface 13

14 Liste des Abréviations ST: Strand Transfer (transfert de brin) TAR: Trans-Activation Response element TAT: TransAcTivator of HIV gene expression TI: Transcriptase Inverse TMB: 3,3,5,5 -TetraMethylBenzidine UV: UltraViolet VDW: Van Der Waals VIB: Virus d'immunodéficience Bovine Vif: Viral Infectivity Factor VIF: Virus d'immunodéficience Féline VIH: Virus d'immunodéficience Humaine VIH-1: Virus d'immunodéficience Humaine de type 1 VIH-2: Virus d'immunodéficience Humaine de type 2 VIS: Virus d'immunodéficience Simienne VIScpz: Virus d'immunodéficience Simienne du Chimpanzé VISsm: Virus d'immunodéficience Simienne du sooty mangabey VMD: Visual Molecular Dynamics Vpr: Viral Protein R Vpu: Viral Protein U 14

15 Liste des Figures et Tableaux Figure 1: Prévalence globale de VIH chez les adultes (15 à 49 ans) 20 Figure 2: Arbre phylogénétique des lentivirus de primates 22 Figure 3: Particule virale mature de VIH-1 25 Figure 4: Structure du génome de VIH-1 27 Figure 5: Cycle de réplication du VIH 32 Figure 6: Structure de IN de VIH-1 36 Figure 7: Architecture de l'intasome du PFV 40 Figure 8: Le site actif de l'intasome du PFV 42 Figure 9: Séquence des événements de l'intégration du VIH-1 44 Figure 10: Interactions protéine-adn viral au niveau du site actif de l'intasome du PFV 47 Figure 11: Structure du complexe IN CCD -LEDGF IBD 51 Figure 12: Dicétoacides et dérivés 59 Figure 13: Interactions de 5CITEP au niveau du site actif de IN de VIH-1 60 Figure 14: Structures chimiques de RAL, EVG et DTG 62 Figure 15: Structure chimique de RAL et ses principales interactions au niveau du site actif 63 Figure 16: RAL et EVG au niveau du site actif de l intasome du PFV 64 Figure 17: Structures chimiques de différents INSTI 65 Figure 18: Comparaison des modes de liaison des différents inhibiteurs 65 Figure 19: Sites de mutations de résistance de RAL et de EVG reportés sur le modèle de l intasome de VIH-1 67 Figure 20: (A) DTG au niveau du site actif (B) comparaison de la position de RAL, de MK2048, et de DTG dans l'intasome du PFV 69 Figure 21: Structure cristallographique du domaine central de IN 70 Figure 22: Peptides inhibiteurs dérivés de l'interface de dimérisation de IN 71

16 Liste des Figures et Tableaux Figure 23: Séquences des oligonucléotides utilisés 82 Figure 24: Séquences des oligonucléotides utilisés dans les calculs de dynamique moléculaire 82 Figure 25: Séquences des peptides K156 et K156-loop Figure 26: Séquences des peptides utilisés pour les études des anticorps 83 Figure 27: Structures chimiques de TB11 et de RAL 84 Figure 28: Principe du DC 88 Figure 29: Angles de rotation (ou dièdres) dans l unité peptidique : autour de la liaison N-Cα (PHI, φ) et de la liaison Cα-C entre (PSI, ψ) 89 Figure 30: Spectres de DC de structures secondaires «pures» 90 Figure 31: Diagramme simplifié de Perrin- Jablonski 93 Figure 32: Spectres d'absorption et d'é mission de (A) TB11 et (B) RAL 95 Figure 33: Analyse de la liaison de ligand par anisotropie de fluorescence 96 Figure 34: Représentation schématique de la mesure en anisotropie de fluorescence 98 Figure 35: Principe de la SPR 105 Figure 36: Evolution des courbes plasmon avant (rouge) et après (bleu) une interaction biologique. Les différentes méthodes exploitant l évolution des courbes de plasmon (1 : lecture type BIAcore 2 : lecture par imagerie SPR) 106 Figure 37: a) Evolution des courbes plasmon avant (rouge) et après (bleu) une interaction biologique b) Suivi cinétique en temps réel de la réflectivité décrivant successivement une phase d association et une phase de dissociation

17 Liste des Figures et Tableaux Tableau 1: Peptides inhibiteurs de IN issus des régions d'interaction de IN avec des cofacteurs viraux ou cellulaires 73 Tableau 2: Anticorps inhibiteurs de IN 75 Tableau 3: Conditions expérimentales des titrages en anisotropie de fluorescence 98 Tableau 4: Composition du gel de polyacrylamide SDS PAGE

18 A. Introduction

19 Introduction Après la peste noire, réputée pour avoir décimé le tiers de la population européenne au XVIe siècle (Soit entre 20 et 30 millions de personnes), le SIDA (Syndrome d immunodéficience acquise) engendré par le VIH (Virus d'immunodéficience Humaine) est considéré comme étant la maladie infectieuse la plus dévastatrice que l'humanité ait jamais connue. Les premiers cas de SIDA ont été détectés au début des années 80. Aujourd hui, et malgré la quantité des travaux effectués et la qualité des connaissances accumulées en trente ans, l épidémie de SIDA reste un sujet d inquiétude universel justifié : elle est la quatrième cause de mortalité dans le monde et la première sur le continent africain. Mais la séropositivité est aussi facteur de discrimination ayant d'importantes répercussions familiales, sociales, économiques et professionnelles. A.I. L épidémie mondiale de SIDA Les chiffres de 2011 publiés par l ONUSIDA montrent qu à l aube de la quatrième décennie de la maladie, la croissance globale de l épidémie mondiale s est stabilisée. La propagation est enrayée et la tendance actuelle commence à être inversée. Cette baisse traduit les bons résultats de la prévention du VIH (moins de personnes infectées), l augmentation et la meilleure disponibilité des traitements antirétroviraux, notamment dans les pays à revenu faible ou intermédiaire tels que l Afrique subsaharienne, qui compte à elle-seule les deuxtiers des personnes infectées par le VIH-1 (avec une prévalence de 5% des adultes vivant avec le VIH/SIDA), et l Asie du Sud et du Sud-Est (second plus grand nombre au monde de personnes vivant avec le VIH) (Figure 1). Ainsi, en 2011, on estimait à 34 millions environ [31,4 millions 35,9 millions] le nombre de porteurs du VIH, contre 26,2 millions [24,6 millions 27,8 millions] en 1999, soit une augmentation de 27%. Le nombre de nouvelles infections a été de 2,5 millions [2,2 millions 2,8 millions], en recul par rapport aux 3,1 millions [2,9 millions 3,4 millions] de Quant au nombre de décès liés au SIDA, il a été de 1,7 millions [1,5 million 1,9 millions], en recul par rapport aux 2,1 millions [1,9 million 2,3 millions] de 2004 (Rapport ONUSIDA sur l épidémie mondiale de SIDA- 2012). 19

20 Introduction Figure 1: Prévalence globale de VIH chez les adultes (15 à 49 ans). Le taux de prévalence mondiale de VIH/SIDA est de 0.8% (Rapport ONUSIDA sur l épidémie mondiale de SIDA- 2012). A.II. Infection par le VIH A.II.1. Découverte du VIH Le 5 Juin 1981, les Centres pour le contrôle et la prévention des maladies aux Etats- Unis (US Centers for Disease Control and Prevention (CDC)) publient un rapport (MMWR: Morbidity and Mortality Weekly Report), décrivant des cas d'une infection pulmonaire rare, la pneumonie à Pneumocystis carinii (PCP), détectés chez cinq jeunes hommes homosexuels à Los Angeles, Californie. Tous les hommes ont aussi d'autres infections inhabituelles, qui indiquent que leur système immunitaire ne fonctionne pas. Cette édition du MMWR marque le premier rapport officiel de ce qui sera connu sous le nom d'épidémie de SIDA. Homosexuels, Haïtiens et hémophiles ont constitué les premiers groupes à risque reconnus aux Etats-Unis, avant même que l étiologie du SIDA ne soit établie. Les transmissions vénériennes et par voie sanguine ont été rapidement repérées dès 1982, ainsi que la transmission de la mère au fœtus. 20

21 Introduction L hypothèse de la responsabilité d un agent infectieux, émise sur la base de ces premières investigations épidémiologiques, a trouvé sa confirmation dans les travaux du professeur Luc Montagnier deux ans plus tard, en 1983 : Montagnier et ses collaborateurs en France parviennent à identifier l agent causal qu ils nommèrent le virus de lymphadénopathie (LAV) (Barre-Sinoussi et al., 1983), aujourd hui connu sous le nom de VIH (van der Graaf & Diepersloot, 1986). Bien que l histoire indique l année 1981 comme le début de la pandémie, l origine de la maladie remonte à bien avant en Afrique centrale et Ouest. A.II.2. Origine du VIH L origine simienne du VIH a rapidement été pressentie dès le début de l épidémie (Sharp et al., 2000). Deux types de VIH (VIH-1, VIH-2) infectent l'espèce humaine. Ces virus émanent des virus de l'immunodéficience simienne (VIS), contre-partie simienne des VIH (Gao et al., 1999). Les données actuelles indiquent que les VIH sont entrés dans la population humaine à travers de multiples infections zoonotiques des VIS-primates non humains (Hahn et al., 2000). Les événements de transmission de virus des singes aux humains, sont au moins au nombre de sept pour le VIH-2 et de trois pour le VIH-1 (Moore, 2004). Les réservoirs simiens pour les virus humains ont été définis sur la base de la parenté génétique de souches connues de VIS et de VIH et de la superposition des zones géographiques d'épidémies humaines et simiennes. Il existe une similitude génétique et une superposition des zones géographiques presque totales entre certaines souches de VIH-2 et un VIS (noté VISsm) que l on trouve au sein d une espèce de singe de l'ouest Africain, le sooty mangabey (Cercocebus atys), mais qui est inoffensif pour l'hôte. Pour le VIH-1, il a été montré que l ancêtre le plus proche est le VIScpz, isolé de la sous-espèce de chimpanzé Pan troglodytes troglodytes (Figure 2) (Gao et al., 1999; Gao et al., 1992; Hahn et al., 2000; Hirsch et al., 1989; Muller-Trutwin et al., 2000; Peeters et al., 1992; Peeters et al., 1989). Là encore, on retrouve la même organisation pour les génomes de VIH-1 et de SIV infectant les chimpanzés (Simon et al., 1998). Les groupes les plus divers du VIH-1 [(M), (O) et N (non - M, non-o)] sont tous retrouvés dans la zone géographique correspondant au P. t. troglodytes dans l'ouest de l Afrique équatoriale. La reconstitution de l histoire évolutive du VIH-1 a 21

22 Introduction permis de conclure que les VIH-1 auraient pu contaminer l'espèce humaine dès le début du 20 ème siècle, aux alentours des années 1931 ( ) (Korber et al., 2000). Souvent pris comme animaux de compagnie ou chassés comme gibier, les contacts par morsures ou par blessures lors du dépeçage des animaux suffisent à expliquer la transmission du virus à l'homme (Katrak, 2006 ; Simon et al., 1998). Figure 2: Arbre phylogénétique des lentivirus de primates établi par comparaison de séquences génomiques complètes (adapté de HIV Sequence Compendium 2002). A.II.3. Diversité génétique des VIH-1 et VIH-2 Au fil du temps, une diversité génétique du virus s est développée. L Afrique centrale est l'épicentre de la diversité du VIH-1, avec un grand nombre de sous-types. Des formes recombinantes ont également été trouvées, résultant d une recombinaison génétique entre des virus de sous-types différents. Ces virus sont dénommés formes circulantes recombinantes (CRF), neuf parmi elles ont été identifiées (Moore et al., 2001). Les souches de VIH-1 22

23 Introduction peuvent être classées en trois groupes: M, N et O. Neuf sous-types de virus non recombinants composent le groupe M («Main»), à l origine de la pandémie mondiale de SIDA : A (A1, A2), B, C, D, F (F1, F2), G, H, J et K. La divergence de ces sous-types entre eux est de 15% en moyenne au niveau du gène gag (Group-Specific Antigen) et de 25% dans le gène env (envelope) (Vessière et al., 2010). Les sous-types A (12% des infections) et C (50% des infections) comptent pour la plupart des infections actuelles, suivis du sous-type B (10%) et les recombinants inter-sous-types CRF01_AE et CRF02_AG. Les sous-types à l intérieur des groupes O («Outlier») et N («New» ou Non M-Non O) ne sont pas, à l heure actuelle, clairement définis. Le VIH-2 responsable d un syndrome d immunodéficience se développant lentement (Blattner et al., 1988), est retrouvé principalement en Afrique de l Ouest et est composé de sept sous-types : A, B, C, D, E, F et G (Buonaguro et al., 2007; McCutchan, 2000; Vessière et al., 2010). La diversité génétique, caractéristique de l infection VIH constitue un obstacle majeur à l éradication de ce virus. Elle se manifeste par le développement rapide de quasi-espèces à partir d un nombre initial limité de particules virales. Les quasi-espèces virales peuvent répondre rapidement à la pression de sélection imposée par le système immunitaire et la thérapie antivirale et frustrer les tentatives de conception de vaccin. La majorité de la diversité génétique est introduite par les mutations et la recombinaison rétrovirale. La source la plus importante de mutations est la transcriptase inverse (TI) qui se caractérise par une faible fidélité et une faible processivité. Le taux d erreur d incorporation de nucléotide de la TI est exceptionnellement élevé 1.4x x10-5 (Abram et al., 2010; Mansky, 1996; Mansky & Temin, 1995). Il découle de l absence d activité correctrice d erreur de la TI. A.II.4. Le VIH A.II.4.1. Classification au sein du monde viral Les VIH appartiennent à la famille des Retroviridae qui se différencient des autres familles de virus par leur structure et leur mode de réplication. Les rétrovirus forment une 23

24 Introduction famille nombreuse et diversifiée de virus à ARN qui, comme leur nom l indique, synthétisent une copie ADN de leur génome ARN après infection de la cellule hôte. La conversion de l ARN en ADN est faite par la TI. La famille des rétrovirus comprend sept genres: Alpharetrovirus, Betaretrovirus, Gammaretrovirus, Deltaretrovirus, Epsilonretrovirus, Spumavirus et Lentivirus (Regenmortel & Fauquet, 2000). Les VIH appartiennent au genre des lentivirus. Les lentivirus (signifiant virus lent, en latin) sont des rétrovirus complexes qui infectent différentes espèces animales, par exemple les primates (VIH-1, VIH-2, VIS), les félins (VIF), les bovins (VIB) et sont responsables de maladies à évolution lente. Ils sont à l origine de pathologies diverses telles que les anémies, les maladies autoimmunes et des états d immunodéficience favorables au développement de maladies opportunistes (Girard et al., 2007). Le VIH-1 infecte préférentiellement les cellules du système immunitaire. Ses cibles principales sont les lymphocytes T CD4+ helper ou auxilliaire (en particulier les cellules T CD4+ mémoires), pilier du système de défense immunitaire de l organisme. D autres cellules du système immunitaire sont également atteintes notamment les monocytes/macrophages, les cellules dendritiques, et les cellules des systèmes lymphatique, hématopoïétique et nerveux. Certaines de ces cellules peuvent agir comme des réservoirs viraux (Levy, 2009). A.II.4.2. La particule virale Le VIH-1 forme des particules sphériques d environ 100 nm de diamètre comportant une enveloppe en bicouche lipidique, issue de la membrane plasmique de la dernière cellule infectée. A la surface de cette enveloppe du VIH-1, on trouve les glycoprotéines de surface gp120 et transmembranaires gp41 et parfois quelques protéines cellulaires (Arthur et al., 1992; Franke et al., 1994; Marschang et al., 1995). Gp120 et gp41 s organisent en trimères formant ainsi une structure en spicules (Figure 3) responsable du tropisme du VIH, c'est-àdire de l attachement aux récepteurs CD4 et corécepteurs CCR5 ou CXCR4 des cellules cibles (Sierra et al., 2005). La face interne de l enveloppe est tapissée d une couche de la protéine constituant la matrice (MA), p17 (Fiorentini et al., 2006) et participant à l'assemblage des particules virales 24

25 Introduction au niveau de la membrane plasmique ainsi qu'au recrutement des protéines d'enveloppe (Bukrinskaya, 2007). Figure 3: Particule virale mature de VIH-1 (Sierra et al., 2005). La particule virale renferme deux copies d ARN viral étroitement associées aux protéines de la nucléocapside (NC), p7 (Bampi et al., 2004) et aux enzymes virales, la protéase (PR), p12, l intégrase (IN), p32 et la transcriptase inverse (TI), hétérodimère p66- p51, et protégées par une capside formée par l assemblage des protéines p24 (CA) (Sierra et al., 2005). L agencement hexamérique des protéines de capside est responsable de la structure conique du core du virus (Figure 3) (Ganser-Pornillos et al., 2007; Pornillos et al., 2009). A.II.4.3. Organisation du génome du VIH-1 Le VIH-1 fait partie des rétrovirus complexes c est-à-dire des rétrovirus régulant leur expression via des facteurs viraux et exprimant des protéines supplémentaires (régulatrices et accessoires) essentielles à leur cycle viral. 25

26 Introduction Le génome VIH-1 se compose de deux molécules d'arn simple brin de polarité positive, alors que la forme persistante du génome VIH-1 est un ADN proviral bicaténaire (dans les cellules infectées) (Sierra et al., 2005). Le génome ARN du VIH, séquencé en 1985 par Wain-Hobson et al., est constitué de 9193 nucléotides et comprend neuf gènes qui codent pour 15 protéines (Wain-Hobson et al., 1985). La production des différentes protéines virales est possible grâce à l'épissage alternatif des transcrits viraux qui génère plusieurs espèces d'arnm : les ARNm de pleine longueur (non-épissés) de 9 kb; les ARNm mono-épissés d'environ 4 kb et les ARNm multi-épissés d'environ 2 kb. L'expression de ces messagers est hautement régulée au cours du cycle viral. Dans les premiers stades de la réplication, les ARNm de 2 Kb sont les plus abondants et permettent de produire les protéines Tat (TransAcTivator), Rev (REgulator of Virion expression) et Nef (Negative Factor) en grande quantité. Par la suite, il y a une augmentation progressive du nombre d'arnm non-épissés et mono-épissés, ce qui permet la production des protéines de structure et des protéines accessoires à la fin du cycle (Kim et al., 1989). Les gènes gag, pol (polymerase) et env codent pour les protéines structurales et les enzymes virales qui sont les composants essentiels de la particule virale. Les gènes tat et rev codent pour des protéines de régulation. Ces protéines modulent les étapes transcriptionnelles et post-transcriptionnelles de l'expression des gènes du virus et sont essentielles pour la propagation du virus. Enfin, les gènes nef, vif (Viral infectivity factor), vpr (Viral Protein Regulatory) et vpu (viral protein U) codent pour des protéines accessoires. Les protéines (Tat, Rev, Nef, Vif, Vpr et Vpu) sont importantes pour la régulation de la réplication et po ur la pathogénicité du virus. Outre les régions codantes, le génome est délimité de part et d autre par les LTR (long terminal repeats) qui sont des séquences promotrices répétées. Ces séquences contiennent de nombreux sites permettant la liaison de la protéine virale Tat et de protéines cellulaires capables de réguler positivement ou négativement la transcription virale. Le LTR est composée de 3 régions : U3, R et U5. C'est à la jonction des régions U3 et R q u'est initiée la transcription (Frankel & Young, 1998; Freed, 2001; Pereira et al., 2000). L organisation du génome du VIH-1 est présentée dans la figure 4. 26

27 Introduction Figure 4: Structure du génome de VIH-1. A.II.4.4. Les gènes et les protéines du VIH-1 - Gag: Le gène gag code pour les protéines de structure. Le précurseur polyprotéique Gag (Pr55Gag) myristyllé est clivé par la PR virale au cours de l étape de maturation de la particule virale. Les protéines structurales MA, CA, NC et p6 sont ainsi libérées (Freed, 1998). - Pol: Le gène pol code pour les enzymes virales. Ces enzymes sont produites sous forme d un précurseur polyprotéique gag-pol produit par décalage du cadre de lecture du ribosome près de l'extrémité 3' de gag (Jacks et al., 1988). Le précurseur gag-pol génère les trois protéines enzymatiques: la PR libérée par un mécanisme d autocatalyse est essentielle pour le clivage des précurseurs polyprotéiques produits du gène gag et du gène pol: l IN nécessaire à l'intégration du provirus et la TI, ADN polymérase ARN-dépendante, à laquelle est associée une activité ribonucléase H. Ces deux dernières protéines sont clivées sous l action de la PR virale (Swanstrom & Wills, 1997). - Env: Le gène env code pour un précurseur polyprotéique, prgp160, qui subit un processus de maturation, par glycosylation et clivage protéolytique aboutissant à l'expression des deux glycoprotéines de l'enveloppe: gp120 et gp41. Son clivage a lieu au cours de son transport vers la membrane plasmique par une protéase d origine cellulaire (Checkley et al., 2011; Robey et al., 1985). 27

28 Introduction Les gènes codant pour les protéines régulatrices (tat et rev), tout comme les gènes codant pour les protéines auxiliaires (nef, vif, vpu et vpr), sont localisés de part et d autre du gène env. Les protéines qui en résultent sont traduites à partir d ARNm épissés (Freed, 2001). - Tat: Transactivateur de l expression des gènes de VIH. C est l un des deux facteurs viraux essentiels (tat et rev) de la régulation de l expression des gènes de VIH. Tat agit en se liant au niveau de la région TAR (trans-activation response element) du LTR des ARNm naissants activant ainsi l initiation de la transcription et l élongation à partir du promoteur des LTR, et empêchant le signal de polyadénylation 5 LTR AATAAA de provoquer l arrêt prématuré de la transcription et la polyadénylation (Romani et al., 2010). - Rev: est le deuxième facteur nécessaire à la régulation de l'expression du VIH. Rev régule l'export nucléaire des transcripts viraux non-épissés et mono-épissés et ceci en formant un complexe multimérique sur le RRE (Rev Responsive Element) (Pollard & Malim, 1998). En plus, des études récentes ont mis le point sur une fonction intéressante de Rev jamais encore décrite: Rev interagit avec IN de VIH-1. Cette interaction inhibe IN et réduit par conséquent le nombre des événements d intégration à un seul ou 2 par cellule bien que le nombre de molécules de IN est de 40 à 100 par virion (Pommier et al., 2005) et un grand nombre de molécules d ADN viral libres sont présentes dans la cellule. La multi-intégration ainsi évitée, la cellule est protégée de l apoptose spécifique des cellules infectées (Benyamini et al., 2011). - Vif: favorise l'infectivité du virus (Barraud et al., 2008). Elle joue un rôle-clé dans la morphologie et la stabilité de la capside, et intervient aussi au niveau de l étape de transcription inverse (Henriet et al., 2009). - Vpr: est associée à la nucléocapside où elle présente un signal de localisation nucléaire nécessaire à l import nucléaire du complexe de pré-intégration (CPI) dans le noyau. Une des fonctions proposées pour Vpr est l arrêt de la croissance cellulaire en phase G où la réplication virale est très efficace (Jowett et al., 1995). - Vpu: a au moins deux fonctions biologiques différentes: la dégradation des récepteurs CD4 dans le réticulum endoplasmique, et le renforcement du bourgeonnement de virions à partir de la membrane cytoplasmique des cellules infectées en empêchant l action 28

29 Introduction du facteur de séquestration des virions tetherin/bst-2 permettant ainsi la libération des nouvelles particules virales (Dube et al., 2010a; Dube et al., 2010b). - Nef: est abondamment produite lors des étapes précoces de la réplication (Kotov et al., 1999). Nef diminue l expression des récepteurs CD4 à la surface des cellules infectées (Goldsmith et al., 1995) ce qui favorise la libération des virions (Luo et al., 1996). A.II.4.5. Le cycle de réplication virale Le cycle de réplication virale comprend une série d'étapes qui commencent avec l interaction des protéines de surface du virus avec les récepteurs de surface cellulaire et se terminent quand des particules virales naissantes arrivent à maturité en devenant des virions infectieux. Au cours du processus de replication, le VIH-1 exploite une multitude de facteurs cellulaires, et doit lutter contre les facteurs de restriction de l hôte qui oeuvrent pour supprimer cette réplication (Huthoff & Towers, 2008). Les différentes étapes du cycle viral (Figure 5) sont: A.II L entrée virale Le VIH-1 infecte essentiellement les cellules T CD4 + et les macrophages. La première étape du cycle réplicatif du VIH-1 consiste en l'attachement de la particule virale à la surface de la cellule cible (Figure 5). Le mécanisme de fusion du VIH avec une cellule cible leucocytaire CD4 commence par l'interaction du VIH avec CD4 via sa gp120 (Lasky et al., 1987). Cette interaction entraîne un changement conformationnel permettant l'exposition du site de fixation au co-récepteur, appartenant à une famille de récepteurs de chimiokines, CCR5 ou CXCR4, et ainsi une seconde interaction est établie à la surface cellulaire. Cette seconde interaction, absolument nécessaire pour que la fusion ait lieu, induit à son tour une modification de conformation conduisant à l'exposition de la partie aminoterminale hydrophobe de la gp41 ou peptide de fusion N-terminal jusqu'alors masqué au sein des trimères gp120-gp41, lui permettant de s'insérer dans la membrane de la cellule-cible du fait de son caractère hydrophobe. L'insertion du peptide de fusion crée un pore de fusion qui s'élargit par formation d'une structure en épingle à cheveux liée au repliement de la gp41 sur elle-même (Briz et al., 2006; Engelman & Cherepanov, 2012). 29

30 Introduction A.II Le transport cytoplasmique du VIH-1 Pour atteindre le noyau, site de sa réplication, le virus doit tout d abord traverser le cytoplasme. Il devra également se déplacer du noyau à la membrane cytoplasmique pour pouvoir se propager. Le virus profite du transport cytoplasmique actif assuré par le cytosquelette de la cellule normalement destiné au transport de protéines et de vésicules cellulaires (Radtke et al., 2006). Une fois arrivés au voisinage de la membrane nucléaire, les virus se détachent des filaments d actine pour s amarrer aux pores nucléaires (Arhel et al., 2006). A ce niveau-là, se produit la transcription inverse. A.II La transcription inverse La transcription inverse, caractéristique des rétrovirus est une étape-clé du cycle viral, a lieu majoritairement au niveau des pores nucléaires et nécessite entre 8 et 12h pour s achever (Bukrinsky, 2004; Stevenson, 1996). Au cours de la transcription inverse, la TI synthétise une copie d ADN complémentaire (ADNc) à l'arn viral puis, à l aide de son activité RNase H, dégrade le brin d ARN résiduel et termine la synthèse de l ADN proviral en synthétisant le second brin. La TI utilise au cours de la rétrotranscription les nucléotides cellulaires (Huthoff et al., 2003). La réplication du VIH-1 dépend entièrement de son accès au noyau de la cellule-cible et de son intégration dans la chromatine. C est pour ça qu une fois la rétrotranscription terminée, les «complexes de rétrotranscription» (RTC) doivent faire face à une nouvelle difficulté, celle de traverser le pore nucléaire. A.II La décapsidation On a longtemps cru que la décapsidation avait lieu dès l entrée du virus dans le cytoplasme. Selon cette hypothèse, la décapsidation post-fusion permettrait au RTC d accéder aux nucléotides cytoplasmiques et déclencherait ainsi la rétrotranscription. Cependant, des études récentes ont démontré que cette étape se déroulait plus précisément au niveau des pores nucléaires, juste avant l entrée du CPI dans le noyau (Arhel et al., 2006; Arhel et al., 2007). En effet, chaque virion ne contient que 80 à 120 copies de RT, ce qui laisse supposer qu une décapsidation immédiatement post-fusion conduirait à la diffusion passive de ces enzymes dans l ensemble du cytoplasme et rendrait la rétrotranscription 30

31 Introduction impossible. Par ailleurs, la cage de capside est un arrangement protéique d hexamères et de pentamères de capside comportant des espacements de 25 à 100 Å, et donc entièrement perméable aux nucléotides dont la taille est de l ordre de quelques ångströms. Ainsi, l hypothèse de la nécessité de la décapsidation afin de déclencher la rétrotranscription ne serait pas pertinente. En accord avec ces observations, des études de microscopie montrent que les protéines de capsides ne sont pas dispersées dans le cytoplasme après l entrée virale, comme il serait attendu d une décapsidation précoce, mais s accumulent de manière transitoire à la membrane nucléaire. La disparition des capsides virales entre 24 et 48 heures après infection coïncide avec la synthèse de l ADN viral complet et à l entrée de l ADN viral dans le noyau, indiquant que le virus perd sa capside avant d entrer dans le noyau. Cette étape de décapsidation est d ailleurs impérative étant donné la taille de la capside (100 à 120 nm de long et 50 à 60 nm de large) qui excède le diamètre du pore nucléaire (25 à 30 nm) (Arhel, 2010; Sherman & Greene, 2002). A.II L intégration Pour être intégré, l ADN viral est transporté vers le noyau au sein du CPI. Ce complexe est formé de différentes protéines virales et cellulaires dont la RT, l IN, la MA, la Vpr et la HMGA1 (Farnet & Bushman, 1997; Freed, 2001). L intégration de l ADN viral linéaire obtenu par transcription inverse dans le génome de la cellule hôte constitue une étape cruciale du cycle réplicatif du VIH-1 à partir de laquelle le virus peut commencer à proliférer (Krishnan & Engelman, 2012). Cette étape sera décrite en détail dans le paragraphe A.III.4. A.II L expression génique Une fois intégré, le provirus suit l une ou l autre de deux voies : a) la latence associée à une chromatine fermée ou l absence de facteurs de transcription b) la transcription active (Bushman et al., 2005; Lewinski & Bushman, 2005). La transcription du provirus se fait par recrutement, au niveau de séquences régulatrices du LTR en 5, de plusieurs facteurs favorisant la transcription par l ARN polymérase II cellulaire. Ainsi il y a production d ARN non et mono-épissés tels que l ARN génomique et les ARN des précurseurs gag, gag-pol et env (Fukumori et al., 1999; Purcell & Martin, 1993; Stoltzfus, 2009). 31

32 Introduction A.II L assemblage et le bourgeonnement Après traduction des différents précurseurs polypeptidiques, les différents composants viraux sont ensuite adressés à la membrane plasmique en vue de leur assemblage. L'acteur majeur de cette étape est le précurseur de Gag, p55 (Freed, 2001). L assemblage de nouvelles particules virales débute avec l encapsidation de deux copies d ARN génomique et des autres facteurs viraux et cellulaires. La libération des nouvelles particules virales s effectue ensuite par bourgeonnement à partir de la membrane plasmique de la cellule infectée, laquelle permet au virus d'acquérir son enveloppe, constitué d'une bicouche lipidique empruntée à la cellule hôte (Corbin et al., 2008). A.II La maturation des particules virales Au moment du bourgeonnement, le virion est immature. Sous l action de la PR, les polyprotéines gag et gag-pol sont clivées pour former les protéines virales indépendantes. Le précurseur polyprotéique Gag engendre ainsi les protéines MA, CA et NC tandis que le gagpol forme les enzymes virales. Les protéines structurales, MA, CA et NC se réarrangent ensuite pour donner naissance à une particule virale infectieuse (Freed, 2001). Figure 5: Cycle de réplication du VIH. Schéma du cycle viral en 13 étapes, de l'entrée du virus dans une cellule hôte à la libération et à la maturation de nouveaux virions (Engelman & Cherepanov, 2012). 32

33 Introduction A.III. L'Intégrase Les IN rétrovirales, dont celle de VIH-1, appartiennent à la superfamille des polynucléotidyltransférases qui comprend en plus des IN, d autres protéines métabolisant les acides nucléiques comme la RNase H, la RuvC, la transposase du bactériophage MuA et le composant nucléase du complexe RISC Argonaute (Nowotny, 2009). Ces enzymes ont en commun un repliement en RNase H (feuillets β entourés d hélices α) définissant leur domaine catalytique avec des chaînes latérales électronégatives d Asp et de Glu (Dyda et al., 1994; Nowotny, 2009; Pommier et al., 2005). L IN du VIH-1 est une protéine de 288 acides aminés (32kDa) codée par l extrémité 3 du gène pol. Elle est générée pendant la maturation du virus par clivage du précurseur polypeptidique gag-pol par la PR du VIH-1 (Pommier et al., 2005). Chaque particule de VIH- 1 contient entre 40 et 100 molécules de IN. Cette enzyme est indispensable à la réplication du virus puisqu elle catalyse l insertion covalente d une copie de l ADN viral, produit de la transcription inverse de l ARN viral, dans les chromosomes des cellules infectées. Une fois intégré, le provirus persiste dans la cellule hôte et sert de matrice pour la transcription des gènes viraux et la réplication du génome viral, permettant la production de nouveaux virus (Craigie, 2001). IN joue donc un rôle capital dans le cycle vital du VIH-1 et justifie l effort porté depuis des années sur les études de toutes sortes de sa structure et de ses fonctions. L étude structurale des IN rétrovirales a cependant été semée d obstacles et les progrès ont été extrêmement lents. Ainsi, la structure cristallographique de la molécule de IN de VIH-1 entière n a toujours pas été déterminée, ralentissant le développement des inhibiteurs de IN. La première structure d un intasome rétroviral-celle du prototype humain des spumavirus (PFV)- n a été résolue que très récemment (Hare et al., 2010). La faible solubilité de la molécule entière de IN de VIH-1, constitue la difficulté majeure faisant obstacle aux études physicochimiques. Cet obstacle a été partiellement surmonté par l étude de domaines individuels (Bujacz et al., 1996; Cai et al., 1998; Cai et al., 1997; Cherepanov et al., 2005; Dyda et al., 1994; Eijkelenboom et al., 1999; Goldgur et al., 1999; Goldgur et al., 1998; Greenwald et al., 1999; Lodi et al., 1995; Maignan et al., 1998) puis de bidomaines (Chen et al., 2000; Wang et al., 2001). Ces structures ont révélé de nombreuses interfaces de dimérisation au niveau des monomères et ont servi de bases à la 33

34 Introduction prédiction de plusieurs modèles de l intasome (Chen et al., 2008; Podtelezhnikov et al., 2003). A.III.1. Structures et fonctions des domaines de IN Ce sont des études de protéolyse aménagée, de mutagénèse dirigée et de complémentation fonctionnelle qui ont permis d identifier les trois domaines fonctionnels de IN: N-terminal (NTD ou N-terminal domain ; résidus 1 à 50) ; core catalytique (CCD ou core catalytic domain ; résidus 50 à 212) et C-terminal (CTD ou C-terminal domain; résidus 212 à 288) (Figure 6A). Ces trois domaines sont absolument requis pour les activités de maturation en 3' (3 P) et de transfert de brin (ST) (Bushman & Wang, 1994; Engelman et al., 1993; van Gent et al., 1993). A.III.1.1. Le domaine N-terminal NTD abrite un motif HHCC, similaire à celui des doigts de zinc, très conservé chez les IN de rétrovirus. Ce sont des histidines, en position 12 et 16, et des cystéines, en position 40 et 43, qui fixent le zinc (Craigie, 2001). Au sein du motif HHCC, Zn 2+ stabilise la configuration des hélices α (Eijkelenboom et al., 1997) et favorise le repliement ainsi que la tétramérisation de IN, nécessaire à l activité (Lee et al., 1997; Zheng et al., 1996). La structure de NTD isolé a été déterminée en solution par résonance magnétique nucléaire (RMN) (Cai et al., 1997; Eijkelenboom et al., 1997), puis par cristallographie au sein du bidomaine avec CCD (Wang et al., 2001) (Figure 6B et E). Sa structure est dimérique. Chaque unité monomérique est structurée en quatre hélices α, les hélices α2 et α3 formant un motif hélice-tour-hélice (HTH), stabilisé par la coordination du zinc et par des interactions hydrophobes. Le repliement du monomère est similaire à un certain nombre de protéines se liant à l ADN contenant un motif HTH. Mais, contrairement aux motifs HTH classiques, dans le NTD c est la deuxième hélice du motif qui intervient dans la reconnaissance de l ADN, l autre étant utilisée pour la dimérisation (Cai et al., 1997). L interface dimérique de NTD est différente dans les structures cristallographiques et dans la 34

35 Introduction structure RMN en solution, ce qui indique des réarrangements multiples des multimères de l IN (Pommier et al., 2005). Le NTD est impliqué dans la maturation de l ADN viral et le ST : les mutants de délétion des 49 premiers acides aminés de l IN (Khan et al., 1991) ne produisent ni le 3 P, ni le ST (Bushman et al., 1993). Les résidus HHCC jouent un rôle important car la mutation de l un de ces 4 résidus réduit l activité enzymatique de l IN (Bushman & Wang, 1994; Engelman & Craigie, 1992). Cependant, les données sur le rôle de ce domaine dans la reconnaissance spécifique des extrémités de l ADN viral sont contradictoires. Alors que certaines expériences démontrent que les mutations dans le domaine HHCC altèrent la spécificité de reconnaissance de l ADN viral par IN (Khan et al., 1991; Mazumder et al., 1996), d'autres montrent que des protéines mutantes ayant échangé leur domaine HHCC avec celui d'un autre virus, continuent de reconnaître l ADN viral de leur propre virus. Ainsi, une protéine constituée du NTD et du CTD de VIH-1 et du CCD du virus Visna reconnaît aussi bien que l IN du virus Visna un substrat ADN ayant les extrémités U3 et U5 du virus Visna (Katzman & Sudol, 1998). A.III.1.2. Le core catalytique CCD est le domaine le plus conservé parmi les différentes IN rétrovirales. Il possède notamment une triade catalytique DD35E hautement récurrente. Ces résidus sont situés en positions 64, 116 et 152, respectivement, pour le VIH-1 (Bushman et al., 1993; Chen et al., 1999; Engelman et al., 1993; Hickman et al., 1994). Ils sont strictement requis pour l activité catalytique de la protéine. La mutation d un seul de ces trois acides aminés inhibe l activité enzymatique de IN et la réplication virale (Engelman & Craigie, 1992; van Gent et al., 1992). La triade coordinne deux ions métalliques et lie une extrémité d ADN viral. Bien que CCD contienne le site catalytique de l enzyme, il ne peut, en l absence de CTD et de NTD, catalyser que la réaction de désintégration inverse de la réaction de ST dont la signification physiologique n est pas connue- in vitro (Goldgur et al., 1998). Le 3 P et le ST nécessitent donc la présence des domaines NTD et CTD en plus du CCD dans un complexe dimérique (Pommier et al., 2005). 35

36 Introduction Une autre fonction de CCD est la reconnaissance et la fixation de l ADN viral et cellulaire. En effet, en plus de la triade catalytique, CCD comporte les résidus nécessaires à l interaction spécifique avec l ADN viral, dont les plus importants sont Q148, Y143, K156, K159 (Zargarian et al., 2003). La mutation des lysines 156 et 159, par exemple, abolit l activité spécifique. En plus, l utilisation de protéines chimères à partir des domaines de différentes IN, permet de démonter que la réaction de clivage se produit uniquement lorsque les protéines chimères comportent le CCD du virus, dont sont issus les séquences att de l ADN viral (Goulaouic & Chow, 1996; Katzman & Sudol, 1998; Pahl & Flugel, 1995). Par ailleurs, CCD joue également un rôle-clé pour le positionnement correct de la protéine sur l ADN cellulaire cible (Harper et al., 2003). Cependant, la reconnaissance de l ADN viral, comme celle de l ADN cible, ne peut avoir lieu sans les NTD et CTD (Lee et al., 2005). Figure 6: Structure de IN de VIH-1. (A) Les différents domaines de IN avec la triade catalytique indiquée en magenta. (B-D) Structures des domaines de IN, avec : (B) le NTD (adapté de la PBD, Réf. 1wje) (Cai et al., 1998); (C) le CCD (adapté de la PDB, Réf. 1bis) (Goldgur et al., 1998); (D) le CTD (adapté de la PDB, Réf.1HV) (Lodi et al., 1995). (E-F) : les structures bidomaines de IN : (E) NTD + CCD (adapté de la PDB, Réf. 1k6y) (Wang et al., 2001), (F) CTD + CCD (adapté de la PDB, Réf. 1ex4) (Chen et al., 2000). Chaque structure se compose de deux monomères, montrés en différentes nuances de bleu. Les ions zinc du NTD sont indiqués en orange, et la triade catalytique (D64, D116 et E152) dans le CCD en magenta (Maes et al., 2012). 36

37 Introduction De nombreuses structures de ce domaine ont été résolues par analyse cristallographique (Figure 6C, E et F). La structure du CCD de IN de VIH (Dyda et al., 1994) a été la première résolue. Plus tard, sont venues les structures des bidomaines: CCD-CTD (Chen et al., 2000) et NTD-CCD (Wang et al., 2001), celle du co-cristal de CCD avec un inhibiteur, le 5CITEP (Goldgur et al., 1999) et celle du co-cristal de CCD avec LEDGF/p75 (Bradley & Craigie, 2005). Ces résultats ont permis d avoir une vision détaillée de la structure et des possibilités interactives de CCD. Dans tous ces exemples, CCD contenait au minimum la mutation F185K, qui accroît la solubilité de la protéine sans affecter toutefois ses activités enzymatiques in vitro. A.III.1.3. Le domaine C-terminal CTD est constitué d un groupe d acides aminés basiques (Pommier et al., 2005). La structure de ce domaine pris séparément (Figure 6D) a été tout d abord déterminée par spectroscopie RMN (Lodi et al., 1995). La structure de CTD au sein du bidomaine CCD- CTD de IN de VIH-1 (Figure 6F) a ensuite été résolue par cristallisation (Chen et al., 2000). En solution, le CTD forme un homodimère. Les deux protomères sont orientés de façon parallèle l un par rapport à l autre (Chen et al., 2000). Chaque sous-unité monomérique est composée de 5 feuillets β avec une topologie très similaire à celle du domaine SH3 (Srchomology) (Lodi et al., 1995), ce qui suggère son implication dans la fixation à l ADN (Esposito & Craigie, 1999). Ce domaine à structure dimérique présente aussi un sillon, composé de nombreux résidus chargés, qui par sa taille pourrait fixer une hélice d ADN double brin. Parce que les sites d intégration au niveau de l ADN cible sont relativement non-spécifiques (Chiu & Davies, 2004), il a été suggéré que ce domaine interagit plutôt avec l ADN cible cellulaire. Cependant, les expérimentations avec l IN chimérique attribuent la reconnaissance du site cible au CCD et les études par pontage covalent suggèrent que le CTD interagit avec la région subterminale de l ADN viral (Craigie, 2001). Des tests d activité in vitro avec des mutations dans le CTD montrent que ce domaine intervient dans les réactions de clivage et de ligation (Engelman et al., 1993). 37

38 Introduction Outre une liaison à l ADN, il a été proposé que le CTD serait impliqué dans la multimérisation de IN, la formation de structures oligomériques de la protéine étant fortement réduite par la suppression de ce domaine (Jenkins et al., 1996). A.III.2. Structure oligomérique de IN Bien qu une structure tridimensionnelle cristallisée de l IN de VIH-1 entière n ait pas été disponible, on savait, grâce aux données biochimiques, que la forme active de l IN était oligomérique (2,4 ou 8) (Podtelezhnikov et al., 2003). Plusieurs études allaient dans ce sens: a) l analyse de l IN d ASV par ultracentrifugation analytique qui a montré que IN existe en solution sous forme de monomères, de dimères et de tétramères (Coleman et al., 1999); b) les essais de «filter-binding» de l'interaction de IN de VIH-1 avec un anticorps anti-in qui ont montré que 2 molécules d anticorps interagissent avec IN, signifiant que IN est dimérique (Maroun et al., 1999a); et c) les tests de complémentation in vitro de deux mutants de IN possédant un ou plusieurs domaines de la protéine qui sont en accord avec une forme dimérique. Ces tests ont permis de démontrer que IN était active sous forme-au minimum- de dimère et que, au sein du dimère, un seul NTD et un seul CTD suffisaient pour obtenir le clivage et la ligation (Engelman et al., 1993). Cependant, au moins un tétramère est requis pour que IN puisse fonctionner: En fait, dans le dimère, les deux sites actifs de chaque sous-unité de la structure sont séparés de plus de 50 Å, distance incompatible avec un décalage de 5 paires de bases (pb). L hypothèse d une forme active tétramérique de IN s est donc très vite imposée (Yang et al., 2000), sa formation étant conditionnée par l'interaction avec l ADN. Ainsi, la création d un pont disulfure entre l ADN viral et IN stabilise une structure tétramérique (Gao et al., 2001). Le rôle de l ADN dans la tétramérisation de IN a été confirmé un peu plus tard (Vercammen et al., 2002). Enfin, l analyse en test d activité in vitro des différentes formes oligomériques de IN révèle que seule la forme tétramérique mène à l intégration concertée (Faure et al., 2005; Li et al., 2006). Différentes autres études ont, par ailleurs, suggéré que le degré d oligomérisation du complexe actif pouvait aller jusqu à un octamère (Cherepanov et al., 2003; Deprez et al., 2000; Lee et al., 1997). 38

39 Introduction Ce sont des résultats structuraux récents qui ont founi les preuves définitives que la forme active de IN était un tétramère lié aux extrémités virales. La cryomicroscopie, a détecté la formation d un complexe stable entre un tétramère de IN du VIH-1 et un cofacteur cellulaire : LEDGF/p75 (Michel et al., 2009). Il y a aussi depuis peu la cristallisation de l intasome (intermédiaire nucléoprotéique clé composé d un tétramère de IN qui interagit de façon stable avec les extrémités d une paire d ADN viral processé) du PFV (Hare et al., 2010). A.III.3. Structures cristallographiques de l'intasome de PFV La présence de l'adn est nécessaire à l oligomérisation de IN car il permet la formation du complexe synaptique entre deux dimères. Les progrès décisifs viennent des études structurales des intasomes de l IN de PFV, qui présente des propriétés de solubilité et de robustesse plus favorables pour les études biophysiques que son équivalente de VIH-1 (Valkov et al., 2009). IN de PFV partage moins de 20% d identité de séquence avec IN de VIH-1 et possède un domaine d extension N-terminal (NTE) qui n est pas présent chez IN de VIH-1. Cependant, les trois domaines de l IN de PFV retrouvés chez IN de VIH-1 ont essentiellement la même structure que les domaines isolés de IN de VIH-1 (Hare et al., 2010). Nous disposons donc actuellement de la structure cristallographique de l intasome du PFV (Hare et al., 2010; Li et al., 2006; Maertens et al., 2010). Cette architecture n aurait jamais pu être prédite en se basant sur les structures connues des domaines de IN de VIH-1 parce que : a) l ADN viral agit en maintenant l intégrité de l intasome et b) les domaines de IN adoptent un arrangement spatial différent comparé à celui des structures antérieures de la protéine seule. De plus, les structures cristallographiques des complexes IN PFV-ADN révèlent que les domaines de IN ne possèdent pas de fonctions distinctes, chacun participant à des contacts étroits protéine-protéine et protéine-adn au sein du complexe fonctionnel, comme pour la transposase Tn5 (Davies et al., 2000). La structure de l intasome du PFV comprend une paire de dimères de IN disposés symétriquement dans un tétramère oblongue. A l interface dimère-dimère, on trouve des interactions intermoléculaires NTD-CCD (Figure 7). Chacun des dimères forme une unité 39

40 Introduction asymétrique constituée de deux IN étroitement associées à une molécule d ADN viral. Les IN internes (monomères à activité catalytique) (en vert et bleu dans la Figure 7) forment un dimère en tête-bêche et sont responsables de tous les contacts protéine-protéine et protéine- ADN qui maintiennent l intasome. Cet arrangement permet aux trois domaines de chacune des sous-unités internes de participer à la liaison de l'adn et à la multimérisation. Les IN externes pourraient stabiliser le dimère interne ou interagir avec les facteurs cellulaires ou l ADN cible (Hare et al., 2009; Hare et al., 2010). Les NTD et les CTD des IN externes sont désordonnés. Cette structure de l intasome du PFV et les structures partielles de IN de VIH-1 (NTD-CCD (Wang et al., 2001) et CCD-CTD (Chen et al., 2000)) ont servi par la suite à la construction d'un modèle de l intasome de VIH-1 (Johnson et al., 2011; Krishnan et al., 2010). A B Figure 7: Architecture de l'intasome du PFV. (A) Les sous-unités internes du tétramère de IN qui fixent l'adn viral sont en bleu et vert; les IN externes sont en jaune. Les brins dits réactifs et non-transférés de l'adn viral sont en orange et en violet, respectivement. Les chaînes latérales des résidus catalytiques sont en rouge. Les sphères grises représentent les cofacteurs métalliques (Hare et al., 2010). (B) Représentation schématique de l'intasome du PFV (Yin & Craigie, 2011). A.III.4. Le mécanisme d'intégration L intégration de l ADN viral dans l ADN hôte se produit en trois étapes indépendantes : la maturation (ou 3 processing ou 3 P) des extrémités virales (LTR) par IN ; l intégration des extrémités processées dans l ADN chromosomique de la cellule hôte (ST). Enfin, l intégration est finalisée par la réparation des sites d intégration par des enzymes 40

41 Introduction cellulaires (Faust & Triller, 2002). Le 3 P des extrémités de l ADN viral a lieu dans le cytoplasme tandis que le ST est évidemment nucléaire. Les deux réactions catalysées par IN correspondent à des attaques nucléophiles par une molécule d'eau pour le 3 P et par l'extrémité 3'OH pour le ST, et requièrent un cofacteur métallique, le magnésium in vivo. La réaction d'intégration est décrite sur la figure 9. A.III.4.1. Le 3 -processing (maturation ou 3 P) Dans un premier temps, IN se fixe spécifiquement sur une séquence courte aux extrémités de U3 et U5 des LTR, générées lors de la transcription inverse. Après sa fixation, IN catalyse la délétion endonucléolytique du dinucléotide GT à chaque extrémité 3' de l'adn viral. Ce clivage est séquence-spécifique et requiert la présence du dinucléotide CA, hautement conservé chez tous les rétrovirus et transposons, devant le dinucléotide GT enlevé par l enzyme (Esposito & Craigie, 1998; Sherman & Fyfe, 1990; Vink et al., 1991). Cette maturation des LTR produit des extrémités saillantes 3 OH nécessaires à la réaction de transfert (Lewinski & Bushman, 2005). Dans l'intasome de VIH-1, modélisé à partir de l intasome du PFV, l adénine porteuse du groupement 3 OH sur le brin activé est dissociée de sa thymine complémentaire. En fait, le fraying de l ADN viral au niveau du site actif de l enzyme est une caractéristique commune aux transpososomes et aux intasomes rétroviraux. Il peut aider à l orientation adéquate tout d abord de la liaison phosphodiester scissile CA GT en vue de son clivage par l enzyme et ensuite du 3 OH pour l attaque nucléophile de l ADN cible dans le ST (Hare et al., 2010; Krishnan et al., 2010). A.III.4.2. Le transfert de brins Le mécanisme de capture de l ADN cible et la réaction de ST ne sont pas encore très bien compris malgré la disponibilité de structures de plusieurs intasomes/ tranpososomes de la superfamille des recombinases DDE(D) (Davies et al., 2000; Hare et al., 2010; Richardson et al., 2009). La co-cristallisation de l intasome du PFV avec un ADN cible conçu sur la base d un site consensus de l intégration du PFV a permis d élucider le processus de capture de l ADN chromosomal par la machinerie d intégration rétrovirale. On constate que l ADN 41

42 Introduction cible se loge dans la fente entre les deux moitiés symétriques de l intasome. Ce dernier ne subit aucun réarrangement mais induit une courbure dans l ADN cible. Cette courbure permet aux sites actifs de IN éloignés de 26.5Å d accéder plus facilement aux liaisons phosphodiesters scissiles de l ADN cible (Maertens et al., 2010). Une fois positionnée sur l ADN cible de la cellule, IN catalyse une réaction de type substitution nucléophilique SN2 assistée par un ion divalent coordinné par la triade catalytique. L extrémité 3 réactive de l ADN donneur se trouve à proximité des résidus Asp 64, Asp 116 et Glu 152 de la triade catalytique. Conformément au mécanisme faisant appel à deux ions métalliques, l ion coordiné à Asp 64 et Glu 152 est responsable de l activation du 3 OH de l ADN viral processé et l ion coordiné aux chaînes latérales de Asp 64 et Asp 116 serait en place pour déstabiliser la liaison phosphodiester de l ADN cible. Les ions métalliques ont une coordination octahédrale avec les carboxylates du site actif, le 3 OH de l ADN viral et 4 molécules d eau (Figure 8) (Hare et al., 2010). Figure 8: Le site actif de l'intasome du PFV. La protéine et l'adn sont représentés en gris. Les sphères mauves représentent les atomes de Mn 2+ et les sphères rouges représentent les atomes d'eau coordinés aux cofacteurs métalliques (Hare et al., 2010). La double attaque nucléophilique de l ADN cellulaire de l hôte lors de l intégration s effectue avec un décalage de 5 pb. Le ST a lieu de façon concertée pour les deux extrémités 42

43 Introduction de l ADN viral. Une fois le ST effectué, la liaison phosphodiester ADN viral-adn cible nouvellement formée est déplacée de 2.3Å ce qui la rejette à l extérieur du site actif. Ce changement conformationnel évitera la réversibilité de la réaction. Comme prédit par le degré relativement faible de sélectivité de séquence de l ADN chromosomal par les rétrovirus, les interactions entre IN et l ADN cible sont dispersées à l'exception de deux interactions étroites avec Arg 329 et Ala 188 de IN de PFV (équivalent à Ser 119 de IN de VIH-1) (Maertens et al., 2010). A.III.4.3. La réparation post-intégration L'étape ST laisse cinq bases non appariées de part et d'autre de l'adn viral. Une dernière étape de réparation de l élément intégré est donc requise. Elle consiste à éliminer les 2 nucléotides des extrémités 5 saillantes, à relier ces extrémités avec les extrémités 3 de l ADN chromosomique, et à combler les espaces (gap) situés à la jonction de l ADN chromosomique et de l ADN viral. La nature des protéines responsables de la réparation de l ADN a fait l objet de plusieurs études. On admet que la réparation se fait par le biais d enzymes cellulaires. A.III.5. Activités catalytiques de IN in vitro A.III.5.1. L intégration in vitro La réaction d intégration peut être reproduite in vitro. Les réactions de 3 P et de ST peuvent être reconstruites séparément (Bushman & Craigie, 1991; Sherman & Fyfe, 1990) ou bien dans le cadre d une intégration complète ((Hindmarsh & Leis, 1999a; Sinha & Grandgenett, 2005; Sinha et al., 2002). Dans les tests d'intégration in vitro, seule IN est nécessaire et suffisante pour catalyser tout le processus. Ces tests ont servi à détailler les activités de IN et à étudier les effets de molécules inhibitrices. 43

44 Introduction Figure 9: Séquence des événements de l'intégration du VIH-1. I) ADN viral, II) 3'P catalysé par IN; III) ST catalysé par IN; IV) Produit du transfert de brins, V) Réparation de l'adn par des enzymes cellulaires. Les parties de ADN viral qui s'intègrent sont en rouge, l'adn cible est en blanc et les parties de l'adn cible réparées à la suite de la réaction de ST sont en gris (Savarino, 2007). 44

45 Introduction A.III.5.2. La désintégration In vitro, IN peut catalyser une troisième réaction, la désintégration, perçue comme la réaction inverse du ST. La désintégration n a jamais été mise en évidence in vivo. Cette réaction peut être catalysée par CCD isolé (Gerton & Brown, 1997) contrairement à la réaction d intégration qui nécessite les trois domaines constitutifs de IN. Un processus pharmacologique retardant la dissociation de IN du produit d intégration, favoriserait cette réaction inverse et diminuerait l efficacité d intégration. Cette réaction sert à tester le mécanisme compétitif de certains inhibiteurs (Mousnier et al., 2007). A.III.6. Les cofacteurs métalliques de IN Un cofacteur métallique est strictement requis dans les réactions de 3 P et de ST. Il semblerait que pour l IN de VIH-1, le cofacteur métallique (Mg 2+ ou Mn 2+ ) induit un changement conformationnel dans le site actif (Asante-Appiah & Skalka, 1997). Ce cofacteur peut être le Mn 2+ ou le Mg 2+ in vitro, mais c est bien évidemment le Mg 2+ in vivo. La spécificité réactionnelle est plus grande en présence de Mg 2+. C est justement pour cette raison que tous les inhibiteurs de IN contiennent un groupement chélateur de Mg 2+. A.III.7. Interactions IN-ADN viral A.III.7.1. Les résidus de IN Pour identifier les acides aminés qui interagissent directement avec l'adn viral, des expériences de photo-pontage ont été menées (Esposito & Craigie, 1998; Heuer & Brown, 1997; Heuer & Brown, 1998; Jenkins et al., 1997; Johnson et al., 2006; Mazumder et al., 1996). Ces expériences ont révélé plusieurs points-clés de contact. Par exemple, les résidus K159, Q148 et Y143 interagissent spécifiquement avec les extrémités de l'adn viral (Esposito & Craigie, 1998; Jenkins et al., 1997). K159 appartient à l'hélice α4 contenant le résidu catalytique E152 à son extrémité N-terminale et peut interagir directement avec la base adénine et le groupement phosphate du CpA invariant (Agapkina et al., 2006; Jenkins et al., 45

46 Introduction 1996). En outre, K159 et K156 appartiennent tous les deux à la séquence riche en lysine K156 E L K159 K160, impliquée dans la liaison spécifique de l'adn à IN (Semenova et al., 2008). La base de l'adénine du CpA (et celle de la thymine complémentaire) est également en contact avec le résidu catalytique E152 de l'hélice α4 (Gerton & Brown, 1997). Y143 et Q148 situés au niveau de la boucle flexible 140 peuvent contribuer au positionnement précis des ADN viral et cible et le résidu Q148 interagit avec l'adénine (Esposito & Craigie, 1998) et la cytosine (Johnson et al., 2006) du 5'AC pendant du LTR processé. Des alignements de séquences entre IN du VIH et d'autres INs rétrovirales ont également été exploités pour l'identification des acides aminés qui contribuent à la reconnaissance de l'adn viral (Chen et al., 2006; Dolan et al., 2009). La mutagénèse dirigée a montré que les résidus V72, S153, K160, I161, G163, V165, H171 et L172 participent directement ou indirectement à la reconnaissance de l'adn viral. Dans une autre étude, les résidus conservés de l IN de VIH-1, particulièrement ceux de la boucle flexible F139-Q146 et de l'hélice α4 amphiphile S147-V165 connus pour leur participation à la liaison de l'adn ont été ciblés par mutagénèse dirigée pour évaluer leurs rôles dans la réplication virale (Lu et al., 2004; Lu et al., 2005). Les résultats ont montré que Q62, H67, N120, Q148, N144 et N155 sont impliqués dans l'intégration, soutenant des données antérieures indiquant que Q62 et N120 interagissent avec l'adn viral et l'adn cible, respectivement, et suggérant des rôles dans l'intégration pour H67 et N155. De même, Krishnan et al. (2010) ont vérifié l implication de nombreux résidus dans la liaison à l ADN. Les rôles potentiels de ces résidus dans l activité de IN ont été examinés par corrélation entre le 3'P et la liaison à l ADN de protéines portant des mutations ponctuelles. Les résidus K219, R262, R263, R269 ainsi que les résidus K156 et K159, K266, R20 et N18 sont tous impliqués dans la liaison à l'adn: Les mutants en ces différentes positions tétramérisent avec la même efficacité que IN sauvage mais sont défectueux pour le 3 P et la liaison à l ADN. Les structures cristallographiques récentes de l'intasome du PFV ainsi que les modèles de l'intasome de VIH-1 issus de ces structures confirment que les interactions spécifiques engagent essentiellement l'hélice α4 et la boucle 140 (G149, S153, S147), en accord avec les résultats des études biochimiques et spectroscopiques (Alian et al., 2009; Chen et al., 2006; 46

47 Introduction Esposito & Craigie, 1998; Hobaika et al., 2009; Jenkins et al., 1997; Johnson et al., 2006; Zargarian et al., 2003). Les résultats indiquent aussi que des résidus appartenant aux trois domaines fonctionnels des monomères internes de IN ainsi qu aux linkers interdomaines contactent l ADN viral: ces interactions engagent les 6 nucléotides terminaux, où l ADN viral dévie considérablement de sa forme B idéale (Renisio et al., 2005). Les interactions ont lieu principalement avec le brin d ADN non transféré et la majorité de ces interactions se font avec le squelette phosphodiester de l ADN viral. Plusieurs contacts de la protéine se font aussi avec les bases de nucléotides importants, définissant ainsi la spécificité de l interaction. La boucle flexible (résidus de IN de PFV/ de IN de VIH-1) est impliquée directement dans la séparation des deux brins de l ADN viral par les deux résidus hautement conservés P214 et Q215 (correspondant aux résidus P145 et Q146 pour le VIH-1). Ces interactions provoquent l élargissement du petit sillon de l ADN viral. Au niveau du terminus du brin réactif de l ADN viral, la paire de bases C:G du dinucléotide CA/GT invariant est distordue d un angle de 30, alors que l adénine 3 est complètement dissociée de son nucléotide complémentaire thymine sur le brin non transféré (Figure 10) (Hare et al., 2010). Figure 10: Interactions protéine-adn viral au niveau du site actif de l'intasome du PFV: mise en évidence de l'hélice α4, de la boucle flexible et des six derniers nucléotides du LTR (Hare et al., 2010). 47

48 Introduction A.III.7.2. Les nucléotides de l'adn viral Le processus d'integration requiert deux fonctions codées par le virus: l enzyme IN (Donehower & Varmus, 1984; Engelman & Craigie, 1995) et la séquence d'attachement (att) localisée au niveau du LTR (Colicelli & Goff, 1985; Panganiban & Temin, 1983). Bien que la spécificité réactionnelle de IN soit irrécusable, la spécificité de fixation de IN sur l ADN viral est discutable: un ADN non spécifique peut entrer en compétition avec l ADN viral pour la liaison à IN, inhibant le 3 P, sans pouvoir toutefois remplacer l ADN viral en tant que substrat pour la réaction de maturation (Dotan et al., 1995; LaFemina et al., 1991; van Gent et al., 1991). IN est donc capable de reconnaître les extrémités de l'adn viral et de le distinguer d'un ADN non spécifique tant au niveau de sa séquence que sa structure. A.III Rôle de la séquence En termes de spécificité, l'intégrité du site att de l'adn viral est strictement requise pour l interaction de haute affinité de IN. Cependant, les nucléotides de l extrémité de l ADN viral n ont pas tous la même importance pour la reconnaissance de l ADN et dans le cycle viral (Katzman & Katz, 1999). Ceci a été confirmé par des résultats d anisotropie de fluorescence issus de notre laboratoire (Hobaika et al., 2009; Zargarian et al., 2003). En particulier, des mutations au niveau du site de clivage CA GT3 ne sont pas du tout tolérées: la mutation de A hautement conservé abolit l interaction de haute affinité de l ADN pour IN, confirmant ainsi le rôle éminent de ce résidu dans le processus de reconnaissance. In vivo, la substitution de A entraîne une réduction drastique, jusqu à 100 fois moins, de l activité de 3 P. Cela est également vrai pour le dinucléotide GT3 qui une fois muté, altère le 3 P (Bushman & Craigie, 1991; Esposito & Craigie, 1998; LaFemina et al., 1991; Sherman et al., 1992) et aussi pour le dinucléotide 5 AC faisant face au GT3 (Heuer & Brown, 1997; Heuer & Brown, 1998; Jenkins et al., 1997). Globalement, toute modification au niveau des 6 dernières paires de bases a un impact sur la reconnaissance de l ADN viral par IN avec un rôle crucial de la paire de dinucléotide CA/GT (Bushman & Craigie, 1991; Craigie et al., 1990; LaFemina et al., 1991; Sherman et al., 1992; Vink et al., 1991) alors que l intégrité des séquences adjacentes est de moindre importance (Zargarian et al., 2003). Etrangement, certaines études ont démontré que même la séquence CA/GT n'était pas absolument nécessaire pour le 3'P (Katz et al., 2011) et 48

49 Introduction l'intégration médiée par IN in vitro (Oh et al., 2008a; Oh et al., 2008b). Il a aussi été démontré qu'il y a reconnaissance croisée par différentes IN rétrovirales des extrémités des LTR présentant une identité de séquence limitée et que l'adn viral conservait sa fonction de substrat après plusieurs substitutions de paires de bases. A.III Rôle de la structure En plus de la séquence de l ADN viral, les résultats d un grand nombre d études ont montré que la structure de l'adn contribue fortement à sa reconnaissance par IN. Le dinucléotide CA/GT conservé à l'extrémité de tous les ADN rétroviraux, les LTR rétrotransposons et certains ADN transposons présente une structure très particulière (Renisio et al., 2005). La conservation de cette séquence va donc de paire avec la consevation d'une structure bien définie à l extrémité de l ADN viral. Celle-ci peut être utile à une reconnaissance hautement spécifique de haute affinité et à la catalyse de la liaison scissile adjacente. L'importance de la structure dans la reconnaissance et le 3'P de l'adn viral a été confirmée par Scottoline et al. (1997). Les auteurs ont pu montrer que: a) le désappariement des paires de base aux extrémités de l'adn viral était un préambule à un 3'P efficace; b) l'extension du duplex d'adn viral au delà de son terminus inhibait cette activité et c) l inhibition est levée par l'introduction d un ''mismatch'' à la jonction entre l'extrémité de l'adn viral et l'extension. Ces résultats suggèrent que la dissociation des 2 brins de l'adn viral- le fraying à l extrémité de l ADN- est nécessaire à la réaction de processing. A.III.7.3. Les sites d intégration dans l ADN cellulaire L intégration de l ADN viral ne semble pas s effectuer en un site spécifique du génome de la cellule hôte. Et pourtant, l intégration se fait préférentiellement au sein de gènes actifs pour la transcription (Mitchell et al., 2004), au niveau de séquences palindromiques (Wu et al., 2005) et de structures locales flexibles, courbées. Quant aux facteurs jouant un rôle dans le ciblage de l intégration, il s agit de facteurs cellulaires du CPI, notamment le LEDGF/p75 (Shun et al., 2007). 49

50 Introduction A.III.8. Les partenaires cellulaires de IN du VIH-1 L intégration rétrovirale est sous le contrôle de IN virale, mais elle nécessite aussi l intervention de partenaires cellulaires. Parmi les cofacteurs ayant la capacité d interagir avec IN, certains vont avoir un impact direct sur la réplication virale. C est le cas de protéines responsables des modifications post-traductionnelles de IN régulant ses activités. IN de VIH- 1 est capable d interagir avec les histones acétyltransférases P300 et GCN5. Ainsi, IN est acétylée par P300, in vitro et in vivo, sur les résidus lysines 264, 266 et 273 et par GCN5 sur la lysine 258 ce qui va augmenter à la fois son affinité pour l ADN et son activité catalytique in vitro. Si l acétylation de IN a été confirmée par deux études différentes, son impact sur la réplication virale est lui plus controversé (Cereseto et al., 2005; Topper et al., 2007). IN subit aussi l'ubiquitination pour être dégradée par le protéasome après l'étape d'intégration de l'adn viral dans le génome de la cellule-hôte. La dégradation de IN serait requise pour permettre une réparation correcte de l'adn après intégration, indispensable pour l'étape de transcription subséquente (Mousnier et al., 2007). De plus, il a été montré que IN est sumoylée in vivo au niveau de trois résidus lysines K46, K136, K244. Les sites de sumolylation ne sont pas ciblés par l'acétylation ou l'ubiquitination. Bien que la mutation au niveau de ces lysines entraîne une diminution de l infectiosité in vivo, la distribution cellulaire de IN, sa stabilité ou encore son activité in vitro ainsi que sa fixation à LEDGF restent inchangées. Le rôle exact des sumoylations reste donc inconnu (Zamborlini et al., 2011). Récemment, il a été montré que IN subit aussi la phosphorylation ce qui module sa stabilité et est nécessaire pour une intégration efficace (Manganaro et al., 2010). Au cours de ces dernières années, une attention toute particulière s est portée sur le LEDGF/p75 comme cofacteur cellulaire de IN. Des résultats récents ont mis en évidence l importance de LEDGF/p75 dans l intégration et la réplication du VIH-1. LEDGF/p75 a tout d abord été identifié comme un coactivateur général de la transcription. Il a été suggéré que LEDGF/p75 pourrait jouer un rôle dans l activation des gènes de réponse au stress en se fixant spécifiquement aux séquences HSE (éléments de réponse aux chocs thermiques) et STRE (éléments de réponse associés au stress) (Shinohara et al., 2002; Singh et al., 2001). Cependant, la spécificité de ces interactions n a pas été confirmée. Des travaux ont décrit un rôle de LEDGF/p75 dans la croissance et la survie de plusieurs types cellulaires dans certaines conditions de stress (Singh et al., 2000). 50

51 Introduction Récemment, un nombre important d études a souligné l importance de LEDGF/p75 dans la réplication du VIH-1. Tout d abord, LEDGF/p75 a été isolé par différentes méthodes comme étant capable de se fixer à IN. L interaction de LEDGF/p75 avec IN se fait par l intermédiaire de sa région IBD (integrase-binding domain), retrouvée dans la région C- terminale entre les résidus 340 et 417. De son côté, le CCD de IN contient les déterminants nécessaires à l interaction avec la région IBD. Plusieurs résidus de IN ont été identifiés par des études de mutagenèse dirigée comme étant impliqués dans la fixation à LEDGF/p75. Ces études montrent qu il existe en général une bonne corrélation entre la perte d interaction avec LEDGF/p75 et une diminution de la capacité du virus à se répliquer. En particulier, les mutations des résidus R166 et Q168 vont diminuer l affinité de IN pour l IBD, sans pour cela inhiber son activité enzymatique in vitro. Cette diminution d affinité pour LEDGF/p75 va se traduire par un blocage de la réplication au niveau de l étape d intégration (Busschots et al., 2007; Emiliani et al., 2005; Rahman et al., 2007). Une structure cristallographique d un complexe formé par le domaine catalytique de IN avec la région C-terminale de LEDGF/p75 a été déterminée (figure 11). Elle montre que l IBD interagit avec l interface du dimère de IN, impliquant la boucle connectant les hélices α4 et 5 de l un des monomères de IN ainsi que la poche hydrophobe formée par les hélices α1 et 3 du second monomère de IN (Cherepanov et al., 2005). Figure 11: Structure du complexe IN CCD -LEDGF IBD. Les deux monomères de IN sont en bleu et vert. De chaque côté du dimère de IN se fixe une molécule IBD de LEDGF/p75, représentée en rose (Cherepanov et al., 2005). 51

52 Introduction De façon remarquable, LEDGF/p75 est capable de cibler directement IN sur les chromosomes de la cellule hôte (Emiliani et al., 2005). L analyse des sites d intégration du VIH-1 dans des cellules humaines partiellement déplétées en LEDGF/p75 a montré que l intégration était : 1) moins fréquente dans les unités transcriptionnelles ; 2) moins fréquente dans les gènes LEDGF/p75 dépendants ; 3) plus fréquente dans les régions riches en GC (Ciuffi et al., 2005). A. IV. Thérapies anti-sida Depuis que le SIDA a été identifié, les progrès thérapeutiques ont permis de concevoir une trentaine de médicaments ciblant les différentes étapes du cycle réplicatif du virus. Actuellement, le traitement de choix est celui qui combine plusieurs antirétroviraux (ARV). Il est connu sous le nom de thérapies antirétrovirales hautement actives-haart. Les HAART associent trois ou plus médicaments avec au moins deux mécanismes d action différents. Elles sont utilisées contre le VIH/SIDA depuis le milieu des années 90. Ces thérapies ont modifié le pronostic létal de la maladie en la transformant en maladie chronique (Chun et al., 1997; Finzi et al., 1997). En effet, si les médicaments réduisent la charge virale dans le sang à 50 particules/mm 3, ce qui est compatible avec une vie normale, ils ne peuvent se débarrasser des VIH, réfugiés au sein, principalement, de lymphocytes T CD4+ quiescents, qui forment des réservoirs chez les patients traités. Les HAART ont fortement diminué le nombre de décès et ont amélioré la qualité de vie des personnes infectées (Hogg et al., 1997) tout en augmentant leur espérance de vie. Toutefois, la résistance aux drogues est importante (Clavel & Hance, 2004; Kantor et al., 2005) et un très grand nombre de patients meurent encore dû à des virus multi-résistants. Les molécules antirétrovirales appartiennent à cinq classes thérapeutiques et représentent six familles de molécules. 52

53 Introduction A.IV.1. Les inhibiteurs de la transcriptase inverse La TI est la cible de deux classes d ARV, les inhibiteurs nucléosidiques (INTI) et non-nucléosidiques (INNTI). Ces deux classes d inhibiteurs se distinguent par leurs structures chimiques différentes. A.IV.1.1. Les Analogues nucléosidiques ou nucléotidiques de la transcriptase inverse (INTI) L AZT, un INTI introduit en 1986, est le premier ARV anti VIH/SIDA (Yarchoan et al., 1986). Les INTI constituent jusqu'à présent le fondement des thérapies antirétrovirales. Ils rentrent en compétition avec les déoxynucléosides cellulaires et inhibent ainsi l action de la TI en empêchant l élongation de l ADN. Ils sont actifs sur le VIH-1 et le VIH-2 (Tantillo et al., 1994). Une toxicité, a été mise en évidence en particulier pour les mitochondries (Brinkman et al., 1998). Les mutations qui surviennent dans le gène de TI entraînent des résistances aux INTI. A.IV.1.2. Les inhibiteurs non-nucléosidiques de la transcriptase inverse (INNTI) Découverts par criblage aléatoire d agents inhibiteurs de la réplication du VIH en culture cellulaire, les INNTI sont des inhibiteurs non compétitifs de la TI. Leur fixation avec une forte affinité dans une petite poche hydrophobe de la TI, proche du site actif de l enzyme entraîne un changement conformationnel qui bloque la réaction de polymérisation. Leur activation n'exige pas de phosphorylation préalable. Les INNTI sont inactifs sur le VIH-2. Les INNTI de première génération, la névirapine et l éfavirenz se caractérisent par la sélection rapide de mutations réduisant l affinité de l inhibiteur pour la TI et entraînant une résistance croisée aux 2 composés. Des INNTI de deuxième génération notamment l étravirine ont été alors développés et se sont avérés très actifs sur les virus porteurs de mutations. Cette classe de médicaments regroupe une trentaine de classes de molécules chimiques (De Corte, 2005). 53

54 Introduction A.IV.2. Les inhibiteurs de protéase (IP) Une meilleure connaissance de la structure de la PR du VIH et de son substrat a permis l éclosion des IP. Arrivés au milieu des années 90, ils ont modifié le pronostic de la maladie suite à l introduction des trithérapies qui associent 2 INTI et 1 IP. Cette association entraîne une augmentation impressionnante de la numération des T CD4+ et une baisse conséquente de la charge virale plasmatique. Les IP sont des inhibiteurs spécifiques et réversibles de la PR. Les particules virales produites sont immatures et non infectieuses. Neuf IP ont été approuvés pour usage clinique : le saquinavir, le ritonavir, l indinavir, le nelfinavir, l amprenavir, le lopinavir, l atazanavir, le tipranavir et le darunavir. La plupart sont prescrits associés à une faible dose de ritonavir qui sert de potentialisateur. Tous ces inhibiteurs, à l exception du tipranavir, sont des inhibiteurs peptidomimétiques compétitifs, mimant les substrats naturels de la PR virale. Ils contiennent un core hydroxyéthylène, qui empêche le clivage de l IP par la PR du VIH (Craig et al., 1991; Kempf et al., 1995; Koh et al., 2003; Partaledis et al., 1995; Patick et al., 1996; Robinson et al., 2000; Sham et al., 1998; Vacca et al., 1994). Le tipranavir contient un noyau dihydropyrone à la place de l hydroxyéthylène (Turner et al., 1998). Les IP sont très efficaces en monothérapie mais sont très sensibles aux mutations dans PR. Utilisés en trithérapie, ils induisent moins de mutations de résistance. De plus, les IP potentialisent les INTI et contrairement à ces derniers ils n ont besoin d aucune activation métabolique intracellulaire. A.IV.3. Les inhibiteurs de IN Les inhibiteurs de IN seront détaillés dans le paragraphe A.V. De même, des inhibiteurs d entrée ont été développés dans le but d élargir l arsenal thérapeutique à côté des inhibiteurs du cycle réplicatif, afin de surmonter les problèmes de résistance. 54

55 Introduction A.IV.4. Les inhibiteurs d entrée L entrée du VIH dans la cellule est un processus hautement spécifique qui met en jeu de nombreuses molécules virales et cellulaires et constitue de ce fait une cible thérapeutique de choix (voir ci-dessus). A.IV.4.1. Les inhibiteurs de fusion L enfuvirtide est le premier inhibiteur de fusion utilisé (T20) [Fuzeon ]. C est un peptide de 36 acides aminés mimant un fragment de la région HR2 de gp41 qui interagit normalement avec la région HR1 et facilite la fusion de l enveloppe virale avec la membrane cellulaire. Enfuvirtide se lie à HR1 et empêche son interaction avec HR2. Il empêche aussi le changement de conformation de gp41. La fusion des membranes virales et cellulaires et la libération de la capside virale dans la cellule-hôte sont alors inhibées. L enfuvirtide est indiqué en association avec d'autres ARV, dans le traitement des patients porteurs de virus résistants aux autres classes thérapeutiques (IP, INTI, INNTI) (Raffi, 2004). Une résistance à l'enfuvirtide survient suite à des mutations dans les séquences HR1 et HR2 de la gp41 (Sista et al., 2004; Wei et al., 2002) sans qu il n y ait, toutefois, de résistance croisée avec les médicaments des autres classes thérapeutiques. A.IV.4.2. Les inhibiteurs de la liaison CD4-gp120 Plusieurs molécules-candidates bloquent l interaction CD4-gp120. Celles-ci possèdent des structures chimiques et des mécanismes d action différents (Exemples: TNX355 et CADA). - Le TNX355 (immunoglobuline G4 anti-cd4) est un anticorps monoclonal nonimmunosuppresseur et très prometteur dans les essais cliniques. Il se lie à CD4 et inhibe l entrée virale (Jacobson et al., 2009; Moore et al., 1992). - Le cyclotriazadisulfonamide (CADA) est un inhibiteur spécifique de la liaison CD4-gp120 qui sous-régule l expression de CD4 et inhibe, de ce fait, l infection par le VIH (Vermeire & Schols, 2003). 55

56 Introduction A.IV.4.3. Les antagonsites de CCR5 et de CXCR4 L inhibition de l'interaction entre les produits de Env et les corécepteurs aux chimiokines CCR5 et CXR4 est une des stratégies les plus efficaces dans le contrôle de la maladie. Les chimiokines CCL3 (MIP-1α), CCL4 (MIP-1β), and CCL5 (RANTES) qui se fixent sur CCR5 (Cocchi et al., 1995), bloquent sélectivement l entrée des souches VIH-R5 en inhibant la liaison Env-CCR5 et en induisant l'internalisation de CCR5 (Alkhatib et al., 1997). Mais elles ont évidemment potentiellement une activité agoniste indésirable sur les corécepteurs. Une autre stratégie pour inhiber les interactions gp120-corécepteur est utilisée par un groupe de petits composés moléculaires établissant des contacts avec les résidus de la poche hydrophobe des hélices transmembranaires de CCR5. Ils exercent leurs effets antiviraux en figeant les corécepteurs dans une conformation non permissive pour la glycoprotéine virale. Certains de ces composés ont été testés chez l'homme. Le maraviroc (UK ) développé par Pfizer a été approuvé en 2007 par la FDA pour le traitement des patients atteints du VIH ayant une réplication virale et porteurs de souches virales résistantes à plusieurs ARV. Il est efficace sur les souches de VIH à tropisme R5 à très faible concentration (dans la gamme du nanomolaire faible) (Dorr et al., 2005). L apparition de virus résistants a été constatée in vitro. Ces souches utilisent CCR5 malgré la fixation concomitante de cet inhibiteur sur ce corécepteur (Westby et al., 2007). Des antagonistes de CXCR4 ont été également développés (Briz et al., 2006). Tous ces inhibiteurs ne présentent pas de mutations croisées avec d autres classes thérapeutiques. Outre les inhibiteurs cités ci-dessus, des voies prometteuses de lutte contre le virus consistent à cibler les interactions protéine-protéine à presque toutes les étapes du cycle viral. C'est ainsi que l'inhibition de la TI du virus peut passer par la perturbation de l'interaction protéine-protéine entre les sous-unités p66 et p51 de la TI puisque l'hétérodimère est requis pour la fonction enzymatique et ce par un peptide linéaire dérivé d'un motif structural situé entre les résidus 284 et 300 de p51. Similairement, des peptides ou des triterpènes inhibent l'homodimérisation de la PR requise pour son activité. Ces composés sont encore en voie de 56

57 Introduction développement. Les interactions CA / CA qui sont au cœur de la maturation des virus constituent aussi une cible intéressante pour le développement de nouveaux agents antiviraux qui inhibent le virus. Un peptide linéaire qui se lie à une poche hydrophobe conservée de la capside en modifiant l'interface dimérique inhibe l'assemblage des capsides in vitro. De plus, l'inhibition de l'interaction Rev-RRE inhibe l'export nucléaire des ARNm non et monoépissés. La proflavine est un composé hétérocyclique qui se fixe spécifiquement et avec une affinité élevée au RRE. La proflavine entre en compétition avec Rev en se fixant sous forme dimérique au niveau d'un site unique du RRE inhibant ainsi la transcription virale (Tavassoli, 2011). A.V. Les inhibiteurs de IN IN a été la dernière enzyme du cycle de réplication du virus à être ciblée par les inhibiteurs en raison principalement de l absence de structure tridimensionnelle. IN est particulièrement intéressante du fait de son rôle-clé dans le cycle viral, et aussi parce qu elle ne présente pas d'équivalent dans la cellule. On peut ainsi supposer que les inhibiteurs de IN n interféreront pas avec des processus cellulaires normaux et seront de ce fait moins toxiques que les ITI et les IP. Les premiers inhibiteurs de IN administrés en clinique ont un indice thérapeutique élevé, et leur utilisation a modifié le pronostic des patients en multi-échec. L obtention d une charge virale indétectable chez les patients lourdement prétraités est désormais envisageable avec l arrivée des inhibiteurs de IN et des inhibiteurs d entrée. A.V.1. Les inhibiteurs de IN non sélectifs du ST Les premiers inhibiteurs de IN (INI) publiés en 1993 sont non sélectifs du ST. Ils appartiennent à la famille des polyphénols (Fesen et al., 1993; Fesen et al., 1994) et peuvent être classés en fonction de la présence ou non de motif acide caféique. Les inhibiteurs de IN à activité antivirale ciblent également d autres étapes du cycle viral de VIH et ne peuvent de ce fait être considérés comme inhibiteurs spécifiques de IN. 57

58 Introduction A.V.2. Les inhibiteurs sélectifs du ST A.V.2.1. Les DKA et leurs dérivés ou molécules apparentées Les inhibiteurs α, γ -dicétoacides (DKA) (Figure 12) ont été identifiés en 2000 par les chercheurs de la firme pharmaceutique Merck à partir d'un criblage aléatoire de composés, et étaient pendant une période de temps les seuls INI biologiquement validés (Hazuda et al., 2000). Ces composés, dont la molécule de référence est le L-731,988 (Reinke et al., 2002), ont démontré une activité inhibitrice du ST (IC50= 80nM) nettement meilleure que celle de l inhibition du 3 P (6µM) et ont par conséquent reçu l appellation d «Inhibiteurs de Transfert de Brin de IN» (INSTI) (Hazuda et al., 2000). L-731, 988 et un analogue, le L-708, 906 (Figure 12A et B), ont démontré une capacité à inhiber la réplication de VIH-1 avec une IC50 de 1 à 2 µm. Des concentrations plus élevées empêchent la propagation du VIH-1 en culture cellulaire pendant plusieurs semaines. L-731, 988 et L-708, 906 entraînent une inhibition de l infection des macrophages et des cellules T, des isolats cliniques, et des variants viraux résistants aux ITI et aux IP. Leur activité antivirale en culture cellulaire a été cependant fortement réduite par l apparition de mutations de résistance sur IN, confirmant ainsi leur action sur cette protéine (Hazuda et al., 2000). Les efforts de synthèse de nouvelles molécules, associant au motif dicétoacide, des nucléobases (pyrimidine et purine), des catéchols, ou bien contenant deux fragments dicétoacides ont été vains : aucune amélioration n a été enregistrée par rapport aux L-708,906 et L-731,988 (Zhao et al., 2007). Presque simultanément aux travaux pionniers de Merck, le groupe Shionogi a étudié des α,γ-dicétones porteurs de groupements indoles substitués, inhibant IN purifiée avec des IC50 inférieures à 10 µm (Fujishita & Yoshinaga, 1999; Yoshinaga et al., 2002). Ces travaux ont conduit à l obtention du 1- (5-chloroindol-3- yl)-3-hydroxy-3-(2h-tétrazol-5-yl)- propénone (5CITEP) (Figure 12C), chef de file des DKA. Les IC50 d inhibition du 3 P et du ST pour le 5CITEP sont de 97 et 400µM, respectivement, en présence de Mg 2+ (Marchand et al., 2003). La molécule est aussi capable d inhiber la réaction de désintégration suggérant une liaison au niveau du site actif. 58

59 Introduction La structure cristallographique du CCD de IN lié au 5CITEP (Figure 13) a fourni les premières preuves structurales des interactions IN-DKA (Goldgur et al., 1999). La résolution de ce co-cristal a confirmé que l essentiel de l interaction de l inhibiteur avec le CCD se faisait par des liaisons hydrogène avec le résidu E152 de la triade catalytique et les résidus T66, N155, K156, Q148 et K159. Ces résidus appartiennent tous, à l exception de T66, à l hélice α4 au contact du site catalytique. En dehors de E152, aucun contact direct du 5CITEP avec les deux autres résidus catalytiques ni même avec l ion métallique n est observé (Goldgur et al., 1999). Le 5CITEP, tout comme le L-708, 906 bloque IN et aussi, mais à des concentrations 10 à 20 fois plus élevées, les recombinases VDJ RAG1/2 qui génèrent le répertoire d'anticorps. Certains DKA peuvent aussi inhiber la RNase H, ce qui n est pas étonnant puisque ce type de repliement est retrouvé au sein de IN (Pommier et al., 2005). Malgré l absence d activité antivirale du 5CITEP, sa co-cristallisation avec le CCD de IN et les études de docking ou de dynamique moléculaire qui ont suivi, ont permis la conception de nouvelles molécules inhibitrices de IN. Ces molécules présentent une meilleure affinité et spécificité pour IN, une tolérabilité et une biodisponibilité accrues. Le premier inhibiteur testé cliniquement, S-1360 (Figure 12D), développé par la firme Shionogi, a fait preuve d activité inhibitrice notable avec une IC50 de 0.02µM sur IN purifiée, une CE50 et une CC50 de 0,2 et 12 µm, respectivement, sur cellules infectées. Trois mutations de résistance au S-1360 (Q148K, I151L, N155S) au niveau de résidus appartenant à l hélice α4 et à la boucle 140 ont été identifiées. Figure 12: Dicétoacides et dérivés : A) L-708,906, B) L-731,988, C) 5CITEP, D) S

60 Introduction Figure 13: Interactions de 5CITEP au niveau du site actif de IN de VIH-1. Les acides aminés en interaction directe avec le 5CITEP sont en vert. E152 est le seul résidu de la triade catalytique à être porté par l hélice. Le S-1360 est actif contre les souches du VIH-1 résistantes aux autres inhibiteurs de VIH (INTI, INNTI et IP). Il possède même une synergie d action avec certains d entre eux (AZT, 3TC, névirapine et nelfinavir) (Billich, 2003). Malgré son profil pharmacologique et pharmacocinétique favorable chez des modèles animaux, S-1360 est rapidement éliminé par glucuronidation chez l'homme (Rosemond et al., 2004). Son développement a été stoppé en 2003 après la phase clinique II. La deuxième molécule à être entrée en étude clinique est le L-870,810 développé par Merck. Cette molécule appartient à la famille des naphthyridines carboxamides qui dérive des DKA. L-870,810 bloque la réplication du VIH-1 en culture cellulaire avec une valeur de IC50 de 10nM. La formation du CPI et la fixation des extrémités virales sont des prérequis pour l inhibition par ce composé. Malgré une activité antivirale remarquable (CE95 = 19 nm, CC50 > 5 µm), les essais cliniques sur le L-870,810 ont été abandonnés en raison de toxicité cellulaire intolérable dans le foie et les reins de chiens (Hazuda, 2003; Zhuang et al., 2003). La plupart des INSTI qui ont été décrits, y compris les DKA, inhibent IN par chélation des cations divalents liés à son site actif et requis pour son activité catalytique (Hazuda et al., 2009; Marchand et al., 2002). Ils sont capables d entrer en compétition avec l ADN cible en se fixant sur un complexe IN-ADN viral (Espeseth et al., 2000). La fonction 60

61 Introduction acide carboxylique n est pas requise pour l interaction avec le complexe IN-ADN viral mais est indispensable pour l inhibition du ST (Grobler et al., 2002; Marchand et al., 2002). Il y a donc vraisemblablement interaction entre cette fonction acide et le magnésium lié aux résidus D64 et D116. L optimisation des composés dont le L-731,988 et le L-870,812 par Merck a conduit au développement du raltégravir (RAL; Isentress, MK-0518). A.V.2.2. Les INSTI utilisés contre le SIDA: Raltegravir, Elvitegravir et Dolutegravir Tous les INSTI décrits jusqu aujourd hui dérivent des DKA et naphthyridine carboxamide (Egbertson et al., 2007; Hazuda et al., 2000). RAL est le premier INSTI approuvé par la FDA en 2007, Elvitegravir (EVG) (Sato et al., 2006) vient aussi d'être approuvé par la FDA en Août L'approbation du dolutegravir (DTG; S/GSK ) (Kobayashi et al., 2010) ayant atteint des étapes avancées dans les essais cliniques (Metifiot et al., 2010) (Figure 14) est attendue en 2013, d autres INSTI sont également en bonne voie. RAL (Figure 14) présente une efficacité antivirale remarquable et des effets secondaires minimes. Les essais cliniques chez les patients ayant une résistance aux trois principales classes d ARV ont montré que l adjonction de RAL à deux autres molécules actives augmente de 45% à 77% le pourcentage de patients à charge virale < 50 copies/ml (Cooper et al., 2008). Cependant, RAL ne peut être utilisé en monothérapie, surtout en raison de l apparition rapide de mutants de résistance. Le pourcentage de mutations est de 78% chez les patients en échec ne recevant que RAL en comparaison avec 33% chez les patients soumis à une trithérapie. De plus, RAL a montré une efficacité remarquable dans la réduction des charges virales chez les patients naïfs (Summa et al., 2008). L approbation de RAL par la FDA pour les patients expérimentés, et plus récemment, pour les patients naïfs, a significativement fait évoluer le traitement du SIDA (Koelsch & Cooper, 2009). A.V Liaison des INSTI et mécanisme d inhibition Les INSTI (Figure 14) utilisés en thérapeutique se lient dans un espace à l interface IN-ADN viral au niveau du site actif de IN. Ils présentent tous des atomes d oxygène (ou 61

62 Introduction d azote) coplanaires rappelant le pharmocophore dicétoacide (McColl & Chen, 2010; Summa et al., 2008). Ces oxygènes ou azotes chélatent les ions métalliques divalents les rendant ainsi indisponibles pour la réaction de ST (Grobler et al., 2002). Par ailleurs, un rôle crucial a été attribué à l ADN dans la formation du site d interaction définitif de l inhibiteur, les INSTI étant incapables de se lier à IN avant liaison de l'adn viral (Espeseth et al., 2000). Figure 14: Structures chimiques de RAL, EVG et DTG. La co-cristallisation de l intasome du PFV en présence de plusieurs INSTI, notamment RAL, a permis d'éclaircir les modes de liaison des inhibiteurs. Ces résultats ont constitué aussi la base pour modéliser la liaison des INSTI au site actif de IN de VIH-1 (Barreca et al., 2009; Perryman et al., 2010; Savarino, 2007). En effet, les sites actifs de IN de PFV et de VIH-1 sont structurellement et fonctionnellement comparables. Une étude récente par RMN du CCD du IN de VIH-1 a montré que les boucles flexibles des IN de VIH-1 et de PFV (résidus du VIH-1 et du PFV) sont très similaires (Fitzkee et al., 2010). De plus, les INSTI sont capables d inhiber IN de PFV in vitro au même titre que IN de VIH-1 (Valkov et al., 2009). Tous ces arguments constituent des preuves pertinentes de l utilisation de IN de PFV pour étudier les inhibiteurs de IN de VIH-1 et les mutations de résistance. A.V Mécanisme d action de RAL et de EVG RAL engage les ions métalliques du site actif par interaction avec les atomes oxygène du pharmacophore. Le groupement halobenzyl se positionne dans la poche créée par le déplacement de l adénosine 3 (A17) à l intérieur de laquelle la drogue établit des 62

63 Introduction interactions de Van der Waals (VDW) avec les bases du dinucléotide invariant CA (C16, A17) et de la guanine du brin non transféré (G4: complémentaire au C du CA invariant) ainsi que les résidus conservés P214 et Q215 (correspondant aux résidus P145 et Q146 pour le VIH-1). En plus, le groupement isopropyl de RAL effectue une interaction hydrophobe avec la chaîne latérale du résidu P214 et le groupement méthyl-oxadiazole est impliqué dans une interaction de type empilement (stacking) avec la chaîne latérale de la Y212 (correspondant à Y143 du VIH-1), augmentant la stabilisation de l inhibiteur dans le site actif (Figure 15). Suite à la fixation de RAL, le 3 OH réactif de l'adénosine en 3 est expulsé loin du site actif de plus de 6Å (Figure 15A), cause principale de l inhibition de l intasome (Hare et al., 2010). De plus, la présence d un INSTI à l interface n'est pas compatible avec la liaison de l'adn hôte (Maertens et al., 2010), ce qui est en accord avec l observation d une compétition entre l'adn cible et les INSTI, pour la liaison à l intasome (Espeseth et al., 2000). Le mode de liaison de EVG à l intasome du PFV est identique à celui de RAL. Les interactions ADN-inhibiteur sont semblables, alors que pour les interactions inhibiteurprotéine, celles de EVG sont plus étroites avec P214 (P145 dans IN VIH-1) par rapport à RAL, via sa base quinolone et son groupement isopropyl. Et comme EVG ne possède pas de groupement oxadiazole, il n'y a pas d interaction avec Y212 (Figure 16). A B Figure 15: (A) Une molécule de RAL au niveau du site actif (réf. PDB 3OYA). La flèche rouge indique le déplacement du 3 OH de l ADN viral suite à la liaison de l'inhibiteur. (Cherepanov et al., 2011). (B) Structure chimique de RAL et ses principales interactions au niveau du site actif (Hare et al., 2012). 63

64 Introduction A B Figure 16: RAL (Réf PDB: 3L2T) et EVG (Réf PDB: 3L2U) au niveau du site actif de l intasome du PFV (Metifiot et al., 2010). A.V Mode de liaison des autres INSTI La cristallisation de l intasome du PFV en présence de Mg 2+ et de différents INSTI (RAL, L-870,810, PICA, GS9160, MK0536) (Figure 17) a montré que tous ces inhibiteurs se liaient de la même façon au site actif, causant à chaque fois le déplacement de l adénine 3, à la base du mécanisme d inhibition (Figure 18). A l exception du déplacement de cette adénosine, un ajustement conformationnel très limité de l intasome est requis pour accommoder les INSTI: des shifts mineurs ne dépassant pas les 0.7 Å dans les positions des cofacteurs métalliques dépendent en fait de l espacement entre les atomes du pharmacophore chélateur de métaux. Le changement le plus significatif a lieu sans doute au niveau de la chaîne latérale de Y212 dont le OH se déplace de 3.1 Å sous l effet des interactions (Figure 18B) (Hare et al., 2010). 64

65 Introduction Figure 17: Structures chimiques de différents INSTI. Le groupement fluorobenzyl est en bleu et le groupement chélateur de métaux est en rouge (Hare et al., 2010). A B Figure 18: Comparaison des modes de liaison des différents inhibiteurs. (A) Les inhibiteurs sont en bleu. Les tracés ovales en noir entourent les motifs conservés dans les inhibiteurs: 1, les hétéroatomes chélateurs de métaux; et 2, le cycle halogéné. (B) Vue alternative de la liaison des inhibiteurs: la chaîne latérale de Y212 est montrée pour souligner son implication dans la liaison de differents INSTI; l'adn est coloré en orange: mise en évidence du changement d'orientation de la 3'-adénosine (Hare et al., 2010). 65

66 Introduction A.V Résistances de VIH-1 à RAL et EVG Comme pour toutes les classes d ARV conçus jusqu à ce jour, des mutations de résistance de IN réduisent l'efficacité des INSTI (Metifiot et al., 2010). La substitution d un acide aminé est définie comme mutation primaire si elle confère une augmentation 10 fois de la résistance aux inhibiteurs. Des mutations secondaires qui agissent avec les mutations primaires augmentent la résistance générale du virus à l'inhibiteur. Les substitutions de Q148, N155 et T66 confèrent une résistance primaire à RAL et à EVG (Fransen et al., 2009; Kobayashi et al., 2008). La mutation de Y143 confère une résistance à RAL seulement (Delelis et al., 2010), alors que les substitutions au niveau des résidus E92, F121, P145, Q146, S147 et V151 sont observées dans les souches de virus résistantes à EVG (Kobayashi et al., 2008; Shimura et al., 2008) (résidus en bleu dans la figure 19). Chacune de ces mutations primaires peut se combiner à une mutation secondaire qui répare la réplication virale altérée par la première mutation (Delelis et al., 2009). Les mutations secondaires de RAL ont lieu au niveau des résidus: L68, L74, T97, F121, T125, E138, G140, V151, S147, G163 et D232 et sont indiquées en rose dans la figure 18. Les mutations secondaires de EVG ont lieu au niveau des résidus H51, L68, V72, L74, Q95, T97, T124, T125, E138, G140, G163, S230, D232 et R263 (Figure 19). Les mutations se produisent sur des résidus qui ne sont pas forcément en contact direct avec l inhibiteur. Y143 dans le cas de RAL et Q146 pour EVG sont les seuls résidus en contact direct avec les inhibiteurs. Dans les autres cas, la chaîne latérale du résidu muté ne contacte pas l inhibiteur mais provoque tout de même une résistance significative. La mutation dans ces cas-là est susceptible d affecter les contacts-clés de l inhibiteur: ceux de l ADN viral et des ions métalliques. Ces mutations vont de ce fait réduire considérablement l affinité de l interaction intasome-inhibiteur, mais préserveront une activité suffisante d intégration au cours de l'infection VIH-1. 66

67 Introduction Figure 19: Sites de mutations de résistance de RAL et de EVG reportés sur le modèle de l intasome de VIH-1. (A et B) des chaînes latérales ayant fait l'objet d'une mutation conférant une résistance à RAL et EVG, respectivement, sont présentés en bleu (mutations primaires) ou en rose (mutations secondaires). Pour surmonter le problème de résistance, Merck & Co. ont développé de nouveaux INSTI, y compris le MK0536 (Johns & Svolto, 2008) (Metifiot et al., 2011) et le DTG, avec une pharmacocinétique favorable et un meilleur profil de résistance (Hare et al., 2011). A.V Dolutegravir et INSTI de deuxième génération: Profil de résistance amélioré Dolutegravir (DTG, S/GSK ) (Figure 14) (Kobayashi et al., 2011) est un candidat de deuxième génération en phase avancée d'essais cliniques. Le DTG a l avantage d être pris une fois par jour comparé à RAL. Comme RAL, il possède un profil d interactions pharmacocinétiques favorable. Le cristal de l intasome du PFV en présence du DTG montre que ce composé se lie au site actif de l intasome de la même façon que les autres INSTI à l'exception de quelques 67

68 Introduction différences subtiles dues à la longueur et à la flexibilité du «linker» entre le cycle halogéné et le core chélateur de métaux. Comme le linker du DTG est plus long et qu'il y a moins d encombrement stérique, le groupement difluorobenzyl pénètre plus profondément au sein de la poche créée par le déplacement de l adénosine 3 permettant un meilleur ajustement et potentiellement un meilleur stacking avec la cytosine du CA invariant. DTG établit une interaction de VDW avec Y143 alors que RAL effectue une interaction π-π stacking avec cette même Y par son groupe oxadiazol (Figure 20A) (Hare et al., 2011). Les résultats des études in vitro et des essais cliniques de phase 3 (van Lunzen et al., 2012; Walmsley et al., 2012) ont montré que DTG a une barrière génétique élevée à l'acquisition d'une résistance. DTG inhibe IN de VIH-1 avec une IC50 de 33 nm. Les mutants de IN résistants à RAL, Y143R et N155H, sont inhibés par le DTG et le double mutant G140S/Q148H, ayant le niveau de résistance le plus élevé à RAL, montre une diminution de la sensibilité au DTG de 5,6 fois seulement. DTG conserve son efficacité sur le mutant Q148H qui provoque une diminution de la sensibilité à RAL (Metifiot et al., 2010), ainsi que sur les mutants T66I et E92Q qui causent une perte importante de la sensibilité à EVG (Goethals et al., 2010). Plusieurs autres INSTI de deuxième génération, notamment MK2048 (Figure 20B) et MK0536 (Figure 17), ont été développés. Ils présentent un profil de résistance amélioré par rapport à RAL et EVG. Ces INSTI occupent le même espace physique dans le site actif de l intasome que DTG (Figure 20B). Les INSTI de deuxième génération interagissent tous avec G118 de IN de VIH-1, ce qui explique l'évolution d'une mutation à cette position. La mutation G118R affecte significativement la sensibilité à MK2048 (Bar-Magen et al., 2010) et cause une réduction de 8 fois de la sensibilité au DTG (Johnson et al., 2011). Les mutations entraînant une résistance à RAL et à EVG affectent l efficacité des inhibiteurs en entraînant un changement subtile dans la géométrie du site actif. La liaison de la molécule d inhibiteur serait donc coûteuse en termes d énergie. DTG, MK0536 et MK2048 sont actifs sur les mutants de RAL parce qu'ils sont capables d'ajuster leur positionnement dans l'intasome suivant si IN est mutée ou non. MK0536 par exemple est capable de changer de position jusqu à 0.91 Å pour maintenir une coordination efficace des ions métalliques (Metifiot et al., 2011). DTG, lui, est déplacé de plus de 0.5Å pour certaines mutations par 68

69 Introduction rapport à IN sauvage (Hare et al., 2011). La longueur et la flexibilité du linker font en sorte à ce que le difluorobenzyl soit capable de bouger dans la poche de l ADN processé ajustant sa position en fonction des changements structuraux locaux apportés par les mutations. A B Figure 20: (A) DTG au niveau du site actif : IN (vert), ADN (orange) et DTG (magenta) (B) comparaison de la position de RAL (jaune), de MK2048 (bleu), et de DTG (magenta)(hare et al., 2011) dans l'intasome du PFV. De plus, l'interaction du DTG avec l'adn et le Mg 2+ est favorisée en comparaison avec RAL et la contribution de la protéine est réduite. Le changement d énergie associé à 69

70 Introduction l ADN provient de l interaction de la base adénine avec les cycles du DTG (Hare et al., 2011). Outre sa flexibilité et son interaction plus importante avec l'adn, l'efficacité de DTG sur les variants résistants à RAL, peut également provenir de la dissociation plus faible de DTG par rapport aux autres INSTI (Hightower et al., 2011). A.V.3. Les inhibiteurs peptidiques A.V.3.1. Les peptides dérivés de IN Le développement continu de peptides inhibiteurs de IN de VIH-1 a permis de mieux définir la structure et les propriétés de dimérisation de l'enzyme. Plusieurs peptides inhibiteurs de IN de VIH-1 dérivent des hélices polypeptidiques retrouvés au sein de la structure de IN. Ces hélices sont mises en évidence dans la figure 21, qui présente la structure cristallographique du core catalytique dimérique de IN. Figure 21: Structure cristallographique du domaine central de IN. Les hélices α ciblées par des inhibiteurs peptidiques sont colorées et étiquetés. Les hélices α1 (bleu) et α5 (mauve) constituent l'interface de dimérisation entre deux monomères de IN. L'hélice α4 (vert) est à proximité du site actif et comprend l'acide aminé catalytique E152. Les trois résidus catalytiques, D64, D116 et E512 sont indiquées en rouge. 70

71 Introduction Les hélices α1 et α5 forment l'interface de dimérisation entre les domaines catalytiques de différentes sous-unités de IN. Des peptides synthétiques INH1 et INH5 reproduisant l'hélice α1 (acides aminés ) et l'hélice α5-boucle (acides aminés 167 à 187), respectivement, inhibent IN de VIH-1 avec des concentrations faibles dans la gamme du nanomolaire (Maroun et al., 2001). Il a été démontré que ces peptides exercent leurs effets inhibiteurs en se liant au domaine central de IN et provoquent ainsi la dissociation des oligomères de IN (Figure 22B) (Johnson et al., 2004; Maroun et al., 2001). Figure 22: Peptides inhibiteurs dérivés de l'interface de dimérisation de IN. La triade catalytique est indiquée en magenta sur le CCD (adapté la PDB réf. 1bis) (Goldgur et al., 1998). (A) IN (rouge) (Sourgen et al., 1996), (B) IN et IN (violet) (Maroun et al., 2001), (C) IN 82-89, IN , IN et IN (orange) (Zhao et al., 2003) et (D) IN et IN 129 à 139 (vert) (Li et al., 2006) (Maes et al., 2012). 71

72 Introduction De façon similaire, il a été reporté que le peptide K159 reproduisant le segment de IN dérivé de l'hélice α4 inhibait IN du VIH-1 in vitro avec une IC50 de 600 µm (Sourgen et al., 1996). Il a été suggéré que l'activité inhibitrice du peptide résultait d'une interaction de type coiled-coil entre le peptide et l'hélice α4 de IN qui bloquerait le résidu catalytique E152 (Figure 22A) (Fermandjian et al., 2001). La même approche a été utilisée pour synthétiser les autres hélices du CCD de IN (Figure 20). Trois de ces peptides (α1, α5 et α6) ont montré une inhibition du 3 P de IN, avec des valeurs de IC50 dans la gamme du micromolaire faible et a diminué la formation de dimères (Figure 22C et D) (Zhao et al., 2003). A.V.3.2. Les peptides dérivés des cofacteurs viraux ou cellulaires de IN IN prend part à un certain nombre d interactions avec des protéines de l'hôte et de leurs modifications post-traductionnelles. Ces modifications peuvent constituer un élément de régulation du processus d intégration et par conséquent une cible pharmacologique potentielle (Sloan & Wainberg, 2011; Van Maele et al., 2006). Des études ont montré que la sumoylation (Zamborlini et al., 2011) et l'acétylation (Terreni et al., 2010) de IN se produisaient in vivo et amélioraient son activité mais il n'y a pas jusqu à présent des inhibiteurs qui peuvent cibler spécifiquement ces modifications de IN sans affecter d'autres protéines cellulaires (Buzon et al., 2011). En effet, une meilleure stratégie pour inhiber l'interaction entre IN et les protéines de l'hôte est de cibler la protéine virale avec des peptides dérivés de la région de liaison avec la protéine cellulaire. Actuellement, les inhibiteurs ciblant les interactions IN-protéine hôte les plus prometteurs sont ceux qui perturbent l interaction entre IN et LEDGF/p75, ce dernier étant une protéine de l'hôte essentielle pour l amarrage du CPI à la chromatine et pour le recrutement d'autres facteurs cellulaires au CPI, ce qui facilite l'intégration (Christ et al., 2010; McNeely et al., 2011). Grâce à ces données, une nouvelle classe d'arv, les LEDGINs, a été développée. Ces molécules miment l'interaction LEDGF IN et inhibent la liaison protéine-protéine et seraient donc capables de supprimer la réplication virale (Christ et al., 2010; De Luca et al., 2011; McNeely et al., 2011). 72

73 Introduction Enfin, l'inhibition de l'interaction entre deux protéines virales est encore une meilleure stratégie pour une intervention thérapeutique. Des peptides dérivés des séquences de la TI virale, de la Vpr et de Rev montrent des propriétés inhibitrices des activités enzymatiques de IN. Par criblage d'une bibliothèque complète de peptides dérivés de TI, Rev et Vpr, différents peptides ayant une activité inhibitrice ont été isolés (Marchand et al., 2009) (Tableau 1). Nom du peptide Séquence IC50 (μm) Références IBD LEDGF Non (Cherepanov et al., déterminé 2004) 4286 (RT palm) KILEPFRKQNPDIVIYQYMD 4.8 (3'P) (Oz Gleenberg et al., 4.5 (ST) 2005) 4321 (RNaseH) ELVNQIIEQLIKKEKVYLAW 6.9 (3'P) (Oz Gleenberg et al., 5 (ST) 2005) Rev13-23 LKTVRLIKFLY 25 (Rosenbluh et al., 2007) Rev53-67 RSISGWILSTYLGRP 25 (Rosenbluh et al., 2007) Vpr61-75 IRILQQLLFIHFRIG 1.3 (3'P) (Gleenberg et al., 1 (ST) 2007) Tableau 1: Peptides inhibiteurs de IN issus des régions d'interaction de IN avec des cofacteurs viraux ou cellulaires. A.V.4. Les anticorps anti-in Une bibliothèque d'anticorps monoclonaux dirigés contre IN de VIH-1 a été développée. La caractérisation des ces anticorps a fourni des informations sur leur mécanisme d'inhibition via leur interaction avec les domaines fonctionnels de IN, ainsi qu'un aperçu sur l'arrangement des sous-unités de l'enzyme. Plusieurs anticorps monoclonaux ont été caractérisés: mab17 et mab4 se lient aux NTD et CCD respectivement alors que mab32 et mab33 se lient au CTD. Trois de ces anticorps inhibent IN in vitro (Asante-Appiah & Skalka, 1997). MAb17 et Fab17 inhibent le 3'P avec des valeurs de IC50 de 0,4 et 4,5 µm respectivement (Yi et al., 2000). Ces anticorps se lient au NTD et inhibent l'enzyme en interférant avec les interactions protéine-protéine ou la conformation, sans toucher à la dimérisation ou à l'interaction avec l'adn. Le mab32 n'inhibe que faiblement l'activité de 3'P de IN (IC50 de 2 µm), le Fab correspondant Fab32 manque de pouvoir inhibiteur. 73

74 Introduction L'anticorps le plus puissant mab33, et le fragment Fab correspondant Fab33 se lient au domaine C-terminal de IN et inhibent la liaison à l'adn (Yi et al., 2002). Les valeurs des IC50 de 3'P sont de 0,18 et 1,8 µm pour mab33 et Fab33, respectivement. Un changement conformationnel de IN qui se produit lors de la liaison des cofacteurs métalliques est empêché par l'addition de mab33. Si le changement de conformation a déjà eu lieu, c'est la liaison de l'anticorps qui est bloquée (Asante-Appiah & Skalka, 1997). Par conséquent, mab33 peut agir en bloquant l'enzyme dans sa conformation catalytiquement inactive (avant de fixation du métal). Il a aussi été montré que l hélice α4 (résidus ) ainsi que la région en boucle α4-α5 (résidus ) étaient des épitopes et présentaient des propriétés antigéniques importantes. Ceux-ci ont fourni des anticorps monospécifique Ab-boucle (Maroun et al., 1999a) et monoclonal MAba4 (Azzi et al., 2010). Ces deux anticorps inhibent l activité de IN (Tableau 2). Récemment, il a été montré que des IgG isolées de patients infectés par le VIH peuvent agir comme abzymes et hydrolyser spécifiquement IN (Baranova et al., 2009). Le mécanisme mis en jeu est similaire à celui entrepris par les abzymes protéolytiques autoimmunes mais le rôle potentiel de ces immunoglobulines au cours de l'infection n'est pas connu. Ces anticorps hydrolysant peuvent cependant présenter une certaine utilité dans le diagnostic. Les thérapies à base d'anticorps sont envisageables via une approche utilisant la thérapie génique. L'expression intracellulaire de gènes codant pour des anticorps recombinants a démontré son efficacité dans l'inhibition de nombreuses protéines du VIH-1, y compris la TI, Rev, IN et CXCR4 (BouHamdan et al., 2000; BouHamdan et al., 2001; BouHamdan et al., 1998; Ho et al., 1998; Levy-Mintz et al., 1996). La transfection de monocytes humains du sang périphérique par des vecteurs rétroviraux exprimant la SFv (single-chain variable antibody fragment) de mab33 (IN#33) réduit considérablement la réplication du VIH-1 (Levy-Mintz et al., 1996). D'autres études ont montré que l'infection VIH-1 et l'infectivité des virions sont fortement réduites dans les cellules T constamment transfectées par une fusion Vpr-IN-SFv (BouHamdan et al., 2000). 95% des cellules CD

75 Introduction de macaques rhésus et des cellules humaines fœtales de moelle osseuse transduites par IN#33 ont exprimé l'anticorps. Nom du MAb Epitope Séquence 1C4 FLDGIDKAQDEHEKYH DFNLPPVVAKE D6 KCQLKGEAMHGQVD α4 SQGVVESMNKELKKIIGQVR anti-k159 VESMNKELKKIIG KELQKQITKIQNFRVYY RDSRNPLWK GPAKLLWKGEGAVVIQ DNSDIKVVP RRKAKIIRD C3 RRKAKIIRDY MAb 35 KAKIIRDYGK Tableau 2: Anticorps inhibiteurs de IN. A.VI. Le projet proprement dit: «Analyse des mécanismes d'inhibition de IN de VIH-1» Les principaux DKA et leurs dérivés, tel RAL récemment autorisé en thérapie antivirale, inhibent préférentiellement la réaction de ST (Koelsch & Cooper, 2009; Metifiot et al., 2010). Cependant, RAL induit des mutations localisées principalement au niveau de la boucle 140 (Y143H/R/C, Q148H/R/K et G140S-Q148H) et au niveau de l'hélice α4 (N155H) (Marinello et al., 2008; Metifiot et al., 2010), sources de résistances importantes. Les positions des mutations dans la protéine sont compatibles avec le rôle de l'hélice α4 (résidus 149 à 168) et de la boucle flexible (résidus 140 à 149) du CCD dans l'activité catalytique de IN. En effet, l analyse détaillée des données cristallographiques (Dyda et al., 1994; Goldgur et al., 1998), a permis de montrer que l hélice α4 largement exposée à la surface du dimère de CCD était une hélice amphiphile et se caractérisait par une face hydrophobe 75

76 Introduction apolaire orientée vers l intérieur de la protéine et une face polaire chargée orientée vers le milieu ambiant, la boucle catalytique étant flexible et plutôt désordonnée. La face hydrophile/ polaire de α4 est impliquée dans la reconnaissance spécifique de l'extrémité de l'adn viral et le clivage de celui-ci. Des expériences de photo-pontages ont révélé que l'interaction avec l'adn se faisait principalement par l'intermédiaire des résidus Q148, K156 et K159 de l hélice α4 (Esposito & Craigie, 1998; Heuer & Brown, 1997; Heuer & Brown, 1998; Jenkins et al., 1997). La mutation de ces résidus affaiblit très fortement ou élimine l activité enzymatique de la protéine (Gerton & Brown, 1997; van den Ent et al., 1998; van Gent et al., 1992). La structure cristallographique de l'intasome du PFV a apporté des preuves supplémentaires de l'implication des résidus de l'hélice α4, notamment les résidus V150, S153, K160, K159 dans des interactions de VDW et des liaisons hydrogène avec les phosphates et les bases de l'extrémité de l'adn viral. De plus, dans le co-cristal CCD-5CITEP, chef de file des inhibiteurs de la famille des DKA (Goldgur et al., 1999), l'hélice α4 est la cible du 5CITEP. Les contacts avec l'inhibiteur impliquent les résidus Q148, E152, N155, K156 et K159 et l'on constate que ces résidus sont les mêmes que ceux qui interagissent avec l'adn viral, suggérant que le 5CITEP serait un inhibiteur compétitif de la liaison de l'adn à IN. Par son extrémité N-terminale, l'hélice α4 est connnectée à une boucle flexible (résidus de l IN de VIH-1) qui se situerait, après repliement de la protéine, à proximité du site catalytique (Chen et al., 2000). Dans les structures cristallographiques du core catalytique, cette boucle est désordonnée : le segment qui inclut le troisième résidu de la triade catalytique E152 n a pas été résolu dans la carte de densité électronique de la structure cristallographique publiée en 1994 (Dyda et al., 1994). Dans les structures cristallographiques reportées ultérieurement, la structure exacte de la boucle catalytique est partiellement résolue mais diffère selon le mutant considéré (Bujacz et al., 1996; Goldgur et al., 1998; Maignan et al., 1998). Les structures cristallographiques de l'intasome du PFV ont montré que les résidus G140, I141, N144, Q146, S147 de la boucle 140, comme ceux de l'hélice α4, établissent des liaisons avec les phosphates et les bases de l'extrémité de l'adn viral. En plus, P145 et Q146 76

77 Introduction interagissent avec les bases terminales du LTR viral et sont directement impliquées dans la séparation des deux brins d'adn (Hare et al., 2010). Par ailleurs, la boucle 140 est située à proximité des résidus acides conservés de la triade catalytique. Sa flexibilité permet l orientation du résidu E152 qui pointe en direction des deux autres résidus de la triade catalytique, D64 et D116. La substitution des résidus G140 et G149 par des résidus Ala rigidifie la boucle. L activité catalytique du double mutant du CCD G140A et G149A est de ce fait fortement réduite en comparaison avec celle du CCD sauvage. Par contre, la capacité de fixation à l ADN n est pas altérée de manière significative chez ces mutants. Ces résultats montrent que la flexibilité conformationnelle de la boucle est indispensable pour la catalyse, après l étape de liaison à l ADN viral (Greenwald et al., 1999; Lee et al., 2005). De plus, il a été montré que la flexibilité de la boucle était importante pour permettre la fixation de Q148 à la cytosine terminale du LTR processé, cette base se découvrant suite à l'excision du dinucléotide GT (Johnson et al., 2006) mais aussi qu'elle pourrait stabiliser le complexe d'intégration en intervenant comme une barrière séparant les deux extrémités de l'adn viral chargées négativement, ce qui concorde avec l'espacement de 5pb introduit par la coupure de l'adn hôte dans le site d'intégration (Wielens et al., 2005). Des analogues structuraux dérivant de l'hélice α4 ainsi que des anticorps monoclonaux dirigés contre ces peptides, tous préparés dans notre laboratoire, sont des inhibiteurs compétitifs de IN (Krebs et al., 1998; Maroun et al., 1999a; Sourgen et al., 1996) et peuvent être utilisés comme outils d investigation des interactions ADN-protéines (Zargarian et al., 2003). Enfin, il a été démontré plus récemment que la protéine LEDGF/p75 se fixait sélectivement à l extrémité C-terminale de l hélice α4 (Cherepanov et al., 2005). Au total, on peut considérer que l hélice α4 et la boucle flexible jouent un rôle essentiel vis-à-vis de l activité de IN : interaction avec l ADN, interaction avec d autres protéines virales et cellulaires, oligomérisation possible via la face hydrophobe, antigénicité, tout en constituant un site privilégié pour les inhibiteurs de l enzyme. 77

78 Introduction A.VI.1. Premier centre d'intérêt Récemment, les structures cristallographiques de l'intasome (IN+ADN viral+mg 2+ /Mn 2+ ) du PFV en présence et en absence de INSTI ont été obtenues à haute résolution. Ces co-cristaux ont confirmé la liaison de IN et des INSTI à l'extrémité 3' de l'adn viral processé et avec plusieurs contacts entre ces INSTI et la boucle 140 et l'hélice α4 (Hare et al., 2010; Hare et al., 2010; Krishnan et al., 2010). C'est la dislocation du dinucléotide CpA hautement conservé et le déplacement spatial du groupement hydroxyl issu de la réaction de maturation qui est la cause du blocage du ST. Le mécanisme d'inhibition des INSTI semble donc résulter de la perturbation de l'interaction des extrémités LTR avec les sites actifs de IN. Cependant, même si l'on retrouve les INSTI à l'interface ADN-IN, on ne sait pas auquel des deux partenaires les INSTI sont fixés le plus fortement. Il a été reporté à plusieurs reprises que RAL ne se liait pas à IN prise séparément (Espeseth et al., 2000; Fitzkee et al., 2010), alors qu'aucune étude n'a été reportée sur la possible fixation des INSTI à l'adn processé ou non, pris isolément. Des études antérieures ont montré, que la liaison des inhibiteurs de IN de type DKA était fortement améliorée lorsque IN était préalablement complexée à l'adn viral, suggérant que l'adn induisait une conformation de IN plus favorable à la fixation des inhibiteurs. Cependant, aucune question n'a été posée sur le rôle véritable de l'adn viral en tant que cible primaire des INSTI. La première partie de mon travail de thèse est consacrée à l'analyse par différentes techniques des interactions de TB11 et RAL, deux inhibiteurs de IN ayant leurs sites d interaction à l'interface ADN-protéine, mais possédant des propriétés totalement différentes. A.VI.2. Deuxième centre d'intérêt Il a été reporté à plusieurs reprises que le sang de certains malades africains contenait des anticorps anti-in. Cependant, le rôle exact de ces anticorps n'est pas connu. Sont-ils faiblement neutralisants? Ces données sont-elles utilisables dans la recherche sur les vaccins? 78

79 Introduction Nous avons obtenus plusieurs anticorps à la suite d'injections de peptides contenant plusieurs domaines de IN y compris l'hélice α4. L étude de leurs interactions fait aussi partie de mon projet de thèse. Ce travail de thèse s inscrit dans la continuité de travaux précédents sur: d une part, les interactions de IN de VIH-1 avec l ADN viral et certains agents antirétroviraux et d autre part les interactions d anticorps monoclonaux avec IN et les domaines de IN. Les études ont été menées conjointement dans le Laboratoire de Biologie et de Pharmacologie Génétique Appliquée à l Ecole Normale Supérieure de Cachan et dans l'unité de Biochimie- Département SVT à la Faculté des sciences de l'université Saint-Joseph de Beyrouth. Les expériences de plasmon de résonance ont été réalisées en collaboration avec l'équipe de M. Buckle à l'ens de Cachan. Les expériences de cristallisation ont été réalisées en collaboration avec Dr. Ahmed Haouz à l'institut Pasteur-Paris. Les purifications de IN et du CCD ont été réalisées à l Institut Universitaire d Hématologie, CNRS/P7 UMR 7212, Inserm U

80 B. Matériels et Méthodes

81 Matériels et Méthodes B.I. Matériels B.I.1. Oligonucléotides Les quatre oligonucléotides LTR34, LTR32, LTR32-GT, LTR30 et LTR17 présentés ci-dessous (Figure 23) ont été fournis par Eurogentec (Belgique). Le choix de la taille et de la séquence des oligonucléotides a été réalisé en tenant compte des propriétés connues de reconnaissance de l extrémité LTR de l ADN viral par IN. Ils ont été conçus pour adopter une structure en «épingle à cheveux» repliée autour d une boucle à trois résidus thymine en position centrale. Le choix d une épingle à cheveux (monomoléculaire) plutôt qu un duplex linéaire (bimoléculaire) s explique par la meilleure stabilité de l épingle à cheveux par rapport au duplex aux faibles concentrations utilisées en dichroïsme circulaire (DC) et surtout en fluorescence (10-9 à 10-5 M). LTR34 une fois replié en épingle à cheveux présente une tige de 17pb reproduisant la version non-processée de l extrémité U5-LTR. LTR32 (tige de 15pb et dinucléotide pendant sans vis-à-vis en 5 ) est la version processée résultant de la délétion du dinucléotide G 2 T 1 3 (en vert). LTR32-GT (LTR32-inversé) est obtenu par délétion du dinucléotide C -2 A -1 5' (en vert). LTR30 à extrémités franches (sans dinucléotide pendant) est obtenu par délétion des deux paires de base terminales 5 G 2 T 1 3 :5 A -1 C -2 3 (en vert). LTR 17 (tige de 7 pb) comprend la région la plus importante pour la fixation de IN. Dans les cinq oligonucléotides, les paires de bases hautement conservées sont colorées en bleu (Figure 23). Pour les expériences d'anisotropie de fluorescence, la fluorescéine a été greffée sur la thymine située au centre de la boucle (en rouge) (Figure 23), c'est-à-dire à l opposé de l extrémité 5, ce qui permet d éviter l interférence de ce groupement à fort encombrement stérique avec la reconnaissance de l ADN par l IN. Des oligonucléotides non fluorescéinés ont également été préparés pour les mesures de DC et de spectroscopie UV (Azzi et al., 2010; Hobaika et al., 2009; Zargarian et al., 2003). Dans tous les oligonucléotides la numérotation des quatre dernières paires de bases (+1 à +4 et -1 à -4) commence à partir du nucléotide terminal en 3 du brin supérieur (+) et à partir du nucléotide terminal en 5 du brin inférieur (-). 81

82 Matériels et Méthodes LTR 34: 5 ACTGCTAGAGATTTTCCTTTGGAAAATCTCTAGCAGT 3 ; LTR 32: 5 ACTGCTAGAGATTTTCCTTTGGAAAATCTCTAGCA 3 ; LTR 32-GT: 5 TGCTAGAGATTTTCCTTTGGAAAATCTCTAGCAGT 3 ; LTR 30: 5 TGCTAGAGATTTTCCTTTGGAAAATCTCTAGCA 3'. LTR17: 5' ACTGCTATTTTAGCAGT 3' CRE: 5' TGTGTCACGTGACACG 3' 3' ACACAGTGCACTGTGC 5' Figure 23: Séquences des oligonucléotides utilisés. L'ADN double brin CRE (camp responsive element) est utilisé comme témoin négatif dans les tests de compétition ELISA. Les oligonucléotides indiqués ci-dessous (Figure 24) issus des LTR du PFV (Hare et al., 2010) ont servi pour les calculs de dynamique moléculaire: LTR34-PFV : 5 T A C A A A A T T C C A T G A C A A T 3 3 A T G T T T T A A G G T A C T G T T A LTR32-PFV : 5 T A C A A A A T T C C A T G A C A 3 3 A T G T T T T A A G G T A C T G T T A Figure 24: Séquences des oligonucléotides utilisés dans les calculs de dynamique moléculaire. B.I.2. Peptides Les peptides principalement destinés aux études spectroscopiques sont : K156 et K156-loop140 (Figure 25) K156-loop140: KQEFGIPYNPQSQAKLEEMNKELKKLLAQVRAQ K156: SQAKLEEMNKELKKLLAQVRAQW Figure 25: Séquences des peptides K156 et K156-loop

83 Matériels et Méthodes Ils ont été synthétisés par Dr. Christophe Piesse à l Université Pierre et Marie Curie à un degré de pureté > 98%. K156 est la version stabilisée de l hélice α4 (résidus du CCD). La stabilisation a été obtenue par le biais de plusieurs mutations hélicogènes d acides aminés sans effets sur l activité (Hobaika et al., 2009; Zargarian et al., 2003). Le peptide K156-loop140 est constitué du peptide K156 et de la boucle flexible 140 native en position N-terminale. Il s étend sur 33 acides aminés (résidus du CCD). La concentration du peptide K156-loop140 est déterminée par mesure de l intensité du signal UV de la tyrosine en position 143, et celle de K156 à partir du signal du tryptophane ajouté à dessein à son extrémité C-terminale, en utilisant un coefficient d'extinction molaire de 1280 M -1.cm -1 et de 5690 M -1.cm -1 à 280 nm, respectivement. Genecast. Les peptides utilisés pour les études des anticorps (Figure 26) ont été synthétisés par K159: S147 Q G V V E S M N K E L K K I I G Q V R D Q A E H L K T A 175 K159-1: S147 Q G V V E S M N K Y K159-2: S147 Q G V V E S M N K E L K 159 Y IN638: S147 Q G V V E S M N K156 E L K K I I G163 Y IN638-1: S147 E G V V E S M N K156 E L K K I I G163 Y IN638-3: S147 Q G V V E S M N K156 E L E159 K I I G163 Y IN638-4: S147 Q G V V E S M K K156 E L K K I I G163 Y α 4: S147 Q G V V E S M N K E L K K I I G Q V RDQ - Y K156: S147 Q A K L E E M N K E L K K L L A Q V R A Q167- W K159-3: K160 I I G Q V R D Q A E H L K T A175 Y IN636: G Q V R D Q A E H L K T A175 Y IN636-1: G Q A R D Q A E H L K T A175 Y IN636-2: G Q V A D Q A E H L K T A175 Y K159-4: N155 K E L K K I I G Q V R D Q A E H L K T A175 Y K159-5: K159-6: N155 K E L K K I I G Q V R D Q A E H171 Y K159 K I I G Q V R D Q A E H171 Y Figure 26: Séquences des peptides utilisés pour les études des anticorps. Les résidus en rouge représentent les mutations pontuelles introduites dans IN636 et IN638 et les résidus en vert les mutations hélicogènes (α4 K156). 83

84 Matériels et Méthodes Deux peptides supplémentaires ont été synthétisés par ChinaPeptides pour les expériences d'anisotropie de fluorescence peptides-anticorps. Ce sont : F-K159: F*-S147 Q G V V E S M N K E L K K I I G Q V R D Q A E H L K T A 175 Et K159-F: S147 Q G V V E S M N K E L K K I I G Q V R D Q A E H L K T A 175-F* avec le reporteur fluorescéine en N-terminal et C-terminal pour les études d interactions avec les anticorps reconnaissant l une ou l autre extrémité. Tous ces peptides ont été synthétisés en phase solide selon le procédé Fmoc (N-(9- fluorenyl) mothoxycarbonyl et purifiés par HPLC. La masse moléculaire et la pureté de chaque peptide ont été confirmées par spectroscopie de masse. B.I.3. Inhibiteurs Les antiviraux TB11 (Pais et al., 2002; Zhang et al., 2003) et RAL (Figure 27) appartenant ou dérivant de la famille des DKA ont été fournis par Terrence Burke (Laboratory of Medicinal Chemistry, Center for Cancer Reaserch, NCI, Frederic Maryland) et par CacheSyn, respectivement. Les structures chimiques de ces inhibiteurs sont représentées dans la figure 27. Figure 27: Structures chimiques de TB11 et de RAL. 84

85 Matériels et Méthodes B.I.4. Anticorps et Fab Nous avons choisi le peptide K159 (csqgvvesmnkelkkiigqvrdqaehlkta) comme immunisant. Il a été couplé à une molécule support constituée par l'hémocyanine (KLH) de l'anglais "Keyhole limpet hemocyanin" avant d être injecté à un lot de 5 souris BALB/c. Toutes les souris ont fourni une réponse immunitaire convenable et la souris présentant la meilleure réponse a été utilisée pour la fusion cellulaire et la production d'hybridomes. Un total de dix lignées d hybridomes a pu être obtenu. Une culture cellulaire de 6 litres a été réalisée à partir de chacune des deux lignées cellulaires sélectionnées : 4C6 et 4F4, montrant la meilleure affinité pour les fragments N-terminal et C-terminal, respectivement. Les anticorps monoclonaux présents dans les surnageants des cultures cellulaires ont ensuite été purifiés par chromatographie d'affinité sur Protéine A. Les fragments Fab correspondants ont été de même purifiés suite à un clivage enzymatique à la papaïne. B.I.5. IN et CCD La souche compétente Escherichia coli BL21 (DE3) a été transformée par transfert soit du plasmide contenant l ADNc codant pour IN de VIH-1 portant la substitution F185K soit du plasmide contenant l ADNc codant pour le CCD de IN de VIH-1 (résidus 50 à 212) portant la même substitution. Les deux plasmides codent pour une étiquette d histidines en extrémité N-terminale de la protéine produite et renferment un gène de résistance à l'ampicilline (Dr. R. Craigie, NIH, Bethesda, U.S.A). La quantité d ADN utilisée est de 100 ng pour 50 μl de cellules. Une fois le plasmide ajouté, il suffit d incuber les cellules trente minutes sur glace avant d effectuer un choc thermique de 20 à 30 secondes à une température de 42ºC. Suite à quoi, les cellules sont reposées immédiatement sur glace pour une durée de deux minutes. Les bactéries sont ensuite resuspendues rapidement dans du milieu SOC (2% tryptone, 0,5% d extraits de levure, 10mM NaCl, 2,5mM KCl, 10mM MgCl 2, 10mM MgSO 4, 20mM glucose), incubées 1h à 37 C et étalées sur boîte LB-agar (10 g/l tryptone, 5 g/l extrait de levure, 10 g/l NaCl, 15 g/l agar) contenant un antibiotique (100μg/μl ampicilline) (37 C O/N). Une culture de nuit à 37 C de 6mL en milieu LB+Ampicilline (10 g/l tryptone, 85

86 Matériels et Méthodes 5 g/l extrait de levure, 10 g/l NaCl+100 μg/μl ampicilline) inoculée la veille par une colonie bactérienne (miniculture) est ajoutée à 250 ml de milieu LB+Ampicilline (maxiculture). La maxiculture est incubée à 37 C sous agitation. Lorsque la densité optique à 600 nm atteint une valeur comprise entre 0.6 et 0.8, l expression de la protéine de fusion est induite par ajout de 1 mm d IPTG. La culture bactérienne est incubée pendant 3h à 37 C sous agitation puis centrifugée à 6000 rpm pendant 10 min. Les culots bactériens débarrassés de leur surnageant sont resuspendus dans 8 ml de tampon A (50 mm Tris-HCl, ph 8, 1 M NaCl, 4 mm, β mercaptoéthanol). La lyse est effectuée mécaniquement à l aide du Oneshot (French Press). Afin de minimiser la dégradation protéique par les protéases, le PIC (Protease inhibitor cocktail) est ajouté au tampon A. Les lysats cellulaires sont centrifugés à 13000g pendant 25 min. La purification de IN portant une étiquette His à partir du surnageant est réalisée sur des billes de nickel Ni-NTA. La protéine est éluée par 1M imidazole ph 4/5 avant d être dialysée sur la nuit contre le tampon de stockage (20 mm Tris-HCl, ph 8, 1 M NaCl, 4 mm, β mercaptoéthanol). Les échantillons sont alors aliquotés et stockés à -80 C (Leh et al., 2000; Zamborlini et al., 2011). Le CCD a été purifié suivant le même mode opératoire. Pour se débarrasser du tag His du CCD, la protéine de fusion est soumise à un clivage à la thrombine (100µl de billes thrombine humide/1mg de protéine) pendant 4 à 6h à température ambiante. Le tag-his et le His-CCD non clivé sont éliminés du surnageant par incubation avec 200µl de billes NiNTA humides pendant 2h. La protéine est éluée comme précédemment, dialysée contre le même tampon de stockage, aliquotée et stockée à -80 C. B.II. Méthodes B.II.1. Spectroscopie d absorption La spectroscopie d absorption dans l UV et le visible est basée sur la propriété des molécules à absorber des radiations lumineuses de longueur d onde déterminée. Une transition UV-visible (souvent 180 à 750 nm) correspond à un saut d un électron d une orbitale moléculaire fondamentale occupée à une orbitale moléculaire excitée vacante. La matière absorbe alors un photon dont l'énergie correspond à la différence d'énergie entre le 86

87 Matériels et Méthodes niveau fondamental et le niveau excité. Le spectre résultant représente l absorbance en fonction de la longueur d onde. La bande d'absorption est caractérisée par sa position en longueur d'onde (λmax) et par son intensité reliée au coefficient d extinction molaire (εmax) par la loi de Beer-Lambert (A = εlc où l est le trajet optique et C la concentration). La position du maximum d absorption correspond à la longueur d onde de la radiation qui provoque la transition électronique. Les spectres ont été enregistrés sur un spectrophotomètre UVIKON-modèle 941 (Kontron instruments). Les oligonucléotides ont été dissous dans du tampon phosphate Na/Na2 (PO4) 10mM, ph6. Les titrages ont été effectués en utilisant des solutions-mères d ADN comme titrant dans des cuves en quartz de 2 et 10 mm de trajet optique. La concentration de RAL dans la cuve est maintenue à 20 µm et celle de l'adn varie entre 1 et 20 µm. Les spectres de différence (RAL complexé) entre 200 nm et 380 nm sont obtenus par soustraction des spectres d'adn des spectres des complexes ADN-RAL et tenant compte de la contribution du tampon. Les spectres sont exprimés en densité optique donnée en unité arbitraire en fonction de la longueur d onde λ (nm). B.II.2. Dichroïsme circulaire (DC) B.II.2.1. Principe du DC Le vecteur champ électrique (E) d une lumière polarisée linéairement peut être décomposé en deux vecteurs ED et EG représentant deux ondes polarisées circulairement droite et gauche suite au passage à travers un cristal piézoélectrique comme le quartz, soumis à un courant électrique alternatif. Le DC résulte de l absorption différentielle des composantes gauche et droite de la lumière polarisée circulairement après passage par l échantillon : la production de deux vibrations d amplitudes inégales donne naissance à une vibration elliptique (Figure 28). Le DC est alors exprimé par : A = Ag Ad = (εg εd).c.l = ε.c.l, où C est la concentration molaire en soluté chiral (M), l, le trajet optique (cm) et ε, le coefficient d extinction molaire (M -1.cm -1 ) (Greenfield, 2006; Woody, 1995). 87

88 Matériels et Méthodes La production de DC requiert un chromophore doté de chiralité (chromophore optiquement actif) soit : (a) intrinsèquement de par sa structure ; soit (b) du fait de sa liaison à un centre chiral : ou bien encore (c) parce qu il est placé dans un environnement asymétrique. Figure 28: Principe du DC. OP: onde polarisée; OPC: onde polarisée circulairement. B.II.2.2. Principaux domaines d utilisation du DC Les organismes vivants sont constitués de biopolymères (protéines, peptides, acides nucléiques, etc) optiquement actifs, qui par leurs interactions mutuelles assurent et contrôlent les différentes fonctions biologiques. Les biopolymères peuvent être aussi le siège d interactions avec des molécules exogènes, tels les vaccins ou les médicaments. Le DC est capable de fournir des informations de nature globale et parfois même locale sur la structure secondaire et les variations conformationnelles de ces biopolymères. L essentiel du pouvoir dichroïque des biopolymères résulte de leurs conformations régulières. Le spectre global correspond à la somme des contributions de chaque chromophore monomérique (liaisons peptidiques ou bases puriques et pyrimidiques), au sein des structures organisées (Martin & Schilstra, 2008). Le DC permet l analyse des structures secondaires (et parfois tertiaires) des protéines. La mesure du DC dans l UV lointain ( nm) permet de déterminer le contenu en structure secondaire. Le chromophore actif dans ce cas est la liaison peptidique (groupement amide) encadré par deux carbones asymétriques (les carbones α des deux acides aminés 88

89 Matériels et Méthodes voisins). L orientation des groupements peptidiques est imposée par les angles phi et psi dont les valeurs sont caractéristiques des différents types de structures secondaires (Figure 29). L allure des spectres de DC varie donc suivant le type de repliement en hélice α, feuillet β, coude et apériodique (random) (Holm et al., 2010; Lewis & Johnson, 1974; Matsuo et al., 2004). L hélice α est caractérisée par un pic positif à 190 nm et deux pics négatifs à 208 et 222 nm (Figure 30). Le spectre de la structure désordonnée «random» est caractérisé par une bande négative intense à nm et une autre de plus faible intensité négative ou positive à nm (Figure 30). Des méthodes de «déconvolution» des spectres de DC permettent de quantifier la fraction approximative de chaque type de structure secondaire. Une bonne estimation du pourcentage d hélice dans un peptide ou une protéine peut être obtenue à partir de l intensité de la bande à 222 nm (Zhong & Johnson, 1992). Figure 29: Angles de rotation (ou dièdres) dans l unité peptidique : autour de la liaison N-Cα (PHI, φ) et de la liaison Cα-C entre (PSI, ψ). Les signaux dichroïques dans l UV proche ( nm, zone d absorption des chaînes latérales des acides aminés aromatiques et des ponts disulfures) fournissent des informations sur les repliements tertiaires. Les signaux dans la région aromatique sont habituellement faibles et les concentrations utilisées sont en général plus élevées (Greenfield, 2006). Le DC permet aussi d analyser l impact des mutations ponctuelles sur la structure d une protéine et d étudier les changements de conformation en fonction de nombreux facteurs (ph, T, détergents, tampons, métaux, co-solvants, concentrations, ligands). Par 89

90 Matériels et Méthodes exemple, la stabilité thermique du repliement d une protéine peut facilement être déterminée en suivant le comportement de son spectre DC en fonction de la température. Similairement, le DC se prête bien à l étude des diverses formes d ADN et des transitions conformationnelles des ADN et ARN induites par des ligands protéiques ou des drogues (Dodero et al., 2011; Greenfield, 2006; Martin & Schilstra, 2008). Dans l ensemble, le DC est un outil très sensible, facile à utiliser et non destructif; l échantillon pouvant être récupéré après enregistrement du spectre. Figure 30: Spectres de DC de structures secondaires «pures» (Brahms & Brahms, 1980). B.II.2.3. Conditions d acquisition et de traitement de données. Nos spectres de DC ont été enregistrés à 5 C ou à température ambiante entre 180 et 260 nm (peptides, complexes peptides-inhibiteurs, peptides-adn et complexes peptidesanticorps) et entre 190 et 330 nm (ADN et complexes ADN-inhibiteurs) sur un dichrographe Jobin-Yvon. Les mesures ont été effectuées sur des échantillons dissous dans un tampon phosphate Na/Na 2 PO 4 10 mm, ph 6 et placés dans des cuves en quartz thermostatées de 1-5mm de trajet optique. Après dilution la concentration précise des oligonucléotides a été 90

91 Matériels et Méthodes contrôlée par mesure de l absorbance de la solution à 260 nm en utilisant un coefficient d extinction molaire de M -1.cm -1 pour LTR34 et M -1.cm -1 pour LTR32, celle des solutions peptidiques a été déterminée en mesurant l absorption de la tyrosine ou du tryptophane. Avant l'enregistrement des spectres, les échantillons ont été incubés pendant 10 min à la température choisie pour permettre aux solutions d atteindre leur état d'équilibre. Pour chaque série de mesures, la ligne de base a été soustraite et le spectre moyen représentant l incrément dichroïque par nucléotide ou par acide aminé Δε (M -1.cm -1 ) en fonction de la longueur d onde λ (nm) a été lissé. Le pourcentage de structuration en hélice α (Pα) de la protéine a été évalué à partir de l incrément dichroïque à 222nm rapporté au nombre de résidus du polypeptide Δε 222 /N selon la formule : Pα=-[Δε 222 x10] (Pα: pourcentage en hélice α; Δε 222 : DC par résidu à 222 nm) (Zhong & Johnson, 1992). Pour l analyse des complexes ADN-RAL, les spectres dichroïques des ADN LTR34 et LTR32 à 10 μm entre 200 et 330 nm ont été enregistrés d abord seuls et ensuite en présence de concentrations croissantes de RAL (10 µm à 80 µm). Les spectres de l ADN et des complexes RAL-ADN sont représentés en incrément dichroïque Δε (M -1.cm -1 ) en fonction de la longueur d onde λ (nm) entre 200 et 330 nm. Comme RAL est une molécule achirale, il ne contribue pas directement au spectre. Mais RAL comporte plusieurs chromophores qui une fois bloqués dans un environnement asymétrique, ici au voisinage d'un cycle désoxyribose, peuvent acquérir une chiralité et générer un signal dans la région de leur signal d absorption. Pour l analyse des complexes ADN-peptide, le spectre dichroïque du peptide K156-loop140 à 5 μm entre 190 et 260 nm a été enregistré d abord seul puis en présence de chaque oligonucléotide, LTR34 et LTR32, dans un tampon phosphate ph6 à 5 C. Les spectres des peptides en interaction (spectres de différence peptide-adn) ont été comparés aux spectres des peptides seuls aux mêmes concentrations et dans les mêmes conditions de ph et de température. Pour l'analyse des complexes inhibiteurs-peptide, le spectre dichroïque de chacun des peptides K156 et K156-loop140 à 20 μm entre 190 et 260 nm a été enregistré d abord seul puis en présence de chaque inhibiteur, RAL et TB11, dans un tampon phosphate ph6 à 5 C. Les spectres des peptides en interaction (spectres de différence peptide-inhibiteur) ont été comparés aux spectres des peptides seuls aux mêmes concentrations. 91

92 Matériels et Méthodes Pour l analyse des complexes peptides-anticorps, le spectre dichroïque des peptides à 5 μm entre 190 et 260 nm a été enregistré d abord seul puis en présence des anticorps (ratios peptide: anticorps 2:1 et 1:1), dans un tampon phosphate à température ambiante. Les spectres des peptides en interaction (spectres de différence peptide-anticorps) ont été comparés aux spectres des peptides seuls obtenus dans les mêmes conditions expérimentales. B.II.3. Spectroscopie de fluorescence La spectroscopie de fluorescence est une technique versatile qui permet d analyser, à l équilibre ou en temps réel, les variations de l environnement de sondes fluorescentes intrinsèques (notamment le tryptophane pour les protéines) ou extrinsèques (fluorophores synthétiques). Nous avons utilisé la fluorescence pour déterminer les affinités des interactions des différents partenaires du système, à savoir LTR-peptides, LTR-inhibiteurs, peptidesinhibiteurs et anticorps-peptides. B.II.3.1. Principe de la technique La fluorescence est un phénomène de luminescence dont le mécanisme d excitation provient d une source lumineuse. Lorsqu un fluorophore est porté dans un état excité par l absorption d un photon, il revient spontanément à l état fondamental selon des voies très diverses. L ensemble de ces processus est présenté dans le diagramme de Perrin-Jablonski (Figure 31). L absorption d un photon d énergie appropriée fait passer le fluorophore de l état fondamental (S 0 ) à un état électronique excité (S 1 ou S 2 ). La molécule portée à l état énergétique (S 2 ) peut retourner à l état énergétique inférieur (S 1 ) par conversion interne qui est une transition non radiative. Une perte d énergie peut aussi avoir lieu par relaxation vibrationnelle dans le même état électronique. L émission de photons accompagnant la relaxation (S 1 )-(S 0 ) est appelée fluorescence. Une autre voie de désexcitation est possible à partir de l état S 1 en passant par un état intermédiaire T1, c est le passage inter-système qui est suivi du phénomène de phosphorescence. La fluorescence et la phosphorescence diffèrent par l énergie des photons émis et par la durée de vie de leurs états excités. 92

93 Matériels et Méthodes L absorption de la lumière est un processus instantané qui se produit en seconde. La durée de vie de l état excité est d environ (10-10 à 10-7 seconde), qui est un temps court, mais supérieur au temps requis pour l absorption. L émission de fluorescence est beaucoup plus sensible aux changements dans l environnement du chromophore que l absorption et comme la durée de vie de l état excité est longue, un grand nombre d interactions ou de perturbations peuvent influencer cet état et par conséquent le spectre d émission. La fluorescence est de ce fait un outil excellent et extrêmement sensible pour l investigation de la structure et de la fonction des macromolécules. A l état excité il y a toujours de l énergie perdue par des processus tels que les transitions entre les états vibrationnels. Par conséquent, l énergie de la lumière émise est toujours plus faible que celle de la lumière absorbée et la fluorescence d un chromophore se produit à des longueurs d onde supérieures que celles de l absorption (Matthews & Favard, 2007). Figure 31: Diagramme simplifié de Perrin- Jablonski. Les états électroniques singulets sont notés S0, S1, S2 et l état triplet T1. Les flèches verticales pleines correspondent aux phénomènes d absorption ou d émission de photons. Chaque émission ou abso rption d une quantité E d énergie lumineuse par un fluorophore est liée à la fréquence de cette lumière par la relation E = hυ (h est la constante de Planck, υ la fréquence de la lumière). Les énergies hυex et hυex sont respectivement celles du photon absorbé et celle du photon émis par fluorescence. 93

94 Matériels et Méthodes B.II.3.2. Les fluorophores Les sondes de fluorescence peuvent être classées en deux catégories : les sondes intrinsèques et les sondes extrinsèques. On entend par intrinsèque toute molécule d'origine naturelle qui présente une fluorescence suffisante pour avoir une utilité pratique. C'est le cas notamment des acides aminés aromatiques, surtout le tryptophane (Excitation à 295 nm et émission à 348 nm) et la tyrosine (Excitation à 280 nm et émission à 303 nm). Et par extrinsèque on désigne les sondes qui peuvent être introduites dans le système pour former un complexe covalent ou non-covalent, comme par exemple la fluorescéine (Excitation à 488nm et émission à 515nm) (Mullins, 1994). B.II.3.3. Atténuation de fluorescence B.II Principe La fluorescence du fluorophore est fortement influencée par un certain nombre de processus qui diminuent son intensité. Ces processus peuvent se produire pendant la durée de vie de l'état excité - par exemple le quenching collisionnel et le transfert d'énergie - ou peuvent survenir en raison de la formation de complexes dans l'état fondamental. Les maximums d émission des fluorophores sont aussi fortement sensibles à la polarité du solvant et aux interactions spécifiques au voisinage du fluorophore. L'atténuation de la fluorescence permet de ce fait d'étudier les changements structuraux induits par des modifications du ph, de la température, du tampon et des ligands. Ces études permettent de tirer des informations quantitatives sur les stœchiométries (nombre des sites de liaisons) et les énergies des interactions (affinité et coopérativité). L atténuation de fluorescence sert aussi à décrire les changements conformationels d une protéine (repliement ou dénaturation, oligomérisation, agrégation). B.II Conditions expérimentales Nos expériences d atténuation de fluorescence ont été réalisées sur un fluorimètre Jobin-Yvon Fluoromax II dans une cuve de quartz d un trajet optique de 1 cm dans un tampon phosphate 10mM, ph 6, à 5 C en suivant les spectres d'émission de RAL et de TB11, le fluorophore étant le groupement dicétone (énol-cétone). L'excitation à 313 nm de 94

95 Matériels et Méthodes TB11 et de RAL fournit une émission entre 325 et 500 nm (Figure 32) pour des largeurs des fentes d'excitation et d'émission de 2 et de 5 nm respectivement. Le maximum d'émission est mesuré à 410 nm pour TB11 à 413 nm pour RAL. Les drogues ont été diluées à la concentration voulue dans 800 µl de tampon phosphate 10mM, ph 6. Les échantillons ont été par la suite titrés par addition de concentrations croissantes de LTR ou de peptides. Après chaque addition, la solution a été laissée pendant dix minutes pour atteindre son état d équilibre. Pour chaque point de titrage, au moins 10 spectres d'émission ont été enregistrés et moyennés et la contribution du tampon et du ligand a été soustraite. A B Figure 32: Spectres d'absorption et d'émission de (A) TB11 et (B) RAL. B.II.3.4. L Anisotropie de Fluorescence B.II Principe L anisotropie de fluorescence fournit des informations sur la taille, la forme, la fexibilité et les interactions des macromolécules. Elle permet aussi de déterminer les paramètres de liaison : constante de dissociation, coopérativité et stœchiométrie de liaison (Heyduk & Lee, 1990; Hill & Royer, 1997). 95

96 Matériels et Méthodes Lorsque la source lumineuse d'excitation est polarisée, l'absorption optimale de la lumière sera pour les molécules dont le moment dipolaire est parallèle à la direction de la lumière excitatrice polarisée : C est le principe de la photosélection. Seules ces molécules seront excitées. Les molécules excitées vont se désexciter en émettant un rayonnement de fluorescence. La fluorescence émise par ces molécules après excitation par une lumière polarisée est elle-aussi polarisée. L amplitude de cette polarisation est décrite en termes d anisotropie. Tout changement de direction des moments de transition pendant la durée de vie de l'état excité provoquera une diminution de l'anisotropie, c'est-à-dire induira une dépolarisation partielle ou totale de la fluorescence. La dépolarisation de fluorescence peut être causée par plusieurs phénomènes dont l'importance relative dépend de l'échantillon étudié (mouvement brownien, vibration de torsion, transfert d'énergie...), mais la principale cause est les mouvements de rotation qui animent les molécules (Figure 33) (Nasir & Jolley, 1999; Weber, 1952). A B Figure 33: Analyse de la liaison de ligand par anisotropie de fluorescence. (A) Un fluorophore est excité par une lumière polarisée. Si pendant la durée de vie de l'état excité, le fluorophore est immobile, la lumière émise sera majoritairement orientée parallèlement au rayon incident. Par contre, si l orientation du dipôle des molécules fluorescentes change (mouvement du fluorophore), la polarisation P mesurée diminue. (B) Lorsqu un ligand fluorescent (D *) libre en solution est excité par une lumière polarisée, sa rotation rapide (en raison de son faible poids moléculaire) provoque l'émission d une lumière dépolarisée et une anisotropie faible est mesurée. Quand D * se lie à un récepteur R, son volume effectif augmente et sa rotation est ralentie. La lumière émise est dans ce cas-là polarisée dans le même plan que la lumière d'excitation et A augmente (Rossi & Taylor, 2011). 96

97 Matériels et Méthodes L'anisotropie est donc une mesure de la dépolarisation de fluorescence et est de ce fait directement reliée à la dynamique des macromolécules (Jameson & Seifried, 1999). La polarisation P et l anisotropie A de la lumière émise sont données par les relations: P = (I//- I ) / (I// + I ) et A = (I// - I ) / (I// + 2 I ) où I// et I correspondent à l intensité de fluorescence émise dont la polarisation est respectivement parallèle et perpendiculaire à la polarisation de la lumière d excitation (Figure 34) avec P = 3A/(2 + A) et A = 2P/(3 - P) (Nasir & Jolley, 1999). B.II Conditions expérimentales Nos études d anisotropie de fluorescence ont été effectuées sur le fluorimètre, équipé d un polariseur au niveau de la lumière d excitation et d un autre polariseur au nivea u de la lumière d émission. Les titrages ont été réalisés à 5 C dans une cuve en quartz thermostatée 1 cm x 0.5 cm. Les oligonucléotides et les peptides marqués ont été dilués à la concentration désirée (généralement 10nM) dans 800 µl de tampon phosphate 10mM, ph 6. Les échantillons d'oligonucléotides ont été titrés par l'addition de concentrations croissantes de RAL, de TB11 ou de peptides K156 et K156-loop140. Les échantillons de peptides F-K159 et K159-F ont été titrés par des concentrations croissantes d'anticorps 4F4 et 4C6. Après chaque addition, la solution a été laissée pour s équilibrer pendant au moins dix minutes. Pour chaque point de titrage, aux moins 10 valeurs d'anisotropie ont été enregistrées avec un temps d'intégration de 1 s et la contribution du tampon et du ligand a été soustraite. Le traitement des courbes de titrage par GraphPad Prism selon la méthode Non linear regression (curve fit)-least squares (ordinary fit) a permis de déterminer les K d des interactions. Les conditions expérimentales de ces titrages sont regroupées dans le tableau 3. 97

98 Matériels et Méthodes Figure 34: Représentation schématique de la mesure en anisotropie de fluorescence. L'intensité du rayonnement émis est mesurée dans 2 directions parallèle et perpendiculaire à la direction du faisceau incident (I// et I ) (Lea & Simeonov, 2011). Oligonucléotides/peptides fluorescéinés Longueur d'onde d'excitation (nm) Longueur d'onde d'émission (nm) Largeur de la fente d'excitation (nm) Largeur de la fente d'émission (nm) LTR LTR LTR LTR32-GT F-K K159-F Tableau 3: Conditions expérimentales des titrages en anisotropie de fluorescence. B.II Mesure indirecte de l'affinité des ligands non marqués: déplacement du ligand marqué Une fois le K d pour la liaison du ligand marqué (D*/peptide F-K159 ou K159-F) au récepteur R/anticorps déterminé (méthode de saturation), le K d de n'importe quel autre ligand compétiteur non marqué (I) peut être aussi déterminé (Rossi & Taylor, 2011). En pratique, 98

99 Matériels et Méthodes pour ces expériences, des concentrations fixes de R et de D* sont choisies de sorte à ce que l'anisotropie mesurée (A M ) soit proche de A DR (i.e. la majorité de D* est liée à R). D* T (concentration totale de D*) devra être la plus petite concentration compatible avec l'obtention d'une anisotropie fiable et R T optimale sera dans ce cas la quantité de R suffisante pour lier la majorité de D*. Le complexe D*R formé est titré par des concentrations croissantes du ligand compétiteur non-fluorescéiné. A partir de ces expériences de compétition, la concentration libre de I nécessaire pour déplacer 50% de D* est déterminée ( ). Cependant dans ces conditions, I entre en compétition avec D* pour la liaison à R: la concentration de I nécessaire pour occuper 50% de R ( ) est supérieure à la concentration requise pour la liaison de I pris seul à R (K d ). Puisque les de divers ligands ne sont comparables que dans les conditions expérimentales strictement identiques, pour toute comparaison, nous utilisons une valeur corrigée de, dénommée calculée avec l'équation de Cheng et Prussof (Cheng & Prusoff, 1973), supposant que la liaison du ligand marqué et la liaison du ligand non marqué sont compétitives: Dans cette équation [D*] est la concentration du ligand marqué de référence et constante de dissociation de ce ligand définie par méthode de saturation. la Dans le cas particulier des expériences d'anisotropie de fluorescence, les relations entre les concentrations libres et totales sont plus compliquées, ce qui conduit à l'équation suivante: où (et I 50 ) sont les concentrations libre (et totale) du ligand compétiteur I causant le déplacement de 50% de D* lié, est la concentration de D*R à I 50 et est la constante de dissociation de D*. A I 50, 50% de R sont occupés par I, donc:. 99

100 Matériels et Méthodes Puisque l'anisotropie de fluorescence mesure la fraction liée de D* ([D*]/D* T ), nous pouvons calculer à partir de l'anisotropie mesurée à I 50 ( ): = Pour déterminer les différents paramètres permettant le calcul de, nous construisons la courbe de compétition comportant en abscisse (échelle logarithmique) les concentrations du ligand non marqué et en ordonnée l'anisotropie provenant de la liaison spécifique du ligand marqué. Le traitement des courbes par le logiciel GraphPad Prism selon la méthode Non linear regression (curve fit)-least squares (ordinary fit) permet de déterminer la valeur de I 50. Les, et sont également déduites de la courbe. D* T est la concentration totale du ligand D marqué et R T est la concentration totale du récepteur. B.II.4. Dynamique moléculaire Les calculs de dynamique moléculaire (MD) ont été réalisés avec le logiciel GROMACS (version 4.5.3) (Hess et al., 2008) en utilisant le champ de force Amber99SB- ILDN (Lindorff-Larsen et al., 2010). Les paramètres de RAL ont été construits en utilisant ACPYPE (AnteChamber PYthon Parser interface) (Sousa da Silva & Vranken, 2012), le champ de force Amber général (General Amber Force Field (GAFF)) (Wang et al., 2004) et les charges RESP (restrained electrostatic potential). Les charges RESP ont été calculées par le programme Antechamber (Wang et al., 2006) en utilisant les charges ESP (restrained electrostatic potential) calculées avec la méthode Hartree-Fock (Roothaan, 1951) niveau 6-31G *(Rassolov et al., 2001) en utilisant G03 (Gaussian03, Révision C.02). Les simulations sur les complexes RAL-ADN ont été effectuées sur les ADN de PFV processé et non-processé avec un seul ion Mg 2+. Les coordonnées initiales du complexe LTR32-RAL ont été extraites de la structure PDB 3OYA (Hare et al., 2010), après suppression de IN. LTR34 de PFV, a été construit par addition du dinucléotide 5'AT (correspondant à 5'G 2 T 1 3' du VIH) à l'extrémité 3' du brin processé, en utilisant le programme VMD (visual molecular dynamics) (Humphrey et al., 1996). Le système a été solvaté dans une boîte à eau explicite (modèle TIP3P) (Jorgensen et al., 1983) qui s'étend au moins sur

101 Matériels et Méthodes Å dans chaque direction à partir de n'importe quel atome d'adn ou de RAL. Les systèmes comprennent molécules d'eau et 35 ions Na dans le cas de LTR34 (46274 atomes) et molécules d'eau et 33 ions Na dans le cas de LTR32 (41651 atomes). B.II.5. Calculs des énergies libres de liaison Les énergies libres de liaison de RAL ont été estimées en utilisant la méthode MMPBSA (Molecular Mechanics Poisson-Boltzmann Surface Area) (Hou et al., 2011; Kollman et al., 2000; Massova & Kollman, 1999; Srinivasan et al., 1998; Xue et al., 2012). L'énergie libre totale (G) d'une espèce donnée (complexe, récepteur et ligand) dans l'analyse MMPBSA a été déterminée en utilisant l'équation (1), le changement global dans l'énergie libre lors de la formation du complexe (ΔG bind ) pour un événement de liaison non covalente a été calculée selon l'équation (2). G = G polar + G nonpolar + E MM -TS Eq. (1) ΔG bind = ΔH -TΔS = G comp - (G rec + G lig ) Eq. (2) Les énergies de solvatation polaires (G polar ) ont été calculées dans un solvant continu en utilisant l'équation de Poisson-Boltzmann (PB) et une force ionique de 0,05 comme dans la partie expérimentale. Les termes non polaires (G nonpolar + γsasa + β) ont été estimés à partir des surfaces accessibles aux solvants (SASA: solvent accessible surface areas) en Ǻ (Lindorff-Larsen et al., 2010)) avec des valeurs typiques pour γ = kcal / mol Ǻ 2 (Lindorff-Larsen et al., 2010) et β = 0,92 kcal / mol. Le terme E MM représente la somme des énergies électrostatiques (Coulombic), VDW (Lennard-Jones), et les énergies internes (élongation, flexion et torsion). Le terme restant représente la température (T) et l'entropie du soluté (S), qui peut être estimée par le calcul des modes normaux de structures à énergie minimisée sur la région stabilisée de la trajectoire de MD. L'analyse de l'énergie libre a été réalisée en utilisant un script MMPBSA.py du programme Amber11. Ces calculs ainsi que les calculs de dynamique moléculaire ont été effectués par Dr. Safwat Abdel-Azeim. 101

102 Matériels et Méthodes B.II.6. ELISA L identification des épitopes de 4C6 et de 4F4 a été effectuée par ELISA (Enzymelinked immuno sorbent assay). Les épitopes étudiés sont les suivants : K159, K159-1, K159-2, IN638, IN638-1, IN638-3, IN638-4, α4, K156, IN636, IN636-1, IN636-2, K159-3, K159-4, K159-5 et K159-6 (Figure 26). La plaque ELISA est revêtue par 5 µg de IN ou de CCD ou de peptide dilué dans la solution de revêtement (phosphate 0.1 M ph 7.4) et incubée pendant une nuit à 4 C, l excès d'ag est récupéré et la plaque saturée par la solution de saturation (1% BSA dans la solution de revêtement) puis incubée à 37 C pendant 1 heure et lavée 3 fois par la solution de lavage (Phosphate 0.01M, NaCl 0.15M, ph7.4). A la suite de cette étape, 100 μl par puits de chaque anticorps ou Fab sont ajoutés, aux concentrations choisies (0.2 µg/ml pour 4F4 et 1µg/mL pour 4C6 et les Fab 4F4 et 4C6 dilués dans la solution de dilution (Phosphate 0.01M, NaCl 0.15M, ph7.4, 1% BSA)); La plaque est ensuite incubée à 37 C pendant 1 heure et les puits sont lavés avec du tampon de lavage pour éliminer les anticorps en excès. Après lavage de la plaque, l anticorps secondaire couplé à la peroxydase (anti-mouse IgG (Fab specific)- peroxidase, antibody produced in goat- Sigma) est ajouté à une dilution de 1/10000 à raison de 100µl/ puits. La plaque est de nouveau incubée pendant une heure à 37 C. Après une étape de lavage pour éliminer l excès d anticorps secondaire, la révélation est faite par le substrat de la peroxydase, le 3,3,5,5 -Tétraméthylbenzidine (TMB) (100µl/ puits); la plaque est placée 20 à 30 minutes à l obscurité, un produit de réaction bleu se développe alors. Ce produit peut être lu à 370 ou à 655 nm. La réaction du TMB est arrêtée par du HCl 1N formant un produit réactionnel jaune qui est lu à 450 nm. Pour vérifier si les oligonucléotides entrent en compétition avec les anticorps pour la liaison à IN, des tests ELISA de compétition ont été effectués avec LTR34, LTR32 et LTR17 en prenant CRE comme témoin négatif (Figure 23). 5 µg de IN et 5 µg d'adn ont été préincubés à 37 C pendant une heure. Les puits ont été revêtus par les complexes IN-LTR et incubés à 4 C sur la nuit. A partir de là, le même protocole décrit ci-dessus est suivi. 102

103 Matériels et Méthodes B.II.7. Dot Blot La reconnaissance de IN et de CCD par les anticorps 4F4 et 4C6 a été évaluée par dot blot. Les échantillons (2, 5 et 10 µg) sont déposés sur une membrane de nitrocellulose à raison de quelques µl par dépôt de façon à concentrer l échantillon au maximum. Après séchage à l air libre, la membrane est saturée par un tampon de blocage 3% BSA dans du TTBS (20 mm Tris, 150 mm NaCl, 0.05% Tween20, ph7.5) pendant 60 min sous agitation. Après décantation du tampon de blocage, la membrane est incubée en présence de l anticorps primaire (dilution du 4F4 à 0.2 µg/ml, de 4C6 et des fragments Fab 4F4 et 4C6 à 1µg/mL dans du TTBS) à température ambiante pendant 60 min sous agitation ou sur la nuit à 4ºC. Les anticorps non fixés sont éliminés par cinq lavages successifs de la membrane dans un tampon TTBS. Après 5 rinçages, la membrane est incubée en présence de l anticorps secondaire IgG anti-mouse, couplé à la «HorseRadish Peroxydase (anti-mouse IgG (Fab specific)-peroxidase, antibody produced in goat- Sigma) dilué au 1/10000 dans du TTBS à température ambiante pendant 60 min sous agitation. L anticorps secondaire est décanté et la membrane est lavée entre trois et cinq fois pendant 10 min dans du TTBS. La révélation est faite par la technique ECL (Immun-Star Western C Kit BIO- RAD). Le luminol/enhancer est mélangé avec le tampon peroxyde suivant un ratio 1:1 ; la membrane est incubée dans la solution de substrat pendant 3 à 5 min (0.125mL de solution de substrat/ cm 2 de membrane). En présence d eau oxygénée (H 2 O 2 ), la peroxydase de raifort (horseradish peroxidase HRP) conjuguée à l anticorps secondaire catalyse l oxydation du luminol. L oxydation du luminol provoque sa luminescence. L'enhancer est utilisé pour augmenter la longévité et l intensité du signal émis. L excès de substrat est coulé et la membrane visualisée sur le Molecular Imager ChemiDoc XRS System-Biorad. B.II.8. Western blot Les échantillons (extraits de bactéries produisant IN et CCD) sont pris dans du tampon de dépôt laemmli sample buffer (Tris-HCl 31.5 mm, ph 6,8 ; SDS 1% (m/v), Bleu de bromophénol 0,005% (m/v), glycérol 15%; 355mM β-mercaptoéthanol) et migrés sur gel SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) pour être par la 103

104 Matériels et Méthodes suite transférés sur membrane. Le gel de polyacrylamide est constitué d un gel de concentration à 5% d acrylamide et d un gel de séparation à 15% d acrylamide (Tableau 4). Un marqueur de poids moléculaire coloré (Kaleidoscope prestained standard-biorad) permet de suivre la migration et d estimer le poids moléculaire des protéines des échantillons analysés. L électrophorèse est conduite dans du tampon de migration (Tris-HCl 25 mm, glycine 192 mm, SDS 0,1%). Les protéines séparées par SDS-PAGE sont transférées électriquement sur une membrane de nitrocellulose. Le gel est équilibré à priori dans du tampon de transfert (Tris 25 mm, glycine 192 mm ph 8.3 ; MeOH 20%) pendant 10 min. Deux papiers filtres épais (2.4mm) sont trempés dans du tampon de transfert ainsi que la membrane de nitrocellulose. Le sandwich de transfert est assemblé sur la base de la cassette (anode) en plaçant le papier filtre sur le fond, ensuite la membrane, le gel et finalement le papier filtre restant en dess us. Le couvercle de la cassette est placé sur la base. Le transfert semi-sec est effectué suivant les conditions recommandées pour le transfert en utilisant le Trans-Blot Turbo system de BioRad (25V, 1.3A, 30 min). La révélation de la membrane est réalisée comme pour le Dot Blot. Gel de séparation 15% Gel de concentration 4 % Bis- Acrylamide (37,5:1) (40%) (ml) Tris-HCl (1.5 M) ph 8.8 (ml) SDS (10%) (µl) Tris- HCl (0.5 M) ph 6.8 (ml) H 2 O (ml) Persulfate d ammonium (PSA) (µl) TEMED (µl) Tableau 4: Composition du gel de polyacrylamide SDS PAGE. La pureté des anticorps et des fragments Fab a aussi été contrôlée sur SDS-PAGE 15%. 104

105 Matériels et Méthodes B.II.9. Résonance Plasmonique de Surface La résonance à plasmons de surface (SPR) a été développée par la société Biacore au début des années 90. La méthode sert à l'analyse des interactions moléculaires sans marqueur et en temps réel. En 2001, la société GenOptics a développé la SPR par imagerie (SPRi) (Bouffartigues et al., 2007; Buckle et al., 1996). L avantage de la SPRi par rapport à la SPR est son approche multiplexe, c'est-à-dire sa capacité à étudier simultanément et en temps réel l interaction de plusieurs centaines (jusqu à 1000) de molécules-sondes différentes accrochées à la surface de la biopuce avec des dizaines de molécules cibles en circulation. L aspect temps-réel permet d extraire les cinétiques d interaction et d accéder par-là aux constantes d affinité des molécules entre-elles. En parallèle, l approche multiplexe apporte une solution aux problèmes de variabilité (Cherif et al., 2006). Par ailleurs, contrairement aux techniques basées sur la fluorescence, ces systèmes fonctionnent sans marquage. B.II.9.1. Principe Lorsque la lumière incidente est dirigée à un certain angle (angle de résonance) sur un métal riche en électrons libres tel que l or ou l argent, les photons provoquent une oscillation des électrons libres appelée Résonance Plasmonique de Surface (SPR). Ces oscillations se caractérisent par une onde évanescente dont l amplitude diminue exponentiellement depuis la surface sur une distance maximale de 200 nm (Figure 35). Figure 35: Principe de la SPR (Daghestani & Day, 2010). 105

106 Matériels et Méthodes L onde évanescente est le point central des mesures d interactions. En effet, une perturbation de l onde évanescente, consécutive à l interaction de biomolécules sur la surface va induire une diminution de l angle de résonance directement mesurable. Deux stratégies sont alors envisageables (Figure 36). La première est de suivre les variations d angle de résonance au cours du temps, il s agit des systèmes basés sur la SPR dite «classique». La seconde approche est de travailler à angle fixe et de mesurer les variations de réflectivité induites par la variation d angle au cours du temps, on parle alors de SPR par imagerie (SPRi). Figure 36: Evolution des courbes plasmon avant (rouge) et après (bleu) une interaction biologique. Les différentes méthodes exploitant l évolution des courbes de plasmon (1 : lecture type BIAcore 2 : lecture par imagerie SPR). L'enregistrement en continu de la variation de l intensité lumineuse ou de l'angle de résonance permet de suivre en temps réel la fixation des molécules injectées sur le biocapteur. La réponse est proportionnelle à la masse des molécules qui se lient au ligand immobilisé sur la surface du biocapteur. Le signal de résonance est exprimé en unités de résonance (RU). Sa représentation au cours du temps est un sensorgramme (Figure 37). Cette méthode d analyse permet de calculer les vitesses d association et de dissociation et d en déduire les constantes d affinité caractéristiques de l interaction. 106

107 Matériels et Méthodes Figure 37 : a) Evolution des courbes plasmon avant (rouge) et après (bleu) une interaction biologique b) Suivi cinétique en temps réel de la réflectivité décrivant successivement une phase d association et une phase de dissociation. B.II.9.2. Etude des interactions anticorps-peptides L étude des interactions anticorps-peptides a été effectuée sur un système SPRi GenOptics. L'interface biologique est constituée d'une surface de prisme revêtu d'une couche mince d'or (~50 nm). Ce prisme constitue le dispositif de couplage de l onde incidente avec l onde de surface. Les peptides sont immobilisés sur la surface d or carboxylée via leurs fonctions amines primaires. La surface carboxylée est d abord activée par incubation avec un mélange de 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide hydrochloride (EDC) (concentration finale=200 mm) et de N-hydroxysuccinimide (NHS) (concentration finale=50 nm) pendant 5 min à température ambiante ce qui crée des fonctions ester succinimide. Les différents peptides (à 0.5g/L) dilués dans du PBS sont par la suite déposés sur la surface pré-traitée du prisme. Les esters qui ne réagissent pas sont bloqués par de l'éthanolamine. Les anticorps et les Fab 4C6 et 4F4 (200µl à différentes concentrations dans du tampon PBS) sont injectés suivant un débit de 20µl/min dans la cellule d interaction à température ambiante. Le traitement des courbes d'association et de dissociation obtenues suivant le modèle de Langmuir a permis de déterminer les constantes cinétiques. La constante de dissociation apparente K off est fournie par traitement de la phase de dissociation suivant une expression exponentielle dans laquelle la variation relative de la réponse de résonance (R) en fonction du 107

108 Matériels et Méthodes temps (t) par rapport à R au temps t=0 (R 0 ) résulte de : R t =R 0 exp( -Kofft ) et la constante d association apparente K on peut être obtenue à partir de R t =R max (1-exp (Kon[C]+Kofft) ) pour une concentration donnée de la protéine [C], Rmax étant la réponse à saturation. Le K d calculé est le ratio de K off /K on. Trois spots sont analysés pour chaque peptide et les données représentent la moyenne des valeurs pour ces trois spots (Nogues et al., 2010). 108

109 C. Résultats et Discussion

110 Résultats et Discussion C.I. Analyse des Mécanismes d'inhibition de IN par deux INSTI: RAL et TB11. Les inhibiteurs de IN agissant sur le ST, efficaces contre le SIDA/VIH ont des structures extrêmement différentes, mais tous dérivent de la famille des DKA initialement conçus pour chélater les cofacteurs métalliques du site actif (voir Introduction). Les DKA et les composés apparentés peuvent inhiber IN in vitro en se fixant à l'interface ADN-enzyme, mais les sites et la nature des interactions sont toujours sensiblement différents. L archétype des DKA, le 5CITEP, se lie à l hélice α4, au sein de CCD pris isolément, alors que RAL ne peut se fixer à IN en absence d ADN viral. Il en résulte des propriétés différentes: le 5CITEP et le TB11, qui est l objet de cette étude, sont principalement des inhibiteurs du ST, tout en inhibant significativement le 3'P. En comparaison, RAL est essentiellement un INSTI. Nous proposons donc que ces composés bien que porteurs d un pharmacophore central semblable ont des modes d action complètement différents, notamment sur le site actif de l enzyme. De plus, un composé tel que TB11 démontre une faible biodisponibilité et surtout une importante toxicité, contrairement à RAL actuellement utilisé contre le SIDA. Partant de ces constatations, il nous a paru opportun de comparer certaines propriétés physicochimiques de ces deux composés (RAL et TB11), afin d évaluer leurs différences pharmacologiques. La première partie de ce travail de thèse est consacrée à l'analyse des complexes de TB11 et RAL avec les éléments de IN et de l ADN viral impliqués dans l interaction. La perspective est de déterminer le poids respectif de IN et de l'adn viral dans la formation des complexes ternaires avec TB11 ou RAL et d'essayer de comprendre quelle est l interaction la plus déterminante à l égard de l inhibition de IN et du blocage de l infection. Les principales études sont menées par DC, spectroscopie UV et fluorescence sur un système simplifié, formé de: deux peptides, K156 reproduisant l'hélice α4 de IN et K156- loop140, formé du peptide K156 et de la boucle flexible 140, de plusieurs oligonucléotides mimant les extrémités U5-LTR de l'adn viral processée et non-processée et les deux inhibiteurs en question. Nos techniques permettent de décrire les modifications conformationnelles induites par les différentes interactions et fournissent les paramètres thermodynamiques de ces interactions. Les résultats de cette partie sont peaufinés à l aide de 110

111 Résultats et Discussion calculs de modélisation moléculaire (docking et dynamique). Les principaux résultats font l objet de deux articles : «Unprocessed viral DNA could be the primary target of the HIV-1 integrase inhibitor raltegravir» par Farah Ammar et al. publié dans PlosOne en 2012 et «Understand Mechanisms of Integrase Inhibitors: raltegravir versus TB11» par Farah Ammar et al,. soumis à PlosOne (2013). C.I.1. «Unprocessed viral DNA could be the primary target of the HIV-1 integrase inhibitor raltegravir» by Ammar, F.F. et al. PlosOne (2012). Les INSTI récemment développés, comme RAL et EVG, ne présentent qu une très faible affinité pour IN seule en l absence d ADN viral (Espeseth et al., 2000; Fitzkee et al., 2010). La fixation de IN sur l'adn viral stimule la liaison de forte affinité des INSTI sur le complexe, suggèrant que les inhibiteurs s insèrent dans une poche à l interface ADN-protéine issu d'un arrangement du complexe nucléoprotéique (Asante-Appiah & Skalka, 1999; Chen et al., 2006; De Luca et al., 2003; Dicker et al., 2007; Espeseth et al., 2000; Goldgur et al., 1999; Karki et al., 2004; Pommier et al., 2005; Wang et al., 2005; Wielens et al., 2005). Ces résultats suggèrent aussi une participation importante de l'adn dans la liaison des INSTI à l intasome (Krishnan et al., 2010). Les structures cristallographiques et les modèles de l intasome complexé aux INSTI (Johnson et al., 2011; Karki et al., 2004; Krishnan et al., 2010) suggèrent que les INSTI se lient au site actif de IN au contact de l'extrémité du LTR de sorte à ce que les atomes d oxygène (ou azotes) coplanaires du pharmacophore central puissent capturer les ions métalliques divalents et que le groupement halobenzyl du INSTI s entasse sur la cytosine située en avant-dernière position du brin transféré (C 4 du CA conservé), poussant le 3 OH de l adénine terminale A 3 en dehors du site actif. C'est cette dislocation du dinucléotide CpA et l orientation inadéquate du groupement 3 OH issu de la réaction de maturation qui est la cause du blocage du ST. L'inhibition par les INSTI pourrait donc résulter de l incapacité de 3 OH de s ajuster correctement au site actif de IN. Ces données révèlent que les INSTI interagissent avec des nucléotides hautement conservés de l ADN et que les contacts directs avec la protéine sont importants pour la stabilisation de l inhibiteur mais ne sont pas 111

112 Résultats et Discussion forcément prioritaires pour l inhibition (Johnson et al., 2011). En effet, jusqu'à très récemment, on supposait que les groupements aromatiques des INSTI établissaient des liaisons uniquement avec IN au sein de l intasome (Chen et al., 2008). Les nouvelles informations démontrent que ces groupements aromatiques peuvent aussi interagir avec les nucléotides hautement conservés terminaux de l'adn viral, en particulier A 3 et C 4 du brin d'adn transféré et G -4 du brin non-transféré. Ces résultats sont parfaitement en accord avec des études précédentes décrivant l implication des extrémités de l'adn viral: d'une part, le rôle crucial de l adénosine en 3 dans la fixation des INSTI (Langley et al., 2008) ; et d'autre part, l impact des nucléotides en 5' sur l'affinité d'un STI pour les LTR (Dicker et al., 2007). Plus particulièrement, c'est l'adénosine terminale porteuse du 3'OH qui contrôle les cinétiques d'association et de dissociation des INSTI (Langley et al., 2008). Toute mutation de cette adénosine impacte les cinétiques de liaison des INSTI au complexe ADN-protéine, confirmant une fois de plus le rôle de l'adn dans la liaison des inhibiteurs. Les données cinétiques indiquent aussi que la liaison des INSTI à l intasome est un mécanisme en deux étapes (Garvey et al., 2009; Langley et al., 2008), suggérant que la chélation des Mg 2+ et le stacking sur la cytosine de CpA sont des événements découplés et se déroulent à des vitesses différentes. Le stacking du noyau halobenzyl sur la cytosine serait donc non seulement l un des deux contacts-clés favorables à l inhibition mais pourrait aussi contribuer efficacement à la reconnaissance des INSTI par l intasome. L importance de l ADN a aussi été soulignée dans le mécanisme d action des INSTI de deuxième génération, efficaces sur les mutants de résistance à RAL, tels que DTG et MK0536. Ces deux inhibiteurs démontrent une affinité pour l'adn viral plus importante que RAL, et la contribution de la protéine au sein du complexe apparaît réduite (Johnson et al., 2011; Metifiot et al., 2011). Et vu la conservation du dinucléotide CA, il a été proposé que l optimisation de cette interaction serait un facteur considérable dans le développement de futurs INSTI (Johnson et al., 2011). Par ailleurs, Garvey et al. (2009) ont pu montrer, par le biais d une étude des interactions de six INSTI différents avec des complexes IN-LTR processé et non-processé, qu'un changement de conformation de IN induite, par la réaction 3'P, n'était pas une condition obligatoire permettant la fixation des INSTI à l intasome, puis à l inhibition de la réaction ST 112

113 Résultats et Discussion (Garvey et al., 2009). Cette étude remet aussi en question les résultats concluant que la fixation de l'adn induisait une conformation de IN favorisant la fixation des inhibiteurs. De quelle façon l ADN est-il donc indispensable à la liaison des INSTI à l intasome, si sa fixation à IN ne modifie pas la conformation du site actif? Si l ADN est impliqué dans des contacts avec l inhibiteur, à quel degré sera-t-il responsable de l inhibition? Etant donné qu'aucune question n'a été posée dans la littérature sur le rôle possible de l'adn viral en tant que cible primaire des INSTI, toutes les études précédentes ont été réalisées en présence de la protéine et on ne disposait d'aucune donnée sur la fixation des INSTI à l'adn seul. On s est trouvé pendant longtemps face au schéma classique d une molécule qui inhibe une enzyme en interagissant avec son site actif, avant de s apercevoir qu en absence d ADN, les inhibiteurs puissants de IN n interagissaient absolument pas avec celle-ci. En considérant le fait que même si l'on retrouve les INSTI à l'interface ADN-IN, on ne sait pas lequel des deux partenaires gère la liaison des INSTI. Est-ce IN ou bien les extrémités des LTR qui sont la cible primaire des INSTI? Si les extrémités des LTR sont la cible primaire des INSTI sous quelle forme le sont-elles : processée ou bien non processée? Pour répondre à ces questions, nous avons analysé l interaction de RAL avec plusieurs oligonucléotides mimant ou dérivant de l'extrémité U5-LTR processée et non processée de l'adn viral. Les études ont été menées par spectroscopies UV-visible, DC et fluorescence ainsi que par dynamiques moléculaires (GROMACS 4.5.3/Amber99SB-ILDN) et calculs de l'énergie libre de liaison (MMPBSA: Molecular Mechanics-Poisson Boltzmann Surface Area method). Les résultats indiquent qu'une molécule de RAL se lie étroitement au LTR processé (K d 6 nm) et plus faiblement au LTR non processé (K d 20 nm). La liaison de RAL à l'adn processé nécessite plusieurs nucléotides-clés, incluant le dinucléotide pendant (non apparié) 5 A -1 C -2 3 connu pour sa forte implication dans la liaison et l'activité de IN (Dicker et al., 2007). La liaison de RAL à ce dinucléotide dans LTR non processé est facilitée par le fraying (l agitation) des paires de bases terminales qui abaisse la barrière d'énergie pour l'insertion de la drogue (Katz et al., 2011; Scottoline et al., 1997). Nous montrons que l'insertion de RAL dans les paires de bases terminales de l ADN non processé, n'affecte que légèrement le fraying et les mouvements de la liaison phosphodiester scissile, et de ce fait la 113

114 Résultats et Discussion réaction 3'P peut se dérouler. En fait, le succès de cette dernière réaction est très étroitement lié à l agitation qui règne aux extrémités des LTR (Katz et al., 2011). La liaison de plusieurs INSTI dont RAL aux extrémités de l ADN non-processé a été démontrée précédemment: Bera et al. (2011) ont trouvé sur gel agarose natif que les INSTI étaient capables de piéger efficacement un complexe IN (VIH-1)-LTR non-processé. RAL engage ~ 20-25% du substrat ADN de départ. La formation de ces complexes stables ne dépend pas du 3'P de l'adn viral. A forte concentration d'inhibteurs (>50µM), le 3 P est inhibé, la quantité maximale de complexes IN-LTR non processé-ral est alors détectée sur le gel. Après clivage du dinucléotide 5'G 2 T 1 3', RAL bloque la réaction de ST en adoptant une nouvelle position à l'extrémité du LTR, plus propice à sa liaison aux deux cations bivalents et à C 4 du C 4 pa 3 conservé (Hare et al., 2010; Hare et al., 2010; Krishnan et al., 2010). Remarquablement, dans nos deux structures modélisées de RAL-LTR processé, l'adénine A 3 porteuse du groupe 3'OH adopte les mêmes conformations que celles trouvées dans les structures cristallines des complexes intasome-ral (codes PDB: 3L2T (Hare et al., 2010) et 3OYA (Hare et al., 2010)). Dans l une des stuctures RAL-LTR non-processé calculées, RAL adopte la même conformation que ci-dessus. Tous ces résultats nous apportent plus d éclairage sur le mécanisme d'inhibition des INSTI, en montrant notamment : a) qu ils peuvent se lier spécifiquement aux extrémités LTR processée et non processée, b) que la liaison de RAL au LTR non-processé n'inhibe que très peu la réaction de 3'P, parce que le fraying nécessaire au clivage de la liaison phosphodiester scissile par IN n'est que faiblement affecté par la liaison de RAL au LTR non processé. Ceci est confirmé par Katz et al. (2011) qui ont montré que la présence de RAL ne diminue pas le fraying des paires de bases terminales de l'adn viral (Katz et al., 2011) alors que les inhibiteurs qui réduisent le end fraying réduisent également l'efficacité de la liaison de IN à l'adn (Katz et al., 2011). Ce résultat est en parfaite adéquation avec les propriétés de liaison de cette classe d'inhibiteurs: la fixation de RAL à l'extrémité de l'adn viral est sans conséquences sur la liaison de la protéine à l'adn viral et sur le end fraying et c) Après le clivage du dinucléotide 5'G 2 T 1 3', RAL adopte une nouvelle position à l'extrémité du LTR, responsable du blocage de la réaction de ST. 114

115 Résultats et Discussion En raison d'une exigence stricte des bases aux extrémités des LTR pour l'intégratio n rétrovirale (Bushman & Craigie, 1991; Craigie et al., 1990; LaFemina et al., 1991; Sherman et al., 1992; Vink et al., 1991) et du fait qu il n existe pas de preuves de mutations dans les LTR qui pourraient entraîner des résistances aux INSTI, nous pensons que la nouvelle génération d inhibiteurs devrait profiter, pour sa conception, de ces propriétés caractéristiques et invariables de l'intégration du VIH-1. Et donc des composés antiviraux plus spécifiques, avec une moindre capacité à induire des résistances par mutations dans IN, doivent pouvoir être obtenus grâce à une augmentation du nombre des interactions avec l'adn processé, au détriment de celles avec la protéine. (Voir le manuscrit qui suit) 115

116 Résultats et Discussion 116

117 Résultats et Discussion 117

118 Résultats et Discussion 118

119 Résultats et Discussion 119

120 Résultats et Discussion 120

121 Résultats et Discussion 121

122 Résultats et Discussion 122

123 Résultats et Discussion 123

124 Résultats et Discussion 124

125 Résultats et Discussion 125

126 Résultats et Discussion 126

127 Résultats et Discussion nottutppsni SnutroppuS 127

128 Résultats et Discussion C.I.2. «Understand Mechanisms of Integrase Inhibitors: raltegravir versus TB11» by Ammar, F.F. et al. (2013) soumis à Plos One. Les études les plus récentes indiquent que l hélice α4 (148/ ) et la boucle malléable du site actif ( ) sont les éléments les plus largement impliqués dans l association de IN à l ADN viral (Hare et al., 2010; Zargarian et al., 2003). Ainsi, les résidus Q148 (à la jonction de ces deux éléments) et N155 (dans l hélice α4) entrent très clairement en interaction avec l ADN viral, et leurs mutations induisent la résistance à RAL et à EVG (Delelis et al., 2008; McColl & Chen, 2010). Afin de mieux comprendre le rôle de l ensemble du segment boucle-hélice α4 dans la reconnaissance de l ADN viral par IN, d'une part, et dans l'interaction avec les inhibiteurs à motif dicétone ou équivalent, d'autre part, et ainsi déterminer le mécanisme d action de ces inhibiteurs, nous avons préparé un peptide K156-loop140 de 33 résidus couplant l analogue K156 de l hélice α4 à un élément d une dizaine d'acides aminés du côté N-terminal reproduisant la séquence de la boucle. En guise d ADN rétroviral nous avons les LTR34 (non-processé) et LTR32 (processé), LTR32-GT (LTR32 inversé portant un dinucléotide GT non apparié à l extrémité 3 ) et LTR30 (dépourvu des deux paires de bases terminales 5 GT3 :5 AC3 ). Comme inhibiteurs de IN, nous avons sélectionné le TB11 (Pais et al., 2002; Zhang et al., 2003) et RAL utilisé comme médicament anti-sida depuis fin 2007 (Grinsztejn et al., 2007; Koelsch & Cooper, 2009). Un ensemble exhaustif de travaux de cristallographie récents (Hare et al., 2010; Hare et al., 2010) suggère que RAL se lie dans le site actif de IN lié à l ADN processé en se glissant dans la poche créée par le départ de GT lors du 3'P. Le motif chélateur de l inhibiteur peut alors chélater la paire de cofacteurs métalliques à l interface IN-LTR. Par contre, nous ne disposons d'aucune information structurale sur le TB11, l un des plus anciens DKA synthétisés. Ce composé, quelques années plus tôt, avait créé pas mal d'espoir en tant qu'antiviral possible (Marchand et al., 2003; Pais et al., 2002; Zhang et al., 2003). TB11 et RAL sont très différents tant au niveau de leur structure chimique qu'au niveau de leur efficacité sur l'infection par le VIH-1: la IC50 de TB11 est de trente fois supérieure à celle de RAL (330 nm vs 10 nm) (Marchand et al., 2003; Summa et al., 2008). TB11 a été abandonné en raison de sa faible biodisponibilité par voie orale et sa possible interaction avec d autres 128

129 Résultats et Discussion enzymes à métaux divalents (Grobler et al., 2002; Summa et al., 2008; Summa et al., 2004). En comparaison, RAL a un profil pharmacologique extrêmement favorable, avec peu d'effets secondaires (CC50 environ 60 à 600 µm) (Svarovskaia et al., 2004) et une très bonne biodisponibilité. Dans l'article précédent, nous avions montré que RAL se liait avec une grande affinité aux extrémités processée et non processée des LTR (en particulier, à l'adn processé). L'efficacité de la liaison de RAL à l ADN viral est même plus élevée par rapport à celle avec l'intasome (Ammar et al., 2012; Dicker et al., 2007; Langley et al., 2008). Dans ce deuxième papier, nous avons cherché à évaluer la contribution respective de IN et de l extrémité des LTR dans la capture de TB11 et RAL, afin d établir une ligne de corrélations entre les affinités pour chacune des cibles et les activités. Nous avons utilisé le DC, la fluorescence (intensité et anisotropie), ainsi que les tests de retard et de relaxation de l'adn circulaire sur gel. Notre avons plus particulièrement procédé à: a) l'analyse de la structure des partenaires peptidiques liés et non liés à l ADN et aux inhibiteurs et à une évaluation de la nature des liaisons stabilisant les complexes; b) l'analyse de l impact du 3'P sur la stabilité des complexes de l ADN avec le peptide et les inhibiteurs; c) l évaluation des poids respectifs de IN et de l'adn viral dans la stabilité des complexes avec TB11 et RAL. Pour toutes ces études, nous nous sommes aidés des résultats issus de nos études antérieures sur K156 et les oligonucléotides LTR34 et LTR32 (Hobaika, 2009-Thèse; Hobaika et al., 2009; Renisio et al., 2005; Zargarian et al., 2003). Au total, les résultats de DC indiquent que le peptide K156-loop140 présente une structure secondaire en hélice α caractérisée par un pic positif à 190 nm et deux pics négatifs à 208 nm et 222 nm. Une estimation approximative de l'intensité de la bande de 222 nm fournit une teneur en hélice α de 20% environ, légèrement en dessous de la teneur en hélice α du peptide K156 pris séparément (Zargarian et al., 2003). Dans le peptide K156-loop140, la boucle 140 reste donc désordonnée comme dans les structures cristallographiques de CCD et IN-bi-domaines (Bujacz et al., 1996; Chen et al., 2000; Dyda et al., 1994; Goldgur et al., 129

130 Résultats et Discussion 1998; Greenwald et al., 1999; Maignan et al., 1998; Wang et al., 2001; Yang et al., 2000). Cependant, la conformation de la boucle dépend des ligands : les spectres DC indiquent un très fort changement conformationnel de la boucle 140 du peptide K156-loop140 (structure désordonnée > structure hélice) au sein du complexe peptide-adn. Ce changement optimise les interactions de la boucle avec l extrémité de l ADN viral, la liaison étant mieux réussie avec LTR32 qu avec LTR34. Les résultats d anisotropie de fluorescence sont en accord avec ceux du DC : ils montrent eux aussi que K156-loop140 se lie avec une affinité bien meilleure à l extrémité processée qu à celle non-processée alors que c'est le contraire qui avait été observé avec le peptide K156. Cette différence de comportement s'explique par les contacts établis par la boucle 140 dans la poche créée par la délétion de 5'GT et aussi des interactions avec plusieurs nucléotides incluant le dinucléotide pendant 5'AC à l extrémité du brin non transféré. Cependant, nous n'avons pas constaté d'interactions particulière de RAL avec K156 ou K156-loop140, en conformité avec l'absence d'interaction de RAL avec IN entière (Espeseth et al., 2000; Fitzkee et al., 2010). TB11, par contre, se lie avec une assez bonne affinité aux peptides K156 et K156-loop140. En revanche, comme RAL (Ammar et al., 2012), TB11 interagit avec l'adn viral processé (et non-processé), pris isolément, avec, toutefois, une plus faible affinité. Le K d pour la liaison de TB11 à LTR32 processé est dix fois supérieur à celui de RAL (100 nm vs 10 nm). Dans chaque cas, une seule molécule d inhibiteur occupe l'espace libéré par le clivage du dinucleotide 5'GT3, avec une plus grande liberté de mouvement, cependant, pour la molécule de TB11 de plus petite taille. Remarquablement, ces valeurs de K d pour la liaison de RAL et TB11 à l'adn processé sont semblables aux IC50 reportés pour le ST, soit près de nm pour TB11 et 2-7 nm pour RAL (Marchand et al., 2003; Summa et al., 2008). Cela évidemment suggère, l existence d une corrélation fonctionnelle entre l'affinité de l inhibiteur pour LTR32 processé et l'inhibition du ST. D'autre part, nous avons constaté que ni RAL ni TB11 ne peuvent empêcher la liaison de K156-loop140 au complexe inhibiteur-ltr32. En outre, les tests de relaxation de l'adn plasmidique et de retard sur gel, en conformité avec certains résultats spectroscopiques, 130

131 Résultats et Discussion montrent que TB11, contrairement à la plus grande molécule RAL, s'intercale dans les paires de base de l'adn, ce qui pourrait expliquer sa cytotoxicité élevée. (Voir le manuscrit qui suit) 131

132 Résultats et Discussion Understand Mechanisms of Integrase Inhibitors: raltegravir versus TB11 Farah F. Ammar 1,3a, Zeina Hobaika 1a, Safwat Abdel-Azeim 3, Loussinée Zargarian 3, Terrence R. Burke Jr 4, Richard G. Maroun 1, and Serge Fermandjian 2,3*. 1 Unité de Biochimie, Département SVT, Faculté des Sciences, Université Saint-Joseph, CST- Mar Roukoz, Beyrouth, Liban 2 Laboratoire de chimie et biochimie pharmacologiques et toxicologiques UMR8601 CNRS 45, Rue des Saints-Pères 75270, Paris cedex 06, France. 3 LBPA, UMR8113 du CNRS, Ecole Normale Supérieure de Cachan, Cedex, Cachan, France 4 Laboratory of Medicinal Chemistry, Center of Cancer Research, National Cancer Institute, NIH, Frederick, MD 21702, USA. a These two authors contributed equally to this work. * Corresponding author. Mailing address: Laboratoire de chimie et biochimie pharmacologiques et toxicologiques UMR8601 CNRS 45, Rue des Saints-Pères 75270, Paris cedex 06, France

133 Résultats et Discussion ABSTRACT Integrase (IN) is the retroviral enzyme that catalyzes integration of viral cdna into the infected cell chromosome. Integration involves two steps: the 3 processing (3 P) of viral DNA in the cytoplasm and the strand transfer (ST) in the nucleus. The DKA (diketoacid) related compounds raltegravir (RAL) and elvitegravir (EVG) have been approved recently by the FDA for use in anti-aids/hiv therapy. Both are effective inhibitors of integration, acting as INSTIs (IN ST inhibitors) at the IN-viral DNA interface. However, in a recent report we have shown that the high affinity binding of RAL to viral LTR (long terminal repeat) ends does not require the presence of the enzyme. Our results suggested that a strong binding to HIV DNA is one of the prerogatives of INSTIs endowed with high antiviral activities. Here, we compare the binding properties of RAL with those of TB11 which is one of the first DKAs synthesized with antiviral activity. Similarly to RAL, TB11 is an INSTI, but it is also a weak inhibitor of the 3 P reaction and it displays more side effects. To learn on the differences of behaviors of RAL and TB11, we studied their interactions with various viral DNA and protein fragments, using circular dichroism (CD) and fluorescence spectroscopies, docking assays, and DNA plasmid retardation and unwinding assays. Results highlight that TB11 similarly to RAL interacts with free processed and unprocessed LTR ends, although with a much lower affinity (K d s for processed LTR are about 100 nm for TB11 and below 10 nm for RAL). The structure and motions of the LTR terminal nucleotides-either processed or unprocessed-appear of tremendous importance for the binding of drugs. For each compound we find a good agreement between the affinity for processed LTR and the ST inhibition (in vitro IC50 is 2-7 nm for RAL and nm for TB11), suggesting a functional relationship between these two properties. Although TB11 and RAL, both can interact with the complex of processed LTR with the peptide K156-loop140 derived from the IN active site, only TB11 is able to bind to free K156-loop140 and to IN. We find also that at the higher concentration numerous TB11 molecules intercalate into DNA base pairs, what cannot RAL molecules. This event could contribute to the higher cellular toxicity of TB11. All together, (1) the higher ability of TB11 to inhibit 3 P could result from either its interaction with the enzyme active site, and consecutively, the hindrance of the DNA recognition, or loss of motions and/or distortions of the scissile phosphodiester bond resulting from its insertion into the adjacent terminal base pairs of unprocessed LTR; (2) a higher binding affinity for other proteins and the intercalation into DNA base pairs of TB11, could contribute to its weaker bioavailability and higher toxicity compared with RAL. Keywords: HIV-1; Integrase; DNA; Inhibitors; Interaction; Intercalation. 133

134 Résultats et Discussion INTRODUCTION Integrase (IN) is required for productive HIV infection (LaFemina et al., 1991). IN is encoded by the pol gene besides the two other enzymes reverse transcriptase (RT) and protease (PR). IN catalyzes the integration of viral DNA into the host chromosome following to two distinct steps (Asante-Appiah & Skalka, 1999; Brown, 1997; Bushman et al., 1990; Engelman et al., 1991; Esposito & Craigie, 1999). The first step, named 3 -processing (3 P), occurs in the cytoplasm of infected cell, and consists in cleavage of a dinucleotide GT from the 3 end of the active strand. The second step occurs after the translocation in the nucleus of the processed DNA incorporated in a so-called pre-integration complex (PIC) comprising IN and other viral and host proteins (Bukrinsky et al., 1993; Miller et al., 1997; Sherman & Greene, 2002). There, the processed viral DNA is randomly inserted into the host chromosome by a strand transfer (ST) reaction (Ellison & Brown, 1994; Engelman et al., 1991). Integration can be reproduced in vitro taking recombinant IN enzyme together with synthetic oligonucleotides mimicking the viral DNA extremities (Bushman et al., 1990; Craigie et al., 1990; Katz et al., 1990; Katzman et al., 1989). Similarly to the other polynucleotidyl transferases, the catalytic domain of INs contains a conserved motif DDE (i.e. three acidic amino acid residues). In the IN of HIV-1 these residues are found in positions 64, 116 and 152, respectively, and are spatially clustered in the active site. Each of these residues is critical for the 3 P, ST and disintegration reactions (Engelman & Craigie, 1992; Kulkosky et al., 1992). Introduction of IN inhibitors in antiretroviral therapy constitutes a fantastic progress against the expansion of AIDS. However, there is still no cure for the disease: the known protocols convert the killing AIDS into a chronic disease, mainly because the drugs do not reach the virus that takes refuge into reservoirs formed by latent resting CD4 cells and reappears when the treatment is stopped (Blankson et al., 2002; Chen et al., 2002; Finzi et al., 1997; Noe et al., 2005; Ruiz et al., 2000). Therefore, the time has not come to stop our efforts to eradicate AIDS in developing new drugs and finding new targets. IN has attracted much attention from researchers especially as it holds a key role in the virus life cycle and has no cellular counterpart (Debyser et al., 2002; Hansen et al., 1998). After years of effort two IN inhibitors, Raltegravir (RAL, MK-0518, Isenstress from Merck and Co) and Elvitegravir (EVG, JTK-303/GS-9137 from Japan Tobacco Inc. and Gilead Sciences) (Grinsztejn et al., 134

135 Résultats et Discussion 2007; Hazuda et al., 2000; Nguyen et al., 2011; Rowley, 2008; Serrao et al., 2009; Summa et al., 2008; Summa et al., 2004; Wills & Vega, 2012) have been introduced in clinical and contribute significantly to the cure of AIDS. A third compound, dolutegravir, (DTG, S/GSK from ViiV-Healthcare and Shionogi & Co. Ltd) (Katlama & Murphy, 2012; Vandekerckhove, 2010) presenting only minor resistance to mutations is in advanced phase 3 clinical trials. The three compounds belong to a class of IN inhibitors acting on ST (INSTIs), although 3 P can be also affected to some degree (Marchand et al., 2009; McColl & Chen, 2010). They derive from diketoacids (DKA) a class of compounds originally designed to interact with the metal co-factors at the IN-DNA interface (Espeseth et al., 2000; Grobler et al., 2002; Marchand et al., 2003; Pais et al., 2002). For a long time the co-crystal structure of the complex of 5CITEP (Table 1) bound to the catalytic core domain (CCD) of HIV-1 IN was the only available inhibitor-protein co-crystal (Goldgur et al., 1999). This DKA shares six interactions with CCD, five of them with the α4 helix exposed at the protein surface together with the catalytic site (Goldgur et al., 1999). However, 5CITEP although efficient against 3 P and ST (at high concentration) was found inactive against the HIV-1 infection (Goldgur et al., 1999; Pais et al., 2002; Vajragupta & Boonchoong, 2002). The complex of 5CITEP with CCD has caused numerous questions on the location and orientation of efficient inhibitors on the intasome (comp lex of IN with processed DNA). Most calculated models have located INSTIs within the cavity formed by the active site and the end of processed LTR, with the diketo (or equivalent) motif engaged in interactions with a pair of magnesium cations (Barreca et al., 2009; Chen et al., 2008; Ferro et al., 2009; Karki et al., 2004; Savarino, 2007). It is only recently that an X-rays picture of RAL (Table 1) and several other INSTIs in complex with the intasome has been solved (Hare et al., 2010; Hare et al., 2011; Hare et al., 2010), thanks to the use of the highly soluble and robust PFV (prototype foamy virus) enzyme (Delelis et al., 2008; Valkov et al., 2009). All the co-crystal structures show the coplanar oxygen (or nitrogen) motif of INSTIs at a chelating distance from the divalent ion pair, and the halobenzyl group within interactions with the highly conserved 5 CpA 3 /5 TpG 3 dinucleotide element at the LTR end (Hare et al., 2010; Hare et al., 2011; Hare et al., 2010; Metifiot et al., 2011; Metifiot et al., 2012). In contrast to RAL no structural information is available on the typical DKA TB11 compound (Table 1), on which, there is a time, some hope had been found as a possible anti- 135

136 Résultats et Discussion viral drug (Marchand et al., 2003; Pais et al., 2002; Zhang et al., 2003). TB11 strongly differs of RAL from its chemical structure (Table 1) and efficiency on HIV-1 infection: the 50% inhibitory concentration (IC 50 ) of TB11 is almost thirty times higher that of RAL (330 nm vs 10 nm) (Marchand et al., 2003). TB11 has been abandoned due to its low efficiency but also its low oral bioavailability and undesired interactions with other enzymes using divalent metals, especially in the DNA cortege (Grobler et al., 2002; Summa et al., 2008; Summa et al., 2004). In comparison, RAL has not adverse pattern with dose limiting side effects (50% cytotoxic concentration about 60 to 600 µm) (Svarovskaia et al., 2004), and displays a marked bioavailability. In a previous report we have shown that RAL interacted with high affinity to both free unprocessed and processed LTR ends (especially, that processed) (Ammar et al., 2012). Its binding affinity for processed LTR was even higher compared to that reported for the intasome (Ammar et al., 2012; Langley et al., 2008). We started from the idea that TB11 and RAL, endowed with totally different pharmacological properties, could also differ on their affinities for IN and LTR ends. We set a series of experiments to assess their bindings to IN and LTR ends, to establish correlations between bindings, structures and activities. To this purpose, we used circular dichroism (CD), fluorescence (intensity and anisotropy), docking assays, as well as gel retardation and unwinding assays with a plasmid DNA. All together our results suggest that the main cause of the efficiency difference between RAL and TB11 arises from important affinity differences for LTR ends. The dissociation constant (K d ) for the binding of RAL to processed LTR, is one log lower that of TB11. Moreover, TB11 binds to the K156-loop140 peptide that mimics the catalytic site sequence and intercalates also into DNA base pairs, while RAL does not. We concluded that the RAL molecule is better adapted than TB11 to achieve a selective binding to LTR ends. We also suggest that the lower bioavailability and higher toxicity of TB11 result from its parasite binding to other proteins and its intercalation into DNA base pairs. 136

137 Résultats et Discussion MATERIALS AND METHODS Oligonucleotides. These were purchased from Eurogentec (Belgium) LTR34: 5 ACTGCTAGAGATTTTCCTTTGGAAAATCTCTAGCAGT 3 ; LTR32: 5 ACTGCTAGAGATTTTCCTTTGGAAAATCTCTAGCA 3 ; LTR32-GT: 5 TGCTAGAGATTTTCCTTTGGAAAATCTCTAGCAGT 3 and LTR30: 5 TGCTAGAGATTTTCCTTTGGAAAATCTCTAGCA 3'. All are single strand oligonucleotides designed to adopt a folded hairpin structure, especially at the low concentrations required in fluorescence spectroscopy (Hobaika et al., 2009; Zargarian et al., 2003). Fluorescence studies were possible thanks to the fluorophore fluoresceine grafted on the thymine (in red) at the center of the 3 T loop. The so-called LTR34 once folded has a stem with 17 base pairs that mimics the unprocessed U5 LTR end of viral DNA. The folded LTR32 mimics the processed U5 LTR end. It has a stem with 15 base pairs and bears a dinucleotide AC overhang (in green) at the 5 terminus of the nontransferred strand. LTR32-GT with a dinucleotide GT overhang (in green) at the 3 end and the blunt ended LTR30 lacking the two terminal base pairs 5 GT3 :5 AC3 were designed to assess the role of terminal nucleotides on binding. In the four oligonucleotides, the highly conserved base pairs CpA/GpT are colored in blue. Peptides K156 and K156-loop 140. These: K156-loop140: KQEFGIPYNPQSQAKLEEMNKELKKLLAQVRAQ K156: SQAKLEEMNKELKKLLAQVRAQW were synthetized by Dr. Christophe Piesse at the University Pierre et Marie Curie to a purity grade > 98%. K156 is a stabilized version of the α4 helix (residues ) of the IN CCD (Hobaika et al., 2009; Zargarian et al., 2003), while the longer K156-loop140 peptide (residue 137

138 Résultats et Discussion 136 to residue 168) comprises the modified K156, with the unmodified flexible loop140 at its N-terminus. The peptide concentration was estimated for K156-loop140 from the UV signal intensity of the tyrosine at position 143 of IN and for K156 from the signal of tryptophan purposely added at the C-terminal position, using a molar absorption coefficient at 280 nm of 1280 M -1.cm -1 and 5600 M -1.cm -1, respectively. Inhibitors. Inhibitors used in this comparative study were RAL and TB11 (Table 1). RAL (Summa et al., 2008) is produced by Merck & Co. and has been purchased from CacheSyn. The powder is soluble in water. TB11 (MA-DKA) was synthetized by the Burke s group (NCI) (Pais et al., 2002; Zhang et al., 2003). CD measurements. CD spectra between 190 and 260 nm (peptides and peptide-drug complexes) and between 190 and 330 nm (DNA and peptide-dna complexes) were recorded with a Jobin-Yvon CD6 dichrograph using a quartz cell of 1 mm path length. Measurements were calibrated with (+)-10-camphosulfonic acid. Spectra of samples dissolved in phosphate buffer (10 mm, ph 6.0) were recorded with 1-nm steps, corrected for the base line, and averaged over 10 scans. Before spectral recording, samples were incubated during 10 min at the chosen temperature to allow the solutions to reach their equilibrium state. For titration experiments desired ratios were obtained by addition of the ligand (generally 1 µm to 20µM) to the compound kept at a constant amount (generally 20 µm) in the thermally jacketed cell. In the particular case of the DNA titration by peptides, peptide aliquots were added to 10 μm samples and the spectrum of LTR free of ligand was subtracted from that of the complex. This subtraction is not necessary for titrations by drugs as both RAL and TB11 are achiral molecules. Most experiments were recorded at 10 C. Spectra were expressed as a molar CD (Δε) as a function of wavelength (λ nm). The α helix content was estimated by the relation Pα=-[Δε 222 x10] (Pα: percentage of α helix; Δε 222 : CD per residue at 222 nm) (Zhong & Johnson, 1992). Fluorescence experiments. The fluorescence anisotropy and intensity studies were recorded on a Jobin-Yvon Fluoromax II instrument. Fluorescence anisotropy was expressed as: A = (I// - I ) / (I// + 2 I ), where I// and I referred to parallel and perpendicular emission components. These two components were measured in L-format. The denominator of A is simply the total light that would be observed if no polarizers are used. For the fluorescein 138

139 Résultats et Discussion reporter, maximum wavelengths from the xenon lamp (150 watts ozone-free) were for excitation λ=488 nm and for emission λ= 516 nm in the case of LTR34, λ=488 nm and λ=515 nm in the case of LTR32 and LTR32-GT and λ=488 nm and λ=514 nm in the case LTR30. The slit for excitation width was fixed at 4 nm and emission width was 5 nm for LTR34 and 4 nm for LTR32, LTR32-GT and LTR30. Samples were placed in thermally jacketed 1 cm x 0.5 cm quartz cells and controlled by a circulating bath. For each titration point, at least 10 data points were recorded at 5 C with an integration time of 1s. In fluorescence anisotropy measurements, I// and I intensities of background solution (i.e. buffer and solute contributions) were subtracted from the sample value. Oligonucleotides were diluted to the desired concentration in 800 µl assay buffers (10 mm Na/Na 2 PO 4, ph 6.0). Samples of, generally 10 nm oligonucleotide were titrated by the addition of aliquots of stocks TB11 or peptides. After each addition the solution was allowed to equilibrate at least 2 minutes. The validity of fluorescence anisotropy experiments was controlled in measuring the total fluorescence intensity in parallel to fluorescence anisotropy. As variations of fluorescence were weak, we considered that the anisotropy signal contained the desired information on the complex formation. Finally, K d s (equilibrium dissociation constants) were calculated by fitting the sigmoidal curves, using GraphPad Prism 5 applying the non-linear regression (curve fit) "Least Squares" procedure. In fluorescence intensity studies, fluorescence of TB11 or RAL was measured at the 20µM concentration in 800 µl of reaction buffer. Excitation at 313 nm for TB11 and for RAL provided an emission between 325 and 500 nm, using 2 and 5 nm excitation and emission slit widths, respectively. Maximal emission was measured at 410 nm for TB11 and 413 nm for RAL. Intercalative binding. In the intercalation mode, the chromophore is inserted in between adjacent base pairs, where it is stabilized by polarization and van der Waals forces (Lerman, 1961). Intercalation produces both an extension and left-handed unwinding of the helix (Dedon, 2001). Many intercalating drugs such as doxorubicin (or adriamycin) belonging to the anthracycline family and its related mitoxantrone are still extensively used in cancer treatments (Hurley, 2002). Such ligands generate electrophoretic retardation and unwinding of DNA, the extent of which depends on their shape and chemical structure. 139

140 Résultats et Discussion Gel retardation assay. The agarose electrophoretic retardation assay was carried out as previously described (Wadsworth & White, 2001). Briefly, TB11 and RAL were incubated at different concentrations with 250 ng of pbr322 plasmid DNA in binding buffer (20 mm HEPES ph 7.5, 5 mm DTT, 10% PEG-4000, 10 mm MgCl 2, 20 mm NaCl and 20 µm ZnCl 2 ), in 10 µl total volume. Mixtures were incubated 30 min at 4 C before addition of 2 µl of loading buffer (0.25% xylene cyanol, 0.25% bromophenol blue, 50% glycerol and 200 mm Tris HCl ph 7.5). Samples were then loaded onto 0.8% agarose gels and electrophoresed in 1x TBE for 5 hours at 80V. After electrophoresis, gels were stained in BET and visualized under UV light. DNA-unwinding assay. The DNA unwinding produced by drugs can be measured using closed-circular DNA further wound into right handed superhelix, taking as a reference the standard unwinding value of 26 induced by BET (Kroll et al., 1993; Sourgen et al., 1996; Waring, 1970). 250 ng of supercoiled pbr322 plasmid DNA were incubated alone or with either BET (at 0.1, 1 and 10 µg/ml) or TB11 (1, 3 and 15 µm) or RAL (15, 50 and 150 µm) for 15 min at 37 C. Type I topoisomerase (topoisomerase I, vaccinia, Sigma, Saint Louis, Missouri, USA) was then added (2.5 U) in activity buffer (50 mm Tris HCl ph 7, 10% glycerol, 1 mm EDTA and 2 mm NaCl) to allow complete plasmid relaxation after 1 hour incubation at 37 C in 20 µl total volume. Reactions were terminated by adding SDS and EDTA to concentrations of 0.5% and 20 mm, respectively. Proteins were then completely hydrolyzed with proteinase K (0.5 mg/ml) for 90 min at 45 C. 5 µl of loading buffer (0.25% xylene cyanol, 0.25% bromophenol blue, 50% glycerol and 200 mm Tris HCl ph 7.5) were added and samples were loaded onto 1% agarose gels and electrophoresed in 0.5x TBE for 6 hours at 50V and visualized after BET staining. Docking calculations Docking calculations were performed using Autodock4.2 program (Morris et al., 2009) and the restrained electrostatic potential (RESP) charges for ligands RAL and TB11. The two ligands are docked into the X-ray structure of the viral DNA of foamy virus pdb code 3OYA (Hare et al., 2010) containing one Mg 2+. For the RAL structure we used the X-ray coordinates (3OYA), while the structure of TB11 was created from scratch with the Gauss view program (Dennington et al., 2009). Both ligands are optimized with the Density Functional Theory (DFT) B3LYP 6-31G* method implemented in Gaussian03 140

141 Résultats et Discussion program. RESP charges were calculated with the Antechamber program (Wang et al., 2006) using the electrostatic potential charges (ESP) calculated at Hartree-Fock (Roothaan, 1951) 6-31G* level (Rassolov et al., 2001) with G03 (Gaussian03, Revision C.02). The graphical user interface (GUI) was used for the preparation of the inhibitor and receptor files. Grid maps of interaction energies for various atom types were constructed with a grid box of dimension Å3 centered on the active site. Calculations were performed with a population size of 150, number of energy evaluations of 5x106, maximum number of generations of 27,000, mutation and crossover rate of 0.02 and 0.8 respectively. The number of runs was set to 100 to explore a large number of poses of the highest affinity and the Solis and Wets algorithm was used to relax the best 10 % of the obtained conformations. RESULTS The idea behind this work was to evaluate the role held by viral LTR ends during inhibition of IN by antiretroviral drugs. Indeed, drugs as effective as RAL against ST attach to IN only in the presence of viral DNA (Espeseth et al., 2000). DNA is in itself an extraordinary target for different types of ligands (metal ions, peptides, proteins, peptides, oligonucleot(s)ides, nucleot(s)ides and organic compounds). It can form a variety of stable binary complexes with these ligands. IN inhibitors are characterized by a large variety of chelating cores deriving from DKAs. Those labeled as INSTIs contain a pharmacophore composed of 3 coplanar heteroatoms (oxygen or nitrogen) that chelate the metal ion cofactors at the DNA-IN interface. They also bear a halogenated aromatic ring that may interact with the highly conserved nucleotide bases at the end of retroviral DNA either unprocessed (Ammar et al., 2012; Pandey et al., 2011) or processed (Hare et al., 2010; Hare et al., 2011; Hare et al., 2010). Efficient INSTIs provide stable define complexes with the intasome. If these complexes are characterized by only small structural differences, effects on 3 P and ST inhibitions, virus infection, oral bioavailability, toxicity, and mutation resistance, can be significantly different. For instance, RAL displays remarkable efficiency for both treatmentexperienced and naïve patients (Grinsztejn et al., 2007; Koelsch & Cooper, 2009; Markowitz et al., 2006; Pandey et al., 2011), but it also induces important resistance mutations in the enzyme that do not occur with DTG (Hare et al., 2011). In comparison, the TB11 inhibitor displays a very simple chemical structure (Table 1), so that, important differences of activities could be expected. TB11 was in its time one of the most promising inhibitor of IN, 141

142 Résultats et Discussion but it has been abandoned mainly for low oral bioavailability and toxicity reasons (Marchand et al., 2003; Pais et al., 2002; Zhang et al., 2003). The two compounds contain a pharmacophore bearing three aligned oxygens prone to chelate a pair of divalent metal ions, but strongly differ in their structure complexity. It was tempting to carry out a comparative analysis of TB11 and RAL, looking at their binding properties in correlation with their pharmacological properties. To this end we used optical spectroscopies, CD and fluorescence, as well as DNA retardation, unwinding experiments and docking studies applied to a model system comprising viral DNAs, the two drugs, and IN representative fragments issued from the active site. Design of the K156 and the K156-loop140 peptides K156 is a helix stabilized peptide designed to mimic the α4 helix found at the surface of the IN CCD (residues ). To this end, several amino acid residues deemed not important for DNA recognition were replaced by more helicogenic ones in the corresponding α4 peptide (Hobaika et al., 2009; Zargarian et al., 2003). The backbone conformation of the so obtained K156 peptide has greater resemblance to the protein α4 helix compared with the α4 peptide taken in isolation, which is deprived of ordered structure. It is therefore, more functional, less aggregation prone, and more adapted to the study of specific interactions which are highly conformation dependent. The peptide K156-loop140 consisting of K156 and loop140 extends over 33 amino acids (residue ). The part corresponding to the loop 140 is highly flexible and mimics the peptide segment found within the IN active site. Binding of K156-loop140 to LTRs CD Spectroscopy The CD method is widely used to assess the secondary structures of proteins and nucleic acids and to follow the conformational changes occurring mainly through their mutual interaction or binding to various types of organic ligands (Berova et al., 2000; Fasman, 1996). The technique is therefore well suited to the study of complexes of LTRs with peptides, LTRs with inhibitors, peptides with inhibitors and of combinations thereof. In previous reports CD served to demonstrate that the helix content of K156 was slightly increased upon binding to unprocessed LTR34 (Hobaika et al., 2009). Here, the CD spectrum of K156-loop140 taken 142

143 Résultats et Discussion alone displays also noticeable α helix features (two negative components at 225 nm and 205 nm and a positive one at 190nm) (Fig. 1). A rough estimation from the intensity of the 225 nm band provides almost 20% of α helix content, slightly below the α helix content displayed by K156 taken separately (Zargarian et al., 2003). Indeed, in K156-loop140 the loop140 retains most of the unordered conformation observed in crystal structures of IN-CCD and IN-two-domains (Bujacz et al., 1996; Chen et al., 2000; Dyda et al., 1994; Goldgur et al., 1998; Greenwald et al., 1999; Maignan et al., 1998; Wang et al., 2001; Yang et al., 2000). Yet, upon additions of DNA aliquots in the K156-loop140 solution we observed a spectral change-after subtraction of the DNA spectrum-whose intensity varied with the type of LTR used (Fig. 1). Thus, while the unprocessed LTR34 induced an increase of about 15% of the helix content of K156-loop140, the processed LTR32 induced an increase as large as about 45% (Fig. 1), stipulating a more stable complex formation in the latter case. In contrast, neither LTR32-GT nor the blunt-ended LTR30, produced a helix stabilization (not shown), emphasizing the strong contribution of the 5 A -1 pc -2 3 step in the attachment of the loop to the end of processed LTR32 and unprocessed LTR34. Since the loop is better stabilized with processed LTR32, we deduced that the binding of the loop to the 5 A -1 pc -2 3 dinucleotide is greatly facilitated by the depletion of its facing 5 G 2 T 1 3 dinucleotide. The binding of the loop to LTR34 features particular properties at the DNA extremity. The very special nucleotide composition and sequence at the LTR34 extremity cause base pair fraying (partial disruption of base pairs) unusually high, that lowers the energy barrier for the insertion of the loop140 in between base pairs and its accommodation on the 5 A -1 pc -2 3 step (Katz et al., 2011; Scottoline et al., 1997). LTR30, the other blunt ended oligonucleotide, is unable to bind the loop certainly because the nature of its terminal nucleotides does not allow good base pair fraying. Fluorescence anisotropy Titrations recorded by fluorescence anisotropy of unprocessed LTR34 and processed LTR32 with K156-loop140 provided biphasic curves, proving that the peptide binds to two distinct DNA sites (Fig. 2A). For LTR32, we find a value of 18nM for K d1 and 10µM for K d2, corresponding to ΔG -10 Kcal/mol and ΔG -6.5 Kcal/mol, respectively. K d s for LTR34 have higher values, namely, 0.14 µm for K d1 and 45 µm for K d2, corresponding to ΔG -8.5 Kcal/mol and ΔG -5.5 Kcal/mol, respectively (Fig. 2A). In comparison, the titration curves 143

144 Résultats et Discussion of LTR32-GT and LTR30 are monophasic (Fig. 2B). The K d values, are similar to the K d2 value found for LTR32 and LTR34, that is in the 10 micromolar range. This K d (K d2 ) value stands for non-specific interaction. According to K d1 values, K156-loop140 binds with much higher affinity to LTR32 than to LTR34, although both bindings are compatible with formation of a specific complex. Noteworthy, with the smaller peptide K156 (α4 helix) the high affinity complex had been obtained only in the case of unprocessed LTR34 (Hobaika et al., 2009). High affinity for processed LTR32 requires addition of the loop 140 to the α4 helix. All together, our results conclude on the important role of the 5 A -1 C -2 3 dinucleotide at the end of LTRs for the binding of the catalytic loop. In processed LTR its access is markedly facilitated by the depletion of its facing 5'G 2 T 1 3'dinucleotide. However, the dinucleotide 5 A -1 C -2 3 operates also in the binding of the loop to unprocessed LTR34, likely because, as already suggested by CD experiments, a large fraying within the base pairs of the terminal segment 5 A -1 C -2 3 :5'G 2 T 1 3', favours its access. The key role of 5 A -1 C -2 3 in the binding of the loop is emphasized by the inability of the blunt-ended LTR30 and the inverted LTR32-GT (both being deprived of 5 A -1 C -2 3 ) to form a high affinity complex with K156- loop140. In the meantime, worth noting is the narrow correlation between CD results-degree of helix stabilization induced by LTRs in the loop 140-and the fluorescence results-binding affinity of the K156-loop140 for LTRs. Greater is the affinity, larger is the helix stabilization. Both CD and fluorescent results happen to be in perfect agreement with the crystal structure data of the PFV IN in complex with processed LTR (Hare et al., 2010). Binding of TB11 and RAL to K156-loop140 and K156 Ability of TB11 and inability of RAL to interact with K156-loop140 and K156 CD studies The first evidence of an interaction of TB11 with IN catalytic site is provided by CD. K156 and K156-loop140 display CD spectra with two negative signals at about 222 and 208 nm and a positive one at about 190 nm, characteristic of peptides containing a fair amount of α helix. Upon addition of TB11 (20 µm) to K156 (20 µm), a slight increase of the helical content of the latter is produced (Fig. 3A). Results indicate that TB11 added to K156-loop

145 Résultats et Discussion maintained at a fixed concentration of 20 µm also produced an increase of the helical content (Fig. 3B). This increase did not differ too much from that observed with the shorter K156 lacking the loop 140, but proved an interaction of the drug with the peptide likely on the α4 helix moiety. In comparison the CD spectra of both K156-loop140 and K156 were not modify by RAL (not shown), suggesting a total inability of the drug to form complexes with these two peptides. The result is in line with other studies showing a total inability of RAL to interact with IN and IN-CCD taken alone (Espeseth et al., 2000; Fitzkee et al., 2010). Fluorescence studies The TB11 drug is mostly an INSTI but is also a weak 3'P inhibitor (Marchand et al., 2003). In a previous fluorescence study, we have shown that TB11 binds to K156. The affinity of TB11 for the K156 peptide is 7.75µM (Hobaika et al., 2010). Here, fluorescence anisotropy was used for monitoring the complexation of K156-loop140 and K156 peptides with TB11 and RAL. The fluorescence titration curves reported in Fig. 4 show that TB11 efficiently binds to K156- loop140 while RAL fails to interact with both peptides (not shown). A quantitative determination for the binding of TB11 to K156-loop140 provides a K d of 6.4 µm (Fig. 4), similar to the K d value of the binding of TB11 to the K156 peptide, suggesting that TB11 binds to the α4 helix rather than the loop 140. All together, CD experiments and fluorescence studies revealed that RAL and TB11 have a completely different behavior toward the α4 helix-loop140 domain of IN. The binding of TB11 to K156 reminds the binding of 5CITEP to IN-CCD taken alone. The co-crystal reveals six intermolecular interactions, among which five occur between the drug and the α4 helix, in the proximity of the active site (Goldgur et al., 1999). However, this is not a general rule for the IN inhibitors: Some DKA have been shown to only bind to IN after the enzyme has bound target DNA (Espeseth et al., 2000). Our results also suggest that the higher ability of TB11 to inhibit 3 P could result from its interaction with the enzyme active site, and consecutively, the hindrance of the DNA recognition. 145

146 Résultats et Discussion Binding of TB11 and RAL to LTR ends Fluorescence studies. Evidence for selective and stoichiometric binding of IN inibitors to 3 processed LTR DNA ends was provided by fluorescence studies using fluorescein-labeled olignucleotides mimicking unprocessed or processed LTR DNA ends (LTR34 and LTR32, respectively) together with two control oligonucleotides (LTR32-GT and LTR30). LTR32- GT carries an expanded 5 GT3 dinucleotide instead of the 3 CA5 dinucleotide found in LTR32, while LTR30 is a blunt ended LTR lacking 5 GT3 /3 CA5 (see Material and Methods). Two sorts of fluorescence studies were performed: one is based on the shift and intensity changes of the emission signal and the other on anisotropy change (Lakowicz et al., 1999; Rossi & Taylor, 2011). The binding of RAL to the four viral DNAs, LTR34, LTR32, LTR32-GT and LTR30 was previously studied in fluorescence anisotropy titration experiments in phosphate buffer, ph 6, 5 C (Ammar et al., 2012). Briefly, results show that one molecule of RAL binds tightly to 3 -processed LTR (Kd 6nM) and more weakly to unprocessed LTR (Kd 20nM). In each case the fluorescence anisotropy increased from 0.13 up to almost in describing a monophasic curve in the nanomolar range. Importantly, no further anisotropy variation was observed at higher RAL concentrations. Titration experiments in fluorescence anisotropy of LTR32-GT, that contains a 5 GT3 overhang (3 extremity) instead of a 5 AC3 overhang (5 extre mity), and the bluntended LTR 30, that lacks the dinucleotide base pairs 5 GT3 :5 AC3 and is devoid or has only little ST activity (Bushman & Craigie, 1992; Dicker et al., 2007; Leavitt et al., 1992; Sherman et al., 1992) do not show any signal variation at low and high drug concentrations, stipulating the absence of drug binding with these two oligonucleotides. We deduced that the 5 GT 3 deletion facilitates the interaction of the drug at the LTR end, while the binding to unprocessed DNA could be due to the important end fraying (Scottoline et al., 1997) that decrease the energy barrier for the insertion of the drug in between the two terminal dinucleotide strands. We also deduced that the binding of RAL to viral DNA needs the 5 ApC3 dinucleotide at the end of the non-transferred strand but can do without IN. Results showed that a single RAL molecule was bound to LTR32 (1:1 stoichiometry), in agreement with the crystal structure results (Hare et al., 2010). Overall, these findings indicate that: 1) LTR can be the primary target of RAL. 2) The presence of IN is not required to observe a 146

147 Résultats et Discussion tight binding of the drug. 3) The binding of the drug to LTR can be initiated before the 3 processing has taken place (Ammar et al., 2012). Binding of TB11 to unprocessed LTR34, processed LTR32 and LTR30 oligonucleotides was also analyzed by spectroscopy. Fluorescence anisotropy titration of both LTR34 and LTR32 provided biphasic curves. In each case the fluorescence anisotropy increased from 0.13 up to almost in the case of LTR32 and 0.14 in the case of LTR34. The fitting of the isotherm by a non-linear least squares procedure provided an average K d of about 0.06µM for LTR32 and 0.3µM for LTR34 consistent with a specific binding of TB11 to processed (and unprocessed) viral LTR end. Importantly, at 10 µm concentration of TB11, anisotropy manifests a strong increase providing approximate K d s of 0.4 mm, 0.1 mm and 0.25 mm for the binding of TB11 to LTR34 and LTR32 (Fig. 5), LTR 30 (not shown), respectively. Such high K d s are somewhat surprising but we shall see later that they are consistent with an intercalation of TB11 into the DNA base-pairs. The binding pattern of TB11 with LTR34 differed from that with LTR32. The anisotropy variation was now smaller (0.01 vs 0.015) and the Kd was almost a log higher (0.3µM vs 0.06µM), showing that the binding of TB11 to unprocessed LTR34 is still possible, although weaker than the one to processed LTR32. This result is similar to what was observed in the case of RAL [53]. We deduced that the 5 GT 3 deletion facilitates the interaction of the drug at the LTR end, while the binding to unprocessed DNA could be due to the important end fraying that decrease the energy barrier for the insertion of the drug in between the two terminal dinucleotide strands. The LTR-TB11 interaction was further assessed by reverse experiments in which the small ligand TB11 is titrated by LTRs using the fluorescence emission signal intensity of the inhibitor. In that case we found K d s of 2 µm (Fig. 6C) and 0.1 µm (Fig. 6B) for the binding of TB11 to LTR34 and LTR32, respectively, (no significant change in the fluorescence intensity of TB11 with LTR30) showing that TB11 has two different binding sites on LTRs (Fig. 6). In comparison, in reverse experiments with RAL at 20µM concentration and LTR32 and LTR34 as titrants we determined K d values of 5 nm and 23nM, respectively. In that case the K d values are in the range of Kd values provided by anisotropy. 147

148 Résultats et Discussion All together, our results demonstrate that TB11 similarly to RAL interacts with the free LTR ends, either processed or unprocessed, although with a much lower affinity compared with RAL (K d s for processed LTR are about 100 nm for TB11 and below 10 nm for RAL). Remarkably, the K d for binding of TB11 to LTR32 determined by reverse experiment is similar the in vitro IC50 of 0.3 µm and 0.07 µm for inhibition of wild type IN by TB11, in the presence of Mg 2+ and Mn 2+, respectively (Marchand et al., 2003). As for TB11, K d for binding of RAL to LTR32 is similar to the in vitro IC50 values (2-7nM) for inhibition of wild type IN suggesting a functional relationship between drug binding to DNA and ST inhibition. Docking calculations. The binding free energies predicted by Autodock mentioned in this work reflect only the relative binding tendencies of the two ligands. An empirical scoring function like Autodock is unable to successfully discriminate between the binding energy of TB11 and that of RAL which present too small differences in their binding energies to provide a reasonable ranking of the two drugs. Actually, Autodock is a generalized treatment and does not determine accurately the local differences within the bind ing site. The desolvation term is calculated only for aliphatic and aromatic carbon atoms, regardless of their environment, and the van der Waals and hydrogen bond interactions crucial to discriminate between the binding energies of ligands are underestimated (Buzko et al., 2002). Nevertheless, the binding free energies predicted by Autodock reflect a favourable interaction for RAL and TB11 with processed viral DNA. For the best poses, the binding free energies are and for RAL and TB11, respectively. Based on the uncertainty error of the Autodock scoring function (2.5 kcal/mol), these correspond to similar binding affinities, which is not the case for experimental affinities. However, we see here that both drugs establish strong interactions with the Mg 2+ cation (Fig. 7). Regarding RAL, it further stacks with the conserved CpA cytosine via its halogenated phenyl ring and with the purine of the 3 terminal A via its pyrimidine ring. This binding pattern is maintained in all the efficient INSTIs so far examined (Hare et al., 2010). In most of the other predicted poses the π- stacking between the halogenated phenyl ring of RAL and the purine of CpA cytosine is conserved (Fig. 7). In comparison, TB11 samples different orientations and interchanges the π-stacking with the purine of A and the pyrimidine of C in CpA. Globally, TB11 is endowed with more freedom than RAL at the end of processed viral DNA. 148

149 Résultats et Discussion Binding of RAL and TB11 to the K156-loop140 complex Fluorescence anisotropy. The anisotropy titration profiles provided by the binding of RAL and TB11 to K156-loop140-LTR32 complex show that RAL binds to the complex to form a ternary complex. The K d of binding of RAL to the complex is close to that previously reported for the binding of RAL to the intasome (36nM vs 19nM). TB11 also forms a ternary complex by binding to pre-formed DNA-peptide complex (K d(intasome) =0.1µM vs K d(ltr32) =0.06µM) (Fig. 6 and 8). Therefore, both TB11 and RAL interact with the binary complex of K156-loop140 with processed LTR while, only TB11 is able to bind to free IN or peptide fragments, K156 and K156-loop140, derived from the IN active site (Fig. 3 and 4) Observation of similar K d values for the binding of RAL to LTRs and to IN-LTR complexes, implicates that the LTR end holds the main role in the capture of RAL. Yet, in the crystal structure of the ternary complex IN-LTR-RAL, RAL shares interactions with both the DNA and IN (and also to Mg 2+ ) (Hare et al., 2010). To obtain similar K d s for binding of RAL to free LTR and to intasome implies that several interactions stabilizing the RAL-DNA binary complex are now replaced by interactions of same energy stabilizing the RAL-DNA-IN ternary complex. Plausibly, that the number of interactions is equal to those formed during the binding to DNA alone, then during the ternary complex formation some of these interactions are defeated to be recreated between RAL and DNA. TB11 intercalation into DNA base pairs Gel electrophoretic retardation and topoisomerase I relaxation assays. Above results emphasized a clear difference of behavior between TB11 and RAL. TB11 interacts with a much lower affinity than RAL to the free DNA and to the complex peptide-dna. But, unlike RAL, TB11 is able to bind with the peptide alone and shows a highly populated second binding site on DNA. To find the origin of this binding site we applied gel electrophoretic retardation and topoisomerase I relaxation assays, two techniques well suited for the study of drug interactions with DNA (Mergny et al., 1991; Mewshaw et al., 1999; Webb & Ebeler, 2003). Results confirmed the fluorescence data in showing that only TB11 has the ability to retard the pbr322 plasmid DNA migration on gel electrophoretic retardation experiments (Fig. 9), a property that is generally correlated to intercalation of drugs into DNA base pairs (Hawtin et al., 2010; Mattes et al, 1993). The DNA mobility decreases proportionally to the 149

150 Résultats et Discussion number of drug molecules attached to the DNA (Fig. 9A). The binding of TB11 coincides with a dramatic reduction in fluorescence intensity of BET, suggesting that TB11 moves BET from its intercalating site and is also a good intercalator. Intercalation is achieved at a drug / DNA molar ratio of 300, the higher TB11 concentration being 30µM. The drug intercalation is weakly cooperative and rather presents some distributive character. In the case of nonretarded and fully-retarded interconverting species we would not have observed a gradual decrease of the DNA bulk mobility (Wadsworth & White, 2001). In comparison, RAL does not exert any gel retardation effect, in agreement with the fluorescence anisotropy experiments who did not detect any second binding site on LTRs for this compound (Fig. 9B). Topoisomerase I relaxation data also stipulate the unwinding of closed circular DNA by TB11 in response to its intercalation into base pairs (Kroll et al., 1993; Sourgen et al., 1996). This elegant method was initially used to prove the intercalation of BET into base pairs and also the binding of histones to DNA (Lee & Morgan, 1978). The incubation of circular DNA with topoisomerase I and unwinding ligands (intercalating drugs or proteins) yields DNAs of different superhelix density. In fact the torsional strain introduced by intercalation evolves in progressive unwinding of the DNA. The event can be demonstrated, first, in completely relaxing the BET treated DNA with an excess of topoisomerase I (Fig. 10A, lanes 3-5). Topoisomerase I removes all the supercoils in each DNA molecule, whatever the degree of unwinding present. Extraction of BET reintroduces supercoiling in DNA, indirect proportion to the unwinding initially produced, while the control DNA, which has not been exposed to the unwinding agent, remains completely relaxed (Fig. 10A, lane 2). Thus, the DNA unwinding induced by intercalating drugs is demonstrated by an increased supercoiling of final products. As described in Materials and Methods, selected amounts of BET, TB11 and RAL were incubated with the plasmid, before being subjected to complete relaxation by topoisomerase I. Separation of the reaction products was resolved by agarose gel electrophoresis (Fig. 10). Lanes 1 and 2 of Fig. 10A showed that topoisomerase I relaxes completely the plasmid in the absence of BET or drug. Addition of BET at 10 µg/ml to the medium produced a complete supercoiling of DNA (Fig. 10, lane 5). TB11 produced a similar effect at 3 µm (drug:dna molar ratio 300:1) (Fig. 10A, lane 7) At the same time, RAL was completely unable to unwind the plasmid, even at the high concentrations (Fig. 150

151 Résultats et Discussion 10B, lanes 3-5). Above results definitely prove the intercalation of TB11 into DNA base pairs, a property that RAL does not own. DISCUSSION Both RAL and TB11 are DKA derivatives acting on HIV-1 replication in inhibiting efficiently the ST activity of IN. RAL has recently joined the group of drugs used in highly active antiretroviral treatment (HAART) (Grinsztejn et al., 2007; Summa et al., 2008), while TB11 has been abandoned for its low bioavailabity and high toxicity. We have explored the role of viral DNA as a privileged target of the INSTIs and have sought to determine the molecular basis for the different behavior of TB11 and RAL. Despite their important structural difference, these two compounds are housed in the same way within the pocket left open by 3 P at the viral DNA end. According to our fluorescence and docking experiments a single molecule is inserted into the cavity and engages the pair of divalent metal ions with its metal binding motif. We suggest that the viral DNA end is a primary target for binding of DKA molecules. The accomodation of the inhibitors in the pocket depends on their global size. The binding affinity for DNA depends obviously on the inhibitor functional groups and relies to a large extent on the recognition of the highly conserved CpA /TpG base-pairs. The involvement of these base pairs into the recognition event is certainly not fortuitous. Their extreme malleability confers particular properties to the DNA double helix, including severe bending and kinking, large distortions and striking motions in the backbone (DiGabriele et al., 1989; El Hassan & Calladine, 1998; Lee & Harshey, 2001; Neugebauerova & Kypr, 2000). Likely due to these properties the CpA/TpG base-pairs are often found in protein binding sites and can facilitate the DNA cleavage of connected residues as it is the case in DNAs of retroviruses, transposable phage Mu and other transposable elements (Hobaika et al., 2010; Kim et al., 1993; Lee & Harshey, 2001; Renisio et al., 2005).The CpA/TpG basepairs are also specific sites for intercalation of the antitumor drug nogalamycin. Together, the participation of the CpA/TpG base-pairs in the binding of INSTIs at the viral DNA end is not so surprising especially as their access is facilitated by the 3 P. By chance this faculty coincids with the key importance of CpA at the termini of viral DNA. Thus, RAL, apart its binding to the divalent metal ions, also interacts with the adenine phosphate and the cytosine base of CpA, as well as the guanine of TpG. In the best calculated pose, the smaller TB11 151

152 Résultats et Discussion molecule adopts two conformations with one of them sharing interactions with the adenine of CpA and the other with the guanine of the paired TpG. Assuming that there exists a functional correlation between the binding and the ST inhibition events, the similarity between the Kd values for binding of inhibitors to processed viral DNA (10 nm and 0.1 µm, for RAL and TB11, respectively) and the IC50 values for inhibition of strand transfer (2-7 nm and nm, for RAL and TB11, respectively), suggests that a direct binding of inhibitors to viral DNA is essential to the formation of stable ternary complexes with the intasome. This minimizes the impact of the protein in stabilizing the complex, allowing us to better understand the absence or undetectable binding of RAL to the IN CCD alone in recent NMR experiments (Fitzkee et al., 2010) while NMR is yet a technique well suited even to the study of weak energy bindings. Similarly, L-731,988 a standard DKA binds IN taken alone with a very low affinity (the K d is as high as µm) while the affinity for the processed DNA-enzyme complex is approximately 1,000-fold higher (Espeseth et al., 2000). Such findings led authors to propose that the emergence of an inhibitor binding site on the enzyme results from a conformational change occurring during the intasome formation (Espeseth et al., 2000). In view of the recent crystallographic data on the PFV full length IN (Hare et al., 2010; Hare et al., 2010) and those previously gathered on the CCD (Bujacz et al., 1996; Dyda et al., 1994; Goldgur et al., 1999; Goldgur et al., 1998; Greenwald et al., 1999; Maignan et al., 1998), the CCD-CTD (C-terminal domain) construct (Chen et al., 2000) and the NTD (N-terminal domain)-ccd construct (Wang et al., 2001), the role of a new IN conformation induced by DNA, more likely to interact with the inhibitor, seems not to be retained. Comparison of crystals does not allow to deduce a significant conformational change in the protein at the DNA contact, especially in the inhibitor binding area. As specified above important contacts occur between the inhibitor and the DNA. Contacts between the inhibitor and the protein can be also detected both in the crystal and the docking structures showing that the protein also participates to the binding of the inhibitor in the intasome. However, their binding efficiencies must be weak considering the similarity between the K d for binding to DNA and the IC50 for ST inhibition, for both TB11 and RAL. Possibly, in going from the ternary IN-DNA-inhibitor complex to the binary DNA-inhibitor complex, there is a loss of interactions with the protein that are compensated by new interactions with the DNA. 152

153 Résultats et Discussion Apart the important difference between the binding energies of RAL and TB11 to processed LTR ends, difference which is sufficient to explain the difference of efficiency between the two inhibitors, there is also the fact that TB11 further bind to free IN or peptide fragments, K156 and K156-loop140, derived from the IN active site and intercalates into DNA base pairs while RAL does not. Evidence for interacalation is provided by fluorescence and plasmid unwinding assays. The aromatic ring or perhaps the diketo chromophore of the TB11 molecule can become stabilized by polarization forces and van der Waals interactions in between adjacent base pairs. The maximum number of molecules which is able to intercalate into the DNA double helix is, according to the nearest-neighbor exclusion principle, one for every three base-pairs, which is rather consistent with the change of fluorescence anisotropy displayed by LTR34 (17 base-pairs) and LTR32 (15 base-pairs). The titration isotherm leads to a K d for binding of TB11 to LTR34 of nearly 0.4 mm (Fig. 5) that agrees well with the TB11 concentration necessary to produce the unwinding of a supercoiled DNA plasmid in gel migration assays (Fig. 10). Intercalation of antitumor drugs, such as doxorubicin and mixanthrone, also occurs in the micromolar range. The main criticism that is done to these drugs is their high toxicity often related to their ability to intercalate anywhere into the double helix and interfere with the activity of not only topoisomerases but also with that of several key enzymes in the DNA cortege. We suggest that the toxicity demonstrated by TB11 is caused by its non-specific intercalation into DNA base-pairs and by the possible recruitment of TB11 by other proteins than IN which could contribute to its weak bioavailability. CONCLUSION Our data specify that the viral DNA could be a direct binding target for DKAs and derivatives. The main point is that the drug can bind to LTR ends, before the 3 P has taken place, but the magnitude of the inhibition on this 3 P reaction depends on the type of drug tested. Addition of IN to the complex does not lead to a better affinity. Yet, the 3 P produces a neat increase of the drug affinity for the LTR ends. The conserved flexible 5 CpA3 step located at the end of the transferred strand, crucial for the specific recognition of viral DNA by IN, is extensively implicated in π-stacking interactions with the inhibitors, as already shown in crystal structures. The 5 AC3 overhang on the non-transferred strand, bound to the protein in the crystal structure, interacts with the drugs in our experiments. There is a clear correlation between the binding affinity of the drug for the 3 processed LTR and the 153

154 Résultats et Discussion inhibition of viral infection. RAL which is a much better binder than TB11 to 3 processed LTR is also a much better inhibitor of infection compared with TB11. It can be also considered as a much specific inhibitor than TB11 because it is fixed only to the ends of viral DNA which is not the case of TB11, which also binds to IN and intercalates a great number of molecules in DNA base pairs. These TB11 features may be the basis of its low bioavailability and higher toxicity. Our results also plead on the search of new inhibitors sharing more stabilizing interactions with the ends of viral DNA than with IN, to diminish the drug resistance due to mutations produced by contacts with IN. 154

155 Résultats et Discussion FIGURES AND TABLES Compound Structure Reaction In vitro IC50 (µm) Antiviral References 5CITEP ST 3'P 3'P/ST No (Goldgur et al., 1999; Marchand et al., 2003) TB11 ST 3'P 3'P/ST /> Yes but bad bioavailibility (Marchand et al., 2003) RAL ST 3'P 3'P/ST FDA appoved Oct.2007 (Metifiot et al., 2010; Metifiot et al., 2011) Table 1. Improvement of the DKA inhibition and antiviral efficiency since the discovery of 5CITEP to RAL: Structures, in vitro IC50 and antiviral efficiency of 5CITEP, TB11 and RAL. 155

156 Résultats et Discussion Figure 1. CD study of unbound and bound K156-loop140. Spectrum of K156-loop140 at 5µM (Black line); difference spectra [K156-loop140 (5µM) +LTR34(10µM)]-LTR34 at 10µM (Red line) and [K156-loop140 (5µM)+LTR32(10µM)]-LTR32 at 10µM (blue line). Samples were in phosphate buffer ph 6, 10mM, at 10 C. 156

157 Résultats et Discussion A B Figure 2. Fluorescence anisotropy titration of (A) LTR34 by peptide K156-loop140 (Black line) and LTR32 by peptide K156-loop140 (Red line); (B) LTR30 by peptide K156-loop140 (Blue line) and LTR32-GT by peptide K156-loop140 (Green line). Samples were in Phosphate buffer ph 6, 10mM, at 5 C. Only the titration curves of LTR34 and LTR32 are biphasic. 157

158 Résultats et Discussion A B Figure 3. CD of unbound and bound K156 and K156-loop140 peptides. (A) Spectra of K156 at 20µM (Black line) and K156 + TB11 at 20 µm each (Red line); (B) Spectra of K156-loop140 at 20µM (Black line) and K156-loop140 + TB11 at 20 µm each (Red line) in phosphate buffer ph 6, 10mM, at 10 C. 158

159 Résultats et Discussion A B Figure 4. Quenching fluorescence analysis of the binding of TB11 to K156-loop140 using the TB11 as the fluorophore. (A) Spectra of unbound TB11 and bound TB11 as a function of added K156-loop140; (B) Derived binding curve showing calculated K d. Phosphate buffer ph 6, 10mM, at 5 C. 159

160 Résultats et Discussion Figure 5. Fluorescence anisotropy titration of LTR34 (Black line) and LTR32 (Red line) by TB11 in Phosphate buffer ph 6, 10mM, at 5 C. 160

161 Résultats et Discussion A B C 161

162 Résultats et Discussion Figure 6. Quenching fluorescence analysis of the binding of TB11 to LTR34 and LTR32 using the TB11 as the fluorophore. (A) Spectra of unbound TB11 and bound TB11 as a function of added LTR; (B) Derived binding curve showing calculated Kd for LTR32; (C) Derived binding curve showing calculated Kd for LTR34. Phosphate buffer ph 6, 10mM, at 5 C. Figure 7. Represents the best poses predicted for RAL and TB11 by Autodock. The drugs are represented in sticks while the surrounding interacted base pairs are in ellipsoid and Mg+2 ions are in magenta spheres. 162

163 Résultats et Discussion Figure 8. Fluorescence anisotropy titration of LTR32-K156-loop140 complex by RAL (Black line) and TB11 (Red line) in Phosphate buffer ph 6, 10mM, at 5 C. Green and blue dots represent free LTR32 and LTR32-K156loop140, respectively. Figure 9. Agarose gel electrophoretic analysis of pbr322 plasmid DNA binding by TB11 and RAL. Binding was assessed as described in Materials and Methods. Saturation of DNA with bound molecules coincided with strongly reduced ethidium bromide fluorescence, suggesting that intercalation sites for ethidium bromide are occluded by the bound TB11. Lane 1, 250 ng pbr322; lanes 2-4, 250 ng pbr322 and 3, 15 and 30 µm of TB11, respectively; B-lane1, 250 ng pbr322; lanes 2-3, 250 ng pbr322 and 150 and 300µM of RAL, respectively. 163

164 Résultats et Discussion Figure 10. Detection of pbr322 plasmid DNA unwinding due to the binding of TB11 and RAL. The direct effect of TB11 and RAL on DNA unwinding is assessed relative to the known effect of ethidium bromide (Kroll et al., 1993 and Sourgen et al., 1996). As described in Materials and Methods, the indicated amounts of ethidium bromide, TB11 and RAL were incubated with 250 ng pbr322 and then subjected to relaxation by topo I. A- Lane 1, 250 ng pbr322; lane 2, 250 ng pbr322 and 2.5 U topo I; lanes 3-5, 250 ng pbr322, 2.5 U topo I and 0,1, 1 and 10 µg/ml ethidium bromide, respectively; lanes 6-8, 250 ng pbr322, 2.5 U topo I and 1, 3 and 15 µm TB11, respectively. B- Lane 1, 250 ng pbr322; lane 2, 250 ng pbr322 and 2.5 U topo I; lanes 3-5, 250 ng pbr322, 2.5 U topo I and 50, 150 and 300 µm RAL, respectively. 164

165 Résultats et Discussion REFERENCE LIST 1. LaFemina, R.L., P.L. Callahan, and M.G. Cordingley, Substrate specificity of recombinant human immunodeficiency virus integrase protein. J Virol, (10): p Bushman, F.D., T. Fujiwara, and R. Craigie, Retroviral DNA integration directed by HIV integration protein in vitro. Science, (4976): p Engelman, A., K. Mizuuchi, and R. Craigie, HIV-1 DNA integration: mechanism of viral DNA cleavage and DNA strand transfer. Cell, (6): p Asante-Appiah, E. and A.M. Skalka, HIV-1 integrase: structural organization, conformational changes, and catalysis. Adv Virus Res, : p Brown, P.O., Integration Esposito, D. and R. Craigie, HIV integrase structure and function. Adv Virus Res, : p Sherman, M.P. and W.C. Greene, Slipping through the door: HIV entry into the nucleus. Microbes Infect, (1): p Miller, M.D., C.M. Farnet, and F.D. Bushman, Human immunodeficiency virus type 1 preintegration complexes: studies of organization and composition. J Virol, (7): p Bukrinsky, M.I., et al., Association of integrase, matrix, and reverse transcriptase antigens of human immunodeficiency virus type 1 with viral nucleic acids following acute infection. Proc Natl Acad Sci U S A, (13): p Ellison, V. and P.O. Brown, A stable complex between integrase and viral DNA ends mediates human immunodeficiency virus integration in vitro. Proc Natl Acad Sci U S A, (15): p Katzman, M., et al., The avian retroviral integration protein cleaves the terminal sequences of linear viral DNA at the in vivo sites of integration. J Virol, (12): p Katz, R.A., et al., The avian retroviral IN protein is both necessary and sufficient for integrative recombination in vitro. Cell, (1): p Craigie, R., T. Fujiwara, and F. Bushman, The IN protein of Moloney murine leukemia virus processes the viral DNA ends and accomplishes their integration in vitro. Cell, (4): p Engelman, A. and R. Craigie, Identification of conserved amino acid residues critical for human immunodeficiency virus type 1 integrase function in vitro. J Virol, (11): p Kulkosky, J., et al., Residues critical for retroviral integrative recombination in a region that is highly conserved among retroviral/retrotransposon integrases and bacterial insertion sequence transposases. Mol Cell Biol, (5): p Ruiz, L., et al., Structured treatment interruption in chronically HIV-1 infected patients after long-term viral suppression. AIDS, (4): p Chen, R.Y., et al., Immunologic and virologic consequences of temporary antiretroviral treatment interruption in clinical practice. AIDS Res Hum Retroviruses, (13): p Blankson, J.N., D. Persaud, and R.F. Siliciano, The challenge of viral reservoirs in HIV-1 infection. Annu Rev Med, : p Noe, A., J. Plum, and C. Verhofstede, The latent HIV-1 reservoir in patients undergoing HAART: an archive of pre-haart drug resistance. J Antimicrob Chemother, (4): p

166 Résultats et Discussion 20. Finzi, D., et al., Identification of a reservoir for HIV-1 in patients on highly active antiretroviral therapy. Science, (5341): p Hansen, M.S., et al., Retroviral cdna integration: mechanism, applications and inhibition. Genet Eng (N Y), : p Debyser, Z., et al., In search of authentic inhibitors of HIV-1 integration. Antivir Chem Chemother, (1): p Hazuda, D.J., et al., Inhibitors of strand transfer that prevent integration and inhibit HIV-1 replication in cells. Science, (5453): p Summa, V., et al., Discovery of alpha,gamma-diketo acids as potent selective and reversible inhibitors of hepatitis C virus NS5b RNA-dependent RNA polymerase. J Med Chem, (1): p Rowley, M., The discovery of raltegravir, an integrase inhibitor for the treatment of HIV infection. Prog Med Chem, : p Summa, V., et al., Discovery of raltegravir, a potent, selective orally bioavailable HIVintegrase inhibitor for the treatment of HIV-AIDS infection. J Med Chem, (18): p Grinsztejn, B., et al., Safety and efficacy of the HIV-1 integrase inhibitor raltegravir (MK- 0518) in treatment-experienced patients with multidrug-resistant virus: a phase II randomised controlled trial. Lancet, (9569): p Nguyen, B.Y., et al., Raltegravir: the first HIV-1 integrase strand transfer inhibitor in the HIV armamentarium. Ann N Y Acad Sci, : p Wills, T. and V. Vega, Elvitegravir: a once-daily inhibitor of HIV-1 integrase. Expert Opin Investig Drugs, (3): p Serrao, E., et al., Raltegravir, elvitegravir, and metoogravir: the birth of "me-too" HIV-1 integrase inhibitors. Retrovirology, : p Katlama, C. and R. Murphy, Dolutegravir for the treatment of HIV. Expert Opin Investig Drugs, (4): p Vandekerckhove, L., GSK , a novel integrase inhibitor for the treatment of HIV infection. Curr Opin Investig Drugs, (2): p McColl, D.J. and X. Chen, Strand transfer inhibitors of HIV-1 integrase: bringing IN a new era of antiretroviral therapy. Antiviral Res, (1): p Marchand, C., et al., HIV-1 IN inhibitors: 2010 update and perspectives. Curr Top Med Chem, (11): p Espeseth, A.S., et al., HIV-1 integrase inhibitors that compete with the target DNA substrate define a unique strand transfer conformation for integrase. Proc Natl Acad Sci U S A, (21): p Grobler, J.A., et al., Diketo acid inhibitor mechanism and HIV-1 integrase: implications for metal binding in the active site of phosphotransferase enzymes. Proc Natl Acad Sci U S A, (10): p Marchand, C., et al., Metal-dependent inhibition of HIV-1 integrase by beta-diketo acids and resistance of the soluble double-mutant (F185K/C280S). Mol Pharmacol, (3): p Pais, G.C., et al., Structure activity of 3-aryl-1,3-diketo-containing compounds as HIV-1 integrase inhibitors. J Med Chem, (15): p Goldgur, Y., et al., Structure of the HIV-1 integrase catalytic domain complexed with an inhibitor: a platform for antiviral drug design. Proc Natl Acad Sci U S A, (23): p Vajragupta, O. and P. Boonchoong, New Leads of HIV-1 Integrase Inhibitors. Mahidol University Journal of Pharmaceutical Science (3-4): p

167 Résultats et Discussion 41. Chen, X., et al., Modeling, analysis, and validation of a novel HIV integrase structure provide insights into the binding modes of potent integrase inhibitors. J Mol Biol, (3): p Karki, R.G., et al., Model of full-length HIV-1 integrase complexed with viral DNA as template for anti-hiv drug design. J Comput Aided Mol Des, (12): p Savarino, A., In-Silico docking of HIV-1 integrase inhibitors reveals a novel drug type acting on an enzyme/dna reaction intermediate. Retrovirology, : p Barreca, M.L., et al., Induced-fit docking approach provides insight into the binding mode and mechanism of action of HIV-1 integrase inhibitors. ChemMedChem, (9): p Ferro, S., et al., Docking studies on a new human immunodeficiency virus integrase-mg-dna complex: phenyl ring exploration and synthesis of 1H-benzylindole derivatives through fluorine substitutions. J Med Chem, (2): p Hare, S., et al., Retroviral intasome assembly and inhibition of DNA strand transfer. Nature, (7286): p Hare, S., et al., Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance. Proc Natl Acad Sci U S A, (46): p Hare, S., et al., Structural and functional analyses of the second-generation integrase strand transfer inhibitor dolutegravir (S/GSK ). Mol Pharmacol, (4): p Metifiot, M., et al., MK-0536 inhibits HIV-1 integrases resistant to raltegravir. Antimicrob Agents Chemother, (11): p Metifiot, M., et al., Activities, crystal structures, and molecular dynamics of dihydro-1hisoindole derivatives, inhibitors of HIV-1 integrase. ACS Chem Biol, (1): p Zhang, X., et al., Azido-containing aryl beta-diketo acid HIV-1 integrase inhibitors. Bioorg Med Chem Lett, (6): p Svarovskaia, E.S., et al., Azido-containing diketo acid derivatives inhibit human immunodeficiency virus type 1 integrase in vivo and influence the frequency of deletions at two-long-terminal-repeat-circle junctions. J Virol, (7): p Ammar, F.F., et al., Unprocessed viral DNA could be the primary target of the HIV-1 integrase inhibitor raltegravir. PLoS One, (7): p. e Langley, D.R., et al., The terminal (catalytic) adenosine of the HIV LTR controls the kinetics of binding and dissociation of HIV integrase strand transfer inhibitors. Biochemistry, (51): p Hobaika, Z., et al., Specificity of LTR DNA recognition by a peptide mimicking the HIV-1 integrase {alpha}4 helix. Nucleic Acids Res, (22): p Zargarian, L., et al., Strategy to discriminate between high and low affinity bindings of human immunodeficiency virus, type 1 integrase to viral DNA. J Biol Chem, (22): p Zhong, L. and W.C. Johnson, Jr., Environment affects amino acid preference for secondary structure. Proc Natl Acad Sci U S A, (10): p Lerman, L.S., Structural considerations in the interaction of DNA and acridines. J Mol Biol, : p Dedon, P.C., Determination of binding mode: intercalation. Curr Protoc Nucleic Acid Chem, Chapter 8: p. Unit Hurley, L.H., DNA and its associated processes as targets for cancer therapy. Nat Rev Cancer, (3): p Wadsworth, R.I. and M.F. White, Identification and properties of the crenarchaeal singlestranded DNA binding protein from Sulfolobus solfataricus. Nucleic Acids Res, (4): p

168 Résultats et Discussion 62. Waring, M.J., Drugs and DNA: uncoiling of the DNA double helix as evidence of intercalation. Humangenetik, (3): p Kroll, D.J., et al., Modification of DNA topoisomerase II activity via direct interactions with the cyclic adenosine-3',5'-monophosphate response element-binding protein and related transcription factors. Mol Endocrinol, (3): p Sourgen, F., et al., A synthetic peptide from the human immunodeficiency virus type-1 integrase exhibits coiled-coil properties and interferes with the in vitro integration activity of the enzyme. Correlated biochemical and spectroscopic results. Eur J Biochem, (3): p Morris, G.M., et al., AutoDock4 and AutoDockTools4: Automated docking with selective receptor flexibility. J Comput Chem, (16): p Dennington, R., T. Keith, and J. Millam, GaussView Version p. Semichem Inc. Shawnee Mission KS. 67. Wang, J., et al., Automatic atom type and bond type perception in molecular mechanical calculations. J Mol Graph Model, (2): p Roothaan, C.C.J., New Developments in Molecular Orbital Theory.. Rev. Mod. Phys., : p Rassolov, V.A., et al., 6-31G* Basis Set for Third-Row Atoms. J. Comput. Chem., : p Pandey, K.K., et al., Physical trapping of HIV-1 synaptic complex by different structural classes of integrase strand transfer inhibitors. Biochemistry, (38): p Koelsch, K.K. and D.A. Cooper, Integrase inhibitors in salvage therapy regimens for HIV-1 infection. Curr Opin HIV AIDS, (6): p Markowitz, M., et al., Antiretroviral activity, pharmacokinetics, and tolerability of MK-0518, a novel inhibitor of HIV-1 integrase, dosed as monotherapy for 10 days in treatment-naive HIV- 1-infected individuals. J Acquir Immune Defic Syndr, (5): p Fasman, G.D., Circular Dichroism and the Conformational Analysis of Biomolecules, ed. P. Press. 1996, New York. 74. Berova, N., K. Nakanishi, and R. Woody, Circular dichroism : principles and applications, 2nd ed., ed. Wiley Bujacz, G., et al., The catalytic domain of human immunodeficiency virus integrase: ordered active site in the F185H mutant. FEBS Lett, (2-3): p Dyda, F., et al., Crystal structure of the catalytic domain of HIV-1 integrase: similarity to other polynucleotidyl transferases. Science, (5193): p Goldgur, Y., et al., Three new structures of the core domain of HIV-1 integrase: an active site that binds magnesium. Proc Natl Acad Sci U S A, (16): p Greenwald, J., et al., The mobility of an HIV-1 integrase active site loop is correlated with catalytic activity. Biochemistry, (28): p Maignan, S., et al., Crystal structures of the catalytic domain of HIV-1 integrase free and complexed with its metal cofactor: high level of similarity of the active site with other viral integrases. J Mol Biol, (2): p Chen, J.C., et al., Crystal structure of the HIV-1 integrase catalytic core and C-terminal domains: a model for viral DNA binding. Proc Natl Acad Sci U S A, (15): p Wang, J.Y., et al., Structure of a two-domain fragment of HIV-1 integrase: implications for domain organization in the intact protein. EMBO J, (24): p Yang, Z.N., et al., Crystal structure of an active two-domain derivative of Rous sarcoma virus integrase. J Mol Biol, (2): p Scottoline, B.P., et al., Disruption of the terminal base pairs of retroviral DNA during integration. Genes Dev, (3): p

169 Résultats et Discussion 84. Katz, R.A., et al., Retroviral integrases promote fraying of viral DNA ends. J Biol Chem, (29): p Fitzkee, N.C., et al., Solution conformation and dynamics of the HIV-1 integrase core domain. J Biol Chem, (23): p Hobaika, Z., et al., HIV-1 integrase and virus and cell DNAs: complex formation and perturbation by inhibitors of integration. Neurochem Res, (6): p Lakowicz, J.R., et al., Anisotropy-based sensing with reference fluorophores. Anal Biochem, (2): p Rossi, A.M. and C.W. Taylor, Analysis of protein-ligand interactions by fluorescence polarization. Nat Protoc, (3): p Leavitt, A.D., R.B. Rose, and H.E. Varmus, Both substrate and target oligonucleotide sequences affect in vitro integration mediated by human immunodeficiency virus type 1 integrase protein produced in Saccharomyces cerevisiae. J Virol, (4): p Bushman, F.D. and R. Craigie, Integration of human immunodeficiency virus DNA: adduct interference analysis of required DNA sites. Proc Natl Acad Sci U S A, (8): p Sherman, P.A., M.L. Dickson, and J.A. Fyfe, Human immunodeficiency virus type 1 integration protein: DNA sequence requirements for cleaving and joining reactions. J Virol, (6): p Dicker, I.B., et al., Changes to the HIV long terminal repeat and to HIV integrase differentially impact HIV integrase assembly, activity, and the binding of strand transfer inhibitors. J Biol Chem, (43): p Buzko, O.V., A.C. Bishop, and K.M. Shokat, Modified AutoDock for accurate docking of protein kinase inhibitors. J Comput Aided Mol Des, (2): p Mergny, J.L., et al., Intercalation of ethidium bromide into a triple-stranded oligonucleotide. Nucleic Acids Res, (7): p Webb, M.R. and S.E. Ebeler, A gel electrophoresis assay for the simultaneous determination of topoisomerase I inhibition and DNA intercalation. Anal Biochem, (1): p Mewshaw, R.E., et al., New generation dopaminergic agents. 6. Structure-activity relationship studies of a series of 4-(aminoethoxy)indole and 4-(aminoethoxy)indolone derivatives based on the newly discovered 3-hydroxyphenoxyethylamine D2 template. J Med Chem, (11): p Lee, J.S. and A.R. Morgan, A rapid method for the measurement of the unwinding angle of intercalating agents and the superhelix density of circular DNAs. Nucleic Acids Res, (7): p El Hassan, M.A. and C.R. Calladine, Two distinct modes of protein-induced bending in DNA. J Mol Biol, (2): p Neugebauerova, S. and J. Kypr, Invariant and variable base stacking geometries in B-DNA and A-DNA. J Biomol Struct Dyn, (1): p DiGabriele, A.D., M.R. Sanderson, and T.A. Steitz, Crystal lattice packing is important in determining the bend of a DNA dodecamer containing an adenine tract. Proc Natl Acad Sci U S A, (6): p Lee, I. and R.M. Harshey, Importance of the conserved CA dinucleotide at Mu termini. J Mol Biol, (3): p Kim, J., et al., Adaptability at the protein-dna interface is an important aspect of sequence recognition by bzip proteins. Proc Natl Acad Sci U S A, (10): p Renisio, J.G., et al., Pre-organized structure of viral DNA at the binding-processing site of HIV- 1 integrase. Nucleic Acids Res, (6): p

170 Résultats et Discussion 104. Chen, Z., et al., X-ray structure of simian immunodeficiency virus integrase containing the core and C-terminal domain (residues )--an initial glance of the viral DNA binding platform. J Mol Biol, (2): p Metifiot, M., et al., Resistance to integrase inhibitors. Viruses, (7): p Metifiot, M., et al., Elvitegravir overcomes resistance to raltegravir induced by integrase mutation Y143. AIDS, (9): p

171 Résultats et Discussion C.II. Analyse des Mécanismes d'inhibition de IN par des Anticorps Monoclonaux spécifiques Le système-modèle (LTR-peptide) que nous utilisons dans ce travail est le même que celui utilisé dans les études présentés ci-dessus relatives à la reconnaissance de l extrémité U5- LTR de l'adn viral par l hélice α4 et la boucle flexible de IN. Le système nous a permis de mieux comprendre le mécanisme de la reconnaissance des extrémités de l ADN viral par IN, reconnaissance initiant et déclenchant la maturation de l ADN viral et son transfert dans l'adn cellulaire (Hobaika et al., 2009; Renisio et al., 2005; Zargarian et al., 2003). L analyse de deux INSTI, RAL et TB11, au sein de ce système, nous a permis d accéder aux paramètres thermodynamiques de leurs interactions à l interface ADN-protéine et d évaluer le poids respectif de l ADN et de la protéine dans la complexation des INSTI (Ammar et al., 2012; Hobaika et al., 2010). Dans cette nouvelle partie de nos recherches, nous avons incorporé les anticorps monoclonaux inhibant IN, comme outils supplémentaires d'investigation. De tels anticorps (MAb) peuvent être très utiles dans l analyse des relations entre la structure et la fonction des protéines: la structure d un peptide reconnaissant l'adn, au sein d un complexe avec son anticorps monoclonal, peut nous fournir des indications précieuses sur la structure qu aurait le peptide une fois complexé à l ADN. Nous nous attendons aussi à ce qu'un anticorps dirigé contre un peptide reconnaissant l'adn ait un effet inhibiteur sur cette reconnaissance. Pour cette étude, nous avons préparé des anticorps monoclonaux dirigés contre un peptide synthétique de 29 résidus nommé K159 reproduisant la séquence de IN de VIH-1 (Maroun et al., 1999a; Sourgen et al., 1996). Dans le cristal du CCD, le segment correspondant comporte dans sa partie N-terminale l'hélice α4 (résidus 147 à 166), une boucle en son centre (résidus ) et le début de l'hélice α5 dans sa partie C-terminale (résidus ) (Bujacz et al., 1996; Dyda et al., 1994; Maignan et al., 1998). Le peptide K159 est hautement antigénique et a déjà servi à la préparation de deux types d'anticorps. Il y a environ 10 ans, le laboratoire (Maroun et al., 1999a) a préparé un anticorps polyclonal anti- K159 enrichi au stade monospécifique. L épitope fonctionnel a été caractérisé dans la partie C-terminale de K159. Il gardait sa fonctionnalité au sein de CCD et de IN entière. L anticorps se comportait comme un antagoniste fort de l'activité enzymatique de IN et comme un outil 171

172 Résultats et Discussion d investigation structurale. D une part, les expériences de gel filtration «filter binding» ont montré que son interaction avec IN, faisait obstacle à la liaison de cette dernière à l'adn viral. Comme deux molécules d anticorps se fixaient aux molécules d enzyme on pouvait conclure que IN se fixait sous forme de dimère à l extrémité du LTR viral. D autre part, l'inhibition de la liaison de IN à l'adn était caractérisée par une IC50 de 0.6 µm, et celles de l'inhibition du 3'P et du ST étaient de 16 nm et de 25 nm, respectivement. Plus tard, l équipe a obtenu un anticorps monoclonal (MAb 4) en immunisant une souris toujours avec le même peptide K159 (Azzi et al., 2010). L épitope de ce nouvel anticorps se situait dans la portion N-terminale de K159, correspondant à la séquence du peptide α4 (résidus 147 à 166). L épitope a été localisé par ELISA à l aide d une palette de tronçons peptidiques de K159 de tailles et de séquences différentes. L épitope au sein de K159 ou bien en tant que peptide isolé (α4) présente une structure désordonnée, alors qu en tant que segment au sein du CCD cristallisé, il est sous forme d une hélice régulière, amphiphile, exposée à la surface de la protéine. Curieusement, cette différence n est pas prise en compte par l anticorps. On observe une réactivité croisée entre le peptide α4 et le segment correspondant dans CCD. La reconnaissance s étend au peptide K156 (voir Matériel et Méthodes). Ces résultats ont permis de conclure que: 1) l hélice 4 est facilement accessible à l anticorps au sein de la protéine; 2) la conformation de l épitope, isolé, stabilisé par des mutations (K156) ou par l environnement protéique, n a pas d incidence sur la lia ison avec l anticorps. Cependant, les mutations effectuées sur les résidus Gln148, Lys156 et Lys159 de la face polaire de l hélice que l on sait être impliquée dans la reconnaissance des LTR (Zargarian et al., 2003) et de l inhibiteur 5CITEP (Goldgur et al., 1999) affaiblissent notablement la liaison de K156 à l anticorps, prouvant ainsi que la reconnaissance de l hélice α4 se fait du côté de la face polaire; 3) Enfin, dans une série de tests de compétition ELISA, les oligonucléotides mimant les extrémités LTR empêchent la fixation de l anticorps à IN et à K156, prouvant ainsi que l hélice α4 se sert des mêmes résidus pour interagir avec l ADN viral et avec l anticorps. Ceci explique aussi pourquoi dans les essais in vitro l anticorps est capable d inhiber l activité de IN. Cependant, alors que l ADN ne peut reconnaître qu une hélice stable, l anticorps, lui, peut reconnaître le peptide désordonné (α4), et sous forme 172

173 Résultats et Discussion d hélice, prouvant que l ADN est structuralement plus exigeant que l anticorps pour la reconnaissance du peptide, et, ceci, même si ce sont les mêmes résidus du peptide qui interviennent dans les interactions avec l anticorps et l ADN. Afin de mieux caractériser les facteurs intervenant dans la reconnaissance de l hélice α4 par les anticorps, deux nouveaux anticorps monoclonaux 4C6 et 4F4 ont été identifiés, en immunisant une souris à l aide du même peptide K159. Dans un premier temps, nous avons procédé à la caractérisation et à la délimitation des épitopes de l un et l autre des anticorps par ELISA et à l'identification des résidus impliqués dans la liaison des anticorps. Nous avons aussi évalué la possible interférence de ces anticorps dans la formation du complexe IN-LTR viral, à l aide de la méthode ELISA compétitive. Nous avons continué à nous intéresser au comportement de l'hélice α4 au contact de l'anticorps et de l ADN viral pour mieux comprendre les modalités de l interaction de l épitope α4, avec l'adn viral et les anticorps. Cette question est importante sachant que les anticorps se fixent aux antigènes peptidiques via d'importantes surfaces stériquement et électrostatiquement complémentaires qui mettent en jeu des interactions aussi diverses que les forces de VDW, les liaisons hydrogène et ioniques, qui en fait ressemblent aux interactions qui stabilisent les complexes ADN-protéines. Une autre question, était celle du rôle de la malléabilité conformationnelle de chacun des partenaires dans la formation du complexe. Nous nous sommes servi du DC pour étudier la capacité de l'antigène à ajuster sa conformation sur celle de l'anticorps lors de la copmplexation. Nous avons également étudié les cinétiques d interaction et les affin ités des interactions antigènes-anticorps par deux techniques aussi différentes que le SPR et l anisotropie de fluorescence. Les premiers résultats obtenus ont fait l'objet d'une publication «Monoclonal antibodies that recognize important functional elements of the HIV-1 integrase enzyme» by Maroun, R.G. et al. publié dans Retrovirology en L'ensemble des résultats est présenté dans le paragraphe C.II.2. «Aspects Structuraux et Dynamiques de la Reconnaissance de IN de VIH-1 par des Anticorps Monoclonaux spécifiques». 173

174 Résultats et Discussion C.II.1. «Monoclonal antibodies that recognize important functional elements of the HIV-1 integrase enzyme» by Maroun, R.G. et al. Retrovirology (2012). (Voir le manuscrit qui suit) 174

175 Résultats et Discussion 175

176 Résultats et Discussion C.II.2. «Aspects Structuraux et Dynamiques de la Reconnaissance de IN de VIH-1 par des Anticorps Monoclonaux spécifiques» C.II.2.1. Pureté des anticorps La pureté des anticorps a été contrôlée par électrophorèse sur gel de polyacrylamidesodium dodécyl sulfate (SDS-PAGE). Les puretés respectives des anticorps entiers 4C6 et 4F4 sont de 96,8% et 98.6% et celles des fragments Fab 4C6 et Fab 4F4 sont de 94,9% et de 81,11% (Figure 38). Le titre vis-à-vis du peptide antigénique K159 des anticorps entiers est de >1/81000, celui du Fab 4C6 est >1/27000 et celui du Fab 4F4 est >1/9000. Le titre est la plus grande dilution pour laquelle le rapport de l'absorbance du témoin positif sur le blanc est 2.1. Figure 38: Profils de migration des anticorps et des fragments Fab sur gel SDS-PAGE. (A) M: marqueur de poids moléculaire; 1: anticorps 4C6 entier; 2: fragment Fab de 4C6; (B) M: marqueur de poids moléculaire; 1: anticorps 4F4 entier; 2: fragment Fab de 4F4. 176

177 S147 Q148 G149 V150 V151 E152 S153 M154 N155 K156 E157 L158 K159 K160 I161 I162 G163 Q164 V165 R166 D167 Q168 A169 E170 H171 L172 K173 T174 A 175 Pourcentage en hélice (%) Résultats et Discussion C.II.2.2. Prédiction des structures secondaires des peptides En préambule, nous avons procédé à une estimation de la teneur en hélice α des différents tronçons peptidiques utilisés dans cette étude, par la méthode de prédiction AGADIR (Munoz & Serrano, 1994). Cet algorithme considère les interactions à courte échelle entre les résidus et prédit l'hélicité par résidu des peptides. Le comporte ment conformationnel des peptides en solution en fonction du ph et de la température est pris en compte. Les résultats ne concernent donc que les structures secondaires (hélice α en équilibre avec les structures désordonnées) à l abri de l effet des structures tertiaires (Munoz & Serrano, 1994). Notre but était de sonder l impact de la structure secondaire du peptide sur sa reconnaissance par l anticorps. AGADIR prédit des teneurs faibles d hélice α pour tous les peptides à l'exception de IN638, α4 et K159 qui présentent une teneur en hélice α plus élevée notamment dans leur partie centrale (entre 12 et 20%) (Figure 39). 80 K159 k K159-2 IN K K159-3 IN K K159-5 K Figure 39: Prédictions des structures secondaires des différents peptides utilisés. Les courbes indiquent le pourcentage en hélice pour chaque résidu déterminé par la méthode AGADIR. 177

178 Résultats et Discussion C.II.2.3. Caractérisation et délimitation des épitopes Une prédiction du profil d'antigénicité a montré que la séquence (K159) de IN était hautement antigénique comparée aux séquences restantes de IN (Figure 40) (Hopp & Woods, 1981; Parker et al., 1986). Figure 40: Profil d antigénicité de IN (Parker et al., 1986). Nous avons tout d abord testé par ELISA la liaison des deux anticorps monoclonaux, 4F4 et 4C6, et celle de leurs fragments Fab, au peptide antigénique K159 et aux autres peptides reproduisant les extrémités N- et C-terminales de K159. La concentration de 4C6, Fab 4C6 et Fab 4F4 est de 1µg/mL et celle de 4F4 est de 0.2 µg/ml. Dans ces expériences, l'absorbance mesurée est proportionnelle à la quantité d'anticorps liant les peptides. Le maximum de reconnaissance pour les deux anticorps est observé avec le peptide immunisant K159. C.II Epitope de 4C6 Les absorbances déterminées par tests ELISA pour 4C6 (Figure 41) face aux divers fragments peptidiques (Figure 26) montrent que: 1. 4C6 n'interagit pas avec K159-1 (résidus ), mais interagit légèrement avec K159-2 ( ), stipulant qu'un ou plusieurs des résidus E157, L158 et K159 sont impliqués dans la reconnaissance par 4C6. 2. l'intensité du signal avec IN638 ( ) est meilleure qu'en présence de K159-2 mais moins importante qu'en présence de α4 ( ), soulignant l'importance des résidus K160- Q168 dans l'interaction de 4C6. Les tests ELISA montrent également que parmi tous les peptides c est le peptide α4 ( ) qui est reconnu avec la meilleure affinité par 4C6 ; et on vient de démontrer que 178

179 Absorbance (450nm) Résultats et Discussion l'extrémité N-terminale de α4 (K159-1) ne peut pas, à elle seule, interagir avec 4C6. La confirmation de l'implication des 10 premiers résidus de α4 dans la reconnaissance par 4C6 vient des résultats obtenus avec la moitié C-terminale de K159: K159-3, K159-4, K159-5, K159-6 et IN636. Le peptide IN636 ( ) contient 6 résidus (G163, Q164, V165, R166, D167 et Q168) appartenant à l'épitope de 4C6 mais il n'est que très faiblement reconnu par l'anticorps. De même, les peptides K159-3 ( ), K159-4 ( ), K159-5 ( ) et K159-6 ( ) contenant respectivement 9, 12, 12 et 10 résidus en commun avec α4 et faisant partie de l'épitope de 4C6 n'interagissent que moyennement avec 4C6. Deux hypothèses peuvent expliquer ces faits: soit que la présence de la boucle α4-α5 et du début de l'hélice α5 masque le site d'interaction de l'anticorps sur le peptide soit que les résidus jouent un rôle conformationnel permettant l ajustement de l'interaction de α4 avec 4C C6 Fab 4C6 4F4 Fab 4F T K159 K159-1 K159-2 IN638 4 Peptides K156 IN636 K159-3 K159-4 K159-5 K159-6 Figure 41: Délimitation des épitopes respectifs des anticorps 4F4 et 4C6. Histogramme représentant les résultats des tests ELISA de la fixation des anticorps monoclonaux et des Fab correspondants au peptide immunisant K159 et aux autres peptides plus courts. Les absorbances représentent les moyennes de 9 expériences indépendantes et les barres d'erreurs leurs écarts-types moyens. 179

180 S147 Q148 G149 V150 V151 E152 S153 M154 N155 K156 E157 L158 K159 K160 I161 I162 G163 Q164 V165 R166 D167 Q168 Y169 Pourcentage en hélice (%) Résultats et Discussion La deuxième hypothèse semble être la plus plausible, parce que: (1) la prédiction de la structure secondaire par AGADIR montre que tous les peptides ont des teneurs faibles en hélice α à l'exception de IN638, α4 et K159 qui présentent 12 à 20% d'hélice, notamment dans leur partie centrale (Figure 39); Ces mêmes peptides sont les seuls à interagir avec 4C6 ; et (2) la prédiction de la structure de la séquence E157-Q168 fournit un pourcentage presque nul d hélice α, alors que la même séquence dans α4 possède jusqu'à 15% d'hélice (Figure 42). Ceci met en évidence le rôle des dix premiers résidus de α4 dans la structuration en hélice. La tendance des peptides IN638, α4 et K159 à établir une hélice α, tendance qui dépend de la présence de l'extrémité N-terminale, pourrait donc expliquer leur reconnaissance par 4C6. Nous pouvons d'ailleurs valider cette hypothèse en testant en ELISA un peptide reproduisant uniquement la séquence E157-Q168. Nous notons que les fragments Fab conservent, en ELISA, une bonne affinité, similaire à celle de l'anticorps entier E157-Q Figure 42: Prédictions des structures secondaires du peptide α4 et du segment E157- Q168. Les courbes indiquent le pourcentage en hélice pour chaque résidu déterminé par la méthode AGADIR. C.II Impact de la conformation de l'épitope sur la reconnaissance par 4C6 Le peptide antigénique immunisant K159 et le peptide α4 présentent tous les deux une structure secondaire plutôt désordonnée en solution aqueuse (Maroun et al., 1999a; Zargarian et al., 2003). Ces peptides sont reconnus avec une bonne affinité par 4C6. Par contre, le 180

181 Résultats et Discussion peptide K156, analogue structural de α4, portant sept mutations hélicogènes n'est pas du tout reconnu par 4C6 (Figure 41). Les mutations introduites dans K156 touchent majoritairement des résidus hydrophobes et leur rôle est de restaurer la structure de l'hélice α4, comme au sein de la protéine. Il se pourrait qu'une ou plusieurs des mutations hélicogènes introduites dans K156 affectent des résidus impliqués dans l'interaction avec l'anticorps. La reconnaissance par 4C6 de α4 et non de K156 pourrait signifier que l'épitope de 4C6 est uniquement séquentiel. Que le peptide α4 soit isolé, comme dans α4 et K159, ou bien au sein de CCD ou de la protéine entière, il est reconnu par 4C6. Cependant, plusieurs mutations au sein du peptide inhibent cette reconnaissance. Ceci n exclut évidemment pas la possibilité d un changement conformationnel au contact de l anticorps. De tout ce qui précède, nous pouvons conclure que le segment (hélice α4) est un épitope majeur, reconnu spécifiquement par l anticorps monoclonal 4C6. C.II Epitope de 4F4 L'anticorps 4F4 ne présente aucune affinité pour K159-1, K159-2, IN638 et α4. La meilleure affinité de 4F4 est observée avec K159-3 ( ). L'affinité de 4F4 pour IN636 ( ) est légèrement plus faible que la précédente. Les trois résidus K160, I161 et I162 sont donc impliqués dans l'interaction. L'affinité de 4C6 pour K159-4 ( ) n'est pas meilleure que celle pour K159-3 : les résidus N155, K156, E157 et L158 ne participent donc pas à la liaison du peptide à l'anticorps (Figure 41). L'affinité de K159-5 et de K159-6 est plus faible, le début de l'hélice α5 (L172-A175) qui manque dans ces deux peptides fait donc partie de l'épitope de 4F4 (Figure 41). Tout ce qui précède permet de conclure que K159-3 est l'épitope de 4F4. Ici aussi, les Fab conservent une bonne affinité. Notons que ce dernier épitope que nous avons mis en évidence correspond à une séquence fortement immunogène : des anticorps neutralisants reconnaissant cette séquence ont été trouvés dans le sérum de patients africains séropositifs au VIH (http://www.hiv.lanl.gov/content/immunology). 181

182 Absorbance (450nm) Absorbance (450nm) Résultats et Discussion C.II Identification des résidus impliqués dans la reconnaissance des anticorps: Effet des mutations ponctuelles Dans le but d'identifier les acides aminés des épitopes impliqués dans les interactions avec les deux anticorps, plusieurs mutations ponctuelles ont été introduites dans les peptides IN638 et IN636 (Figure 26). Ces résidus soit jouent un rôle dans la liaison de IN à l'adn viral soit interviennent dans la liaison de CCD au 5CITEP (Q148, K159, V165) (Chen et al., 2006; Dolan et al., 2009; Esposito & Craigie, 1998; Goldgur et al., 1998; Johnson et al., 2006; Krishnan et al., 2010) ou bien encore sont des sites de mutations de résistance aux INSTI (Q148 et N155) (Goethals et al., 2010; Malet et al., 2008). La mutation Q148E (IN638-1) provoque une diminution dramatique dans la reconnaissance de IN ( % d inhibition) par les anticorps (Figure 43B). Les mutations K159E (IN638-3) ( 50% d inhibition de la reconnaissance) (Figure 43B), V165A (IN636-1) ( 50% d inhibition) et R166A (IN636-2) (70-80% d inhibition) (Figure 43A) affectent significativement l'interaction de l'anticorps avec l'épitope. La mutation N155K (IN638-4) (Figure 43B) est moins nuisible. (A) F4 Fab 4F4 (B) C6 Fab 4C IN636 IN636-1 Peptides IN IN638 IN638-1 Peptides IN638-3 IN638-4 Figure 43: Identification des résidus de IN impliqués dans la liaison aux anticorps. (A) Histogramme représentant les résultats des tests ELISA de la fixation de 4F4 et du fragment Fab correspondant au peptide IN636 et aux deux peptides analogues IN636-1 et IN636-2 portant les mutations V165 A et R166 A; (B) Histogramme représentant les résultats des tests ELISA de la fixation de 4C6 et du fragment Fab correspondant au peptide IN638 et aux trois peptides analogues IN638-1, IN638-3 et IN638-4 portant les mutations Q148 E, K159 E et N155 K. Les absorbances représentent les moyennes de 9 expériences indépendantes et les barres d'erreurs leurs écarts-types moyens. 182

183 Absorbance (450nm) Résultats et Discussion On en conclut que les résidus Q148, K159, V165 et R166 participent à la liaison aux anticorps. Plusieurs d entre eux sont impliqués dans l'interaction avec l'adn viral, notamment Q148 et K159. La mutation V165A n affecte que très peu la reconnaissance par l anticorps, probablement en raison de son appartenance à la face hydrophobe de l hélice α4 non-exposée au milieu. L'impact de 4C6 sur le peptide portant la mutation N155K est particulièrement intéressant. Si l'anticorps se montre capable d'inhiber le mutant de IN porteur de cette mutation de résistance aux INSTI, il sera alors actif là où certains INSTI ne le sont pas et pourrait donc ouvrir la voie à des applications thérapeutiques importantes. C.II.2.4. Reconnaissance de IN et du CCD par les anticorps C.II ELISA 4F4 reconnaît le peptide K159, CCD et IN avec la même efficacité ce qui n est pas le cas pour 4C6 qui démontre plus d'affinité pour K159 que pour CCD et IN (Figure 44). On en conclut que les épitopes de 4F4 et de 4C6 sont accessibles et exposés à la surface de la protéine, mais que l accessibilité à l épitope de 4F4 est plus aisée. Du fait de la haute conservation de la séquence dans les IN des différentes souches de VIH-1, nos anticorps devraient démontrer une bonne affinité pour les IN de toutes les souches de VIH (Engelman & Craigie, 1992) C6 Fab 4C6 4F4 Fab 4F K159 IN CC Figure 44: Reconnaissance de IN et du CCD par les anticorps 4F4 et 4C6. Histogramme représentant les résultats des tests ELISA de la fixation des anticorps monoclonaux et des Fab correspondants au peptide immunisant K159, à IN et au CCD. Les absorbances représentent les moyennes de 9 expériences indépendantes et les barres d'erreurs leurs écarts-types moyens. 183

184 Résultats et Discussion C.II Western Blot La spécificité de la reconnaissance de IN par les anticorps a été aussi déterminée par Western Blot. L immuno Blot a été réalisé sur des extraits cellulaires de E. coli produisant IN et CCD. Les extraits bactériens ont été séparés sur PAGE SDS 15%, transférés sur une membrane de nitrocellulose et incubés en présence de concentrations croissantes d'anticorps. Une seule bande de 32 kda correspondant à IN (Figure 45) et une seule bande de 18 kda correspondant au CCD (Figure 46) sont détectées sur le blot confirmant la haute spécificité des deux anticorps. L'affinité de 4F4 est nettement meilleure que celle de 4C6, confirmant ainsi les résultats obtenus par ELISA (Figure 44). L'épitope de 4F4 est donc plus accessible que celui de 4C6 au sein de la protéine entière et du CCD. Figure 45: Western Blot: Détection de IN par les deux anticorps 4F4 et 4C6. 10µl d'extraits de bactéries produisant IN sont déposés dans chaque puits ; les anticorps sont diluées aux concentrations 0.2µg/mL (puits 1 et 4), 0.5 µg/ml (puits 2 et 5) et 2µg/mL (puits 3 et 6). SC (Santa Cruz Biotechnology, USA) (puits 7) est un anticorps monoclonal commercial de IN de VIH

185 Résultats et Discussion Figure 46: Western Blot: Détection du CCD de IN par les deux anticorps 4F4 et 4C6. 10µl d'extraits de bactéries produisant le CCD sont déposés dans chaque puits ; les anticorps sont diluées aux concentrations 0.5µg/mL (puits 1 et 2). C.II Dot Blot La spécificité de l'interaction des anticorps avec IN purifiée et CCD a été confirmée par Dot Blot. 2 et 5 µg de IN (puits 1 et 2) et 2, 5 et 10 µg de CCD (puits 4, 5 et 6) (Figure 47) ont été déposés sur la membrane et incubés avec les anticorps dilués aux concentrations 1µg/mL pour 4C6, Fab 4C6 et Fab 4F4 et 0.2 µg/ml pour 4F4. La BSA (puits 3) (Figure 47-48) sert de contrôle négatif. Aucune interaction n'est observée entre la BSA et les anticorps soulignant la spécificité des anticorps à IN. La reconnaissance par 4F4 est meilleure que par 4C6 en dot blot (Figure 48-48) conformément aux résultats des ELISA et du western blot. Figure 47: Dot Blot: Détection par les deux anticorps et les deux Fab 4F4 et 4C6. 2 et 5 µg de IN (1 et 2), 10 µg de BSA (3) et 2, 5 et 10 µg de CCD (4, 5 et 6) sont déposés sur la membrane. 185

186 Intensité des dots de dot blot (U.A) Résultats et Discussion F4 Fab 4F4 4C6 Fab 4C CCD (2 g) CCD (5 g) CCD (10 g) IN (2 g) IN (5 g) T Figure 48: Histogramme représentant l intensité des dots d interaction IN/CCDanticorps sur le dot blot. C.II.2.5. Inhibition de l'interaction IN- anticorps par l ADN viral La capacité de l'adn viral à se lier à IN au niveau des épitopes et empêcher ainsi la formation du complexe épitope-anticorps a été sondée par des expériences d ELISA compétitive. Les oligonucléotides utilisés correspondent à différentes versions de l'extrémité U5-LTR de l'adn viral (Figure 23-Matériels et Méthodes). LTR34 représente la version non-processée de l'adn viral alors que LTR32 représente la version processée. LTR17 est une version plus courte du LTR non-processée et contient le minimum d'adn requis pour la liaison à IN. CRE est l'oligonucléotide témoin (Azzi et al., 2010). Les anticorps ont été ajoutés aux puits couverts par IN libre ou incubée en présence de l'adn viral. Une inhibition de l'interaction des anticorps est observée après incubation de IN avec les divers LTR et avec les deux anticorps. CRE, oligonucléotide de contrôle est incapable d'interférer avec la liaison des anticorps à IN. Les LTR libres aussi ne sont pas reconnus par les anticorps (Figure 49). Ces résultats confirment que c'est bien le peptide K159 et plus particulièrement l hélice α4 qui intervient dans la reconnaissance du site de maturation de l'adn de VIH-1 à l extrémité des LTR (Zargarian et al., 2003), en accord avec l anisotropie de fluorescence, le DC et la cristallographie (Hare et al., 2010). 186

187 Absorbance (450nm) Absorbance (450nm) Résultats et Discussion C6 Fab 4C6 4F4 Fab 4F CRE LTR17 LTR34 LTR IN IN+CRE IN+LTR17 IN+LTR34 IN et complexes IN-ADN IN+LTR32 Figure 49 : Inhibition de l'interaction des anticorps 4F4 et 4C6 avec IN par les LTR viraux. L'histogramme représente les résultats de l'elisa compétitive entre l'adn et les anticorps pour la fixation sur IN. IN a été incubée avec les différents oligonucléotides ava nt addition des anticorps. Les absorbances sont les moyennes de 3 expériences indépendantes et les barres d'erreurs leurs écarts-types moyens. L'histogramme en insert représente les résultats d'un test ELISA de contrôle de la liaison des anticorps aux oligonucléotides. Ce résultat n est pas étonnant. Nous avions vu plus haut que les résidus Q148, K159, V165 et N155 de α4 impliqués dans la liaison à l ADN, sont aussi impliqués dans la liaison aux anticorps. Au-delà de ce résultat qui établit définitivement le rôle clé de l'hélice α4 dans la reconnaissance spécifique de l'adn viral, la capacité des LTR à interférer avec la formation du complexe IN-anticorps fournit des indications précieuses sur la capacité de ces anticorps monoclonaux à inhiber efficacement le 3'P et le ST. C.II.2.6. Interactions anticorps-peptide par DC L'élucidation des mécanismes par lesquels les protéines se lient entre elles ou fixent des ligands est évidemment d'une grande importance. Les modifications de conformation de 187

188 Résultats et Discussion l'un ou des deux partenaires, contrôlent les énergies, la spécificité des associations et la fonction des protéines. Le DC est une technique parfaitement adaptée à l'étude de la structure secondaire des protéines et des acides nucléiques et à celle de leurs variations induites par des interactions mutuelles ou avec différents ligands (Berova et al., 2000; Fasman, 1996). Les anticorps sont connus pour leurs liaisons à des antigènes spécifiques. Cependant, un même site sur l'anticorps peut accommoder plusieurs antigènes différents (James et al., 2003), alors qu un anticorps possède un répertoire limité de structures en équilibre (Mariuzza, 2006). Au sein de l équilibre, chaque conformation génère une topologie différente permettant la liaison de plusieurs ligands dans la même région du site de liaison (Keskin, 2007). Il est clair aussi que la flexibilité intrinsèque des anticorps contribue à lier plusieurs antigènes, dotés de structures différentes. De la même façon, l antigène peut subir une adaptation conformationnelle lors de la formation du complexe antigène-anticorps. Ici, nous avons analysé par DC, les changements conformationnels des peptides suite à leurs liaisons aux Fab. Les spectres des peptides K159, α4 et K159-3 en solution présentent tous la signature d'une structure désordonnée, avec un pic négatif important à 195 nm. La comparaison des spectres des formes libre et liée du peptide α4 démontre qu au contact du Fab de 4C6 ce peptide adopte une structure en hélice α (Figure 50A), lui permettant de s'accommoder au site de liaison du Fab. Par contre, le peptide α4 mis au contact du Fab de 4F4 conserve sa conformation désordonnée, signifiant l absence d'interaction (Figure 50B). Nous avons aussi étudié l'interaction de K159-3 avec le Fab de 4C6. Là encore, la structure secondaire de K159-3 n est pas modifiée. Par contre, le Fab de 4F4 entraîne un changement dans la structure désordonnée de K159-3 (Figure 51A et B), témoignant d une interaction. La mise en contact des deux anticorps 4F4 et 4C6 avec le peptide immunisant K159 entraîne des modifications de son spectre, mais celles-ci ne sont pas les mêmes. Si l un et l autre des anticorps interagissent avec K159, ils provoquent cependant des changements différents de sa structure secondaire. Fab 4C6 interagit avec le segment α4, qui possède un bon potentiel hélicoïdal, et conforte sa structure en hélice au sein de K159 (Figure 52). 188

189 (M -1.cm -1 ) (M -1.cm -1 ) Résultats et Discussion (A) 3 4 (5 M) Fab 4C6 (2.5 M) 4 +Fab 4C6 (5 M) , nm -4-5 (B) 3 4 (5 M) 2 4+Fab 4F4 (2.5 M) 1 4+Fab 4F4 (5 M) , nm Figure 50: Spectres dichroïques de α4 libre et en complexe avec les anticorps: (A) Spectre de α4 à 5µM (en noir) et spectres de [α4+fab 4C6]-Fab 4C6 (ratio 2:1 en rouge et ratio 1:1 en bleu); (B) Spectre de α4 à 5µM (en noir) et spectres de [α4+fab 4F4]-Fab 4F4 (ratio 2:1 en rouge et ratio 1:1 en bleu). Tampon Na/Na 2 (PO 4 ), 10mM, ph=6, I=0,1, à température ambiante. 4F4 et 4C6 reconnaissent chacun son épitope dans une conformation linéaire. L'épitope de 4F4 conservant la même structure désordonnée dans le peptide (K159-3) et dans la protéine (boucle α4-α5), il n'est pas surprenant que l'anticorps puisse le reconnaître dans les deux cas (Figure 41 et Figures 44-46). Les spectres de DC indiquent que K159-3 subit un léger réarrangement lors de son interaction avec 4F4. Par contre, 4C6 doit reconnaître son 189

190 (M -1.cm -1 ) (M -1.cm -1 ) Résultats et Discussion épitope, le peptide α4, en conformations étendue et hélicoïdale (IN) (Figure 41 et Figures 44-46). Le DC montre que l'anticorps peut forcer le peptide α4 dans une structure en hélice α. (A) K159-3 (5 M) K Fab 4C6 (2.5 M) K Fab 4C6 (5 M) , nm (B) K159-3 (5 M) K Fab 4F4 (2.5 M) K Fab 4F4 (5 M) nm Figure 51: Spectres dichroïques de K159-3 libre et en complexe avec les anticorps: (A) Spectre de K159-3 à 5µM (en noir) et spectres de [K159-3+Fab 4C6]-Fab 4C6 (ratio 2:1 en rouge et ratio 1:1 en bleu); (B) Spectre de K159-3 à 5µM (en noir) et spectres de [K159-3+Fab 4F4]-Fab 4F4 (ratio 2:1 en rouge et ratio 1:1 en bleu). Tampon Na/Na 2 (PO 4 ), 10mM, ph=6, I=0,1, à température ambiante. En fait, la littérature nous fournit plusieurs exemples où un anticorps monoclonal pousse l'épitope à reprendre la conformation qu'il avait dans le contexte de la protéine. Leder et al., (1995) ont ainsi montré qu'un anticorps monoclonal pouvait forcer son antigène peptidique à adopter une structure secondaire en hélice α, similaire à celle qu il possédait au sein de la protéine dans les conditions physiologiques. Le même anticorps a aussi su reconnaître un analogue du peptide, rendu désordonné par la substitution de deux acides 190

191 Résultats et Discussion aminés par des prolines, la liaison induisant la formation d'une structure en hélice. Il faut donc s attendre lorsqu on prépare un anticorps contre un peptide antigénique de structure désordonnée, mais doté d un potentiel hélice α, comme l indique sa structure en hélice dans la protéine, à ce que l anticorps stabilise le peptide en hélice. Ceci revient à dire que l anticorps va créer un réseau d interactions avec le peptide, propices, comme dans la protéine, à la stabilisation de l hélice (Leder et al., 1995). Un autre exemple est fourni par les études de RMN et de docking qui ont montré que trois anticorps dirigés contre un peptide de la toxine de cholera (cholera toxin peptide (CTP3)), reconnaissent deux épitopes différents dans le même peptide. Alors que la structure du peptide isolé est complètement désordonnée, dans la protéine les deux épitopes forment une structure repliée avec une boucle et un feuillet β. L analyse montre que les interactions avec l anticorps restaurent le feuillet β, ce qui pourrait maximiser l interface peptideanticorps (Scherf et al., 1992). Le rôle de la malléabilité conformationnelle de l'antigène et aussi de l anticorps est donc primordial dans la formation du complexe. (M -1 cm -1) K159 5 M K159+ Fab 4F4 5 M K159+Fab 4C6 5 M , nm Figure 52: Spectres dichroïques de K159 libre et en complexe avec les anticorps: Spectres de K159 à 5µM (en noir), [K159+Fab 4F4]-Fab 4F4 (ratio 1:1 en rouge) et [K159+Fab 4C6]- Fab 4C6 (ratio 1:1 en bleu). Tampon Na/Na 2 (PO 4 ), 10mM, ph=6, I=0,1, à température ambiante. 191

192 Résultats et Discussion C.II.2.7. Constantes d'affinité des interactions anticorps-peptides Le développement d'anticorps monoclonaux thérapeutiques nécessite des mesures rigoureuses des propriétés cinétiques et thermodynamiques des associations antigènesanticorps. La mesure précise de la constante de vitesse d'association (ka), de la constante de vitesse de dissociation (kd), et de la constante d'affinité (K d ) fournit des informations utiles au développement de médicaments (Drake et al., 2012). Afin d obtenir une bonne évaluation des propriétés de nos complexes, nous avons utilisé conjointement les techniques de SPR et d anisotropie de fluorescence. C.II Résonance plasmonique de surface (SPR) La SPR est une technique bien adaptée à l analyse qualitative et quantitative des interactions. L'avantage de la SPR dans l'étude des interactions anticorps-peptides est sa capacité à détecter les interactions de faible et de haute affinités, alors que les tests traditionnels, i.e. ELISA, sont incapables de détecter les interactions à dissociation rapide (Swanson, 2003; Thorpe & Swanson, 2005). La biopuce possède une surface en or carboxylée sur laquelle les peptides sont fixés via leurs amines primaires. Le bruit de fond par rapport au signal, déterminé à partir des courbes de réflectivité lorsque le flux d'anticorps passe à travers la surface, est faible. Les sensorgrammes pour une ou deux concentrations d'anticorps ou de Fab sont présentés dans les figures 53 et 54 avec en ordonnnée les intensités du signal en unité de résonance (RU) et en abscisse le temps en secondes. Pour des concentrations relativement faibles d'anticorps, la courbe de liaison est généralement simple. Les logiciels de calcul Biaevaluation de Biacore permettent, par une intégration mathématique globale des données («global fitting») suivant le modèle cinétique d'interaction 1:1, de calculer avec une bonne précision les constantes kd, ka et K d de l interaction. Les valeurs de K d des interactions peptides-anticorps/fab regroupées dans les tableaux 5 et 6 montrent que les peptides α4, K156, K159-6, IN638 n interagissent pas avec 4F4. Par contre, les peptides K159-1 et K159-2 ne montrent qu une faible interaction. Les peptides qui fixent le mieux 4F4 sont : K159, K159-3, K159-4 et IN636 (Figure 53 et Tableau 5). Ces résultats concordent avec ceux des ELISA. K159, le peptide immunisant est celui qui interagit le mieux (Rmax la plus élevée et 192

193 Résultats et Discussion K d de 0.76nM). Vient ensuite, K159-3 qui donne la meilleure Rmax et donc la meilleure capacité de liaison à 4F4, ainsi que le meilleur K d (0.26 nm) par rapport à IN636 et à K159-4 dont les K d sont de 0.94 nm et de 2nM, respectivement. Ces résultats sont en parfait accord avec ceux des ELISA, en confirmant que K159-3 est bien l'épitope de 4F4. 193

194 Résultats et Discussion Figure 53: Sensorgrammes représentant le profil d'interaction de chacun de 4F4 et du Fab correspondant par SPRi. Les RU (en ordonnée) sont présentés en fonction du temps. Le code couleur des peptides est indiqué. Les anticorps sont injectés à des concentrations variables [4F4]=7nM et [Fab 4F4]=12.8 ou 51.25nM dans du PBS, ph 7.4 Peptide Fab 4F4 (51.25nM) Fab 4F4 (12.8nM) 4F4 (7nM) Rmax (RU) K d (M) Rmax (RU) K d (M) Rmax (RU) K d (M) k E E E-10 k E E E-09 k ND ND E-10 IN638 ND ND ND E-10 α ND ND ND ND k ND ND ND ND k E E E-10 k E ND E-09 k ND 0.1 ND E-09 k E ND ND ND IN E E E-10 Tableau 5: Réponses maximales de Résonance (Rmax) et constantes de dissociation (K d ) exprimées en M de l'interaction de 4F4/Fab 4F4 avec les différents peptides. 194

195 Résultats et Discussion 195

LE SIDA: UNE AFFECTION DU SYSTEME IMMUNITAIRE

LE SIDA: UNE AFFECTION DU SYSTEME IMMUNITAIRE LE SIDA: UNE AFFECTION DU SYSTEME IMMUNITAIRE Introduction: Le SIDA, ou syndrome immunodéficience acquise, est une maladie due à un virus, le virus de l'immunodéficience humaine ou VIH (HIV: Human Immunodeficiency

Plus en détail

TRANSMISSION DES VIRUS ET CYCLE DE MULTIPLICATION

TRANSMISSION DES VIRUS ET CYCLE DE MULTIPLICATION TRANSMISSION DES VIRUS ET CYCLE DE MULTIPLICATION II. 1 Généralités II.2 Transmission des Virus II.3 Grandes étapes de Cycle de Multiplication Attachement Pénétration Réplication Libération II. 1 Généralités

Plus en détail

Virus: Virus: Diversité génétique. Diversité génétique et variation antigénique. Virus: Conséquences épidémiologiques et thérapeutiques

Virus: Virus: Diversité génétique. Diversité génétique et variation antigénique. Virus: Conséquences épidémiologiques et thérapeutiques Virus: Diversité génétique et variation antigénique Conséquences épidémiologiques et thérapeutiques M. Segondy Virus: Diversité génétique Virus: Génome + Capside ± Enveloppe 1 Virus: Diversité génétique

Plus en détail

Généralités sur les virus Structure, Réplication, Évolution

Généralités sur les virus Structure, Réplication, Évolution Généralités sur les virus Structure, Réplication, Évolution Les virus sont des microorganismes de très petite taille, 20 à 300 nanomètres, 100 fois plus petit qu une bactérie, non visibles en microscopie

Plus en détail

ETUDE FONCTIONNELLE ET STRUCTURALE DE LA PROTEINE INTEGRASE DES RETROVIRUS ET APPLICATION EN TRANSGENESE

ETUDE FONCTIONNELLE ET STRUCTURALE DE LA PROTEINE INTEGRASE DES RETROVIRUS ET APPLICATION EN TRANSGENESE MINISTERE DE LA JEUNESSE, DE L EDUCATION NATIONALE ET DE LA RECHERCHE ECOLE PRATIQUE DES HAUTES ETUDES Sciences de la Vie et de la Terre MEMOIRE Présenté Par Julie CHARMETANT Pour l obtention du diplôme

Plus en détail

Licence-Master Bioinformatique Contrôle continu 06/03/06. Correction

Licence-Master Bioinformatique Contrôle continu 06/03/06. Correction Licence-Master Bioinformatique Contrôle continu 06/03/06 Correction -«Vraies» questions de cours -«fausses» questions de cours: questions pour voir si pouviez imaginer une réponse crédible qui n était

Plus en détail

Chapitre 2. La synthèse protéique : la relation entre le génotype et le phénotype.

Chapitre 2. La synthèse protéique : la relation entre le génotype et le phénotype. Chapitre 2. La synthèse protéique : la relation entre le génotype et le phénotype. Les maladies génétiques comme la drépanocytose ou l'albinisme sont liées à des modifications du génotype des individus

Plus en détail

ÉTUDE FONCTIONNELLE ET STRUCTURALE DE LA PROTÉINE INTÉGRASE DU VIH-1 ET DÉVELOPPEMENT D INHIBITEURS

ÉTUDE FONCTIONNELLE ET STRUCTURALE DE LA PROTÉINE INTÉGRASE DU VIH-1 ET DÉVELOPPEMENT D INHIBITEURS MINISTERE DE L ENSEIGNEMENT SUPERIEUR ET DE LA RECHERCHE ÉCOLE PRATIQUE DES HAUTES ÉTUDES Sciences de la Vie et de la Terre MÉMOIRE Présenté Par Coralie CELLIER Pour l obtention du diplôme de l École Pratique

Plus en détail

Quelques termes-clef de biologie moléculaire et leur définition

Quelques termes-clef de biologie moléculaire et leur définition Acide aminé (AA) Quelques termes-clef de biologie moléculaire et leur définition Isabelle Quinkal INRIA Rhône-Alpes Septembre 2003 Petite molécule dont l enchaînement compose les protéines - on dit qu

Plus en détail

Université D Oran, Faculté de Médecine, Service D Histologie-Embryologie Dr Belarbi-Amar. Le virus. Les virus(acaryotes)

Université D Oran, Faculté de Médecine, Service D Histologie-Embryologie Dr Belarbi-Amar. Le virus. Les virus(acaryotes) Les virus(acaryotes) Le virus I-Généralités : Le virus (cellule acaryote) est une entité biologique incapable de se reproduire de façon autonome, nécessitant une cellule hôte, dont il utilise les constituants

Plus en détail

Université du Québec à Montréal

Université du Québec à Montréal RECUEIL D EXERCICES DE BICHIMIE 6. Les acides nucléiques 6.2. Réplication, transcription et traduction P P P CH 2 H N H N N NH NH 2 Université du Québec à Montréal 6.2. Réplication, transcription et traduction

Plus en détail

Expression des gènes Comparatif entre procaryotes et eucaryotes

Expression des gènes Comparatif entre procaryotes et eucaryotes Comparaison procaryotes/ 2TSbc Expression des gènes Comparatif entre procaryotes et eucaryotes La majeure partie des connaissances de biologie moléculaire a d'abord débuté par l'étude des phénomènes chez

Plus en détail

Les outils du génie génétique.

Les outils du génie génétique. Les outils du génie génétique. I\ Les enzymes. On va se servir des enzymes pour couper, coller et synthétiser des acides nucléiques. A\ Les polymérases. Toutes les polymérases agissent de 5 vers 3. En

Plus en détail

ECUE 2 (L 1 -S 2 ) : Microbiologie générale Microbiologie générale

ECUE 2 (L 1 -S 2 ) : Microbiologie générale Microbiologie générale Unité d enseignement UE 8 : Biologie Moléculaire - Microbiologie ECUE 2 (L 1 -S 2 ) : Microbiologie générale Microbiologie générale 1h30 de cours et 1h15 de Travaux pratiques Un examen écrit ; un examen

Plus en détail

3. Biotechnologie de l ADN

3. Biotechnologie de l ADN 3. Biotechnologie de l ADN 3.1. Technologie de l ADN recombinant 3.1.1. Isolation d ADN et d ARN 3.1.2. Fragmentation de l ADN (les Endonucléases) 3.1.3. Analyse d ADN sur d agarose et d acrylamide 3.1.4.

Plus en détail

IMMUNOLOGIE. La spécificité des immunoglobulines et des récepteurs T. Informations scientifiques

IMMUNOLOGIE. La spécificité des immunoglobulines et des récepteurs T. Informations scientifiques IMMUNOLOGIE La spécificité des immunoglobulines et des récepteurs T Informations scientifiques L infection par le VIH entraîne des réactions immunitaires de l organisme qui se traduisent par la production

Plus en détail

CHAPITRE 3 LA SYNTHESE DES PROTEINES

CHAPITRE 3 LA SYNTHESE DES PROTEINES CHAITRE 3 LA SYNTHESE DES ROTEINES On sait qu un gène détient dans sa séquence nucléotidique, l information permettant la synthèse d un polypeptide. Ce dernier caractérisé par sa séquence d acides aminés

Plus en détail

Chapitre 10 L isolement et la manipulation de gènes. Injection d ADN étranger dans une cellule animale

Chapitre 10 L isolement et la manipulation de gènes. Injection d ADN étranger dans une cellule animale Chapitre 10 L isolement et la manipulation de gènes Injection d ADN étranger dans une cellule animale Comment amplifier un gène d intérêt? Amplification in vivo à l aide du clonage d ADN L ensemble formé

Plus en détail

V. Exemples choisis. 1. Classification et propriétés

V. Exemples choisis. 1. Classification et propriétés V. Exemples choisis 1. Classification et propriétés Autrefois, les Polyomavirus et les Papillomavirus étaient regroupés en une famille unique nommée Papovaviridae (nom qui regroupe le début du nom de chaque

Plus en détail

L3-BH01 Cours n 10 Modifications post-transcriptionnelles

L3-BH01 Cours n 10 Modifications post-transcriptionnelles L3-BH01 Cours n 10 Modifications post-transcriptionnelles Ce cours est présent sur le web à l adresse suivante : http://www.univ-orleans.fr/sciences/biochimie/l/ressources.htm Plan (cours n 10 & 11) Introduction

Plus en détail

Cycle de réplication. Webinaire présenté par : Michael Bailey, directeur, Réalisation des programmes Date : 6 février 2014, de 13 h à 14 h (HNE)

Cycle de réplication. Webinaire présenté par : Michael Bailey, directeur, Réalisation des programmes Date : 6 février 2014, de 13 h à 14 h (HNE) Cycle de réplication virale du VIH Webinaire présenté par : Michael Bailey, directeur, Réalisation des programmes Date : 6 février 2014, de 13 h à 14 h (HNE) Pourquoi est-ce important de comprendre le

Plus en détail

Information Génétique et hérédité 1- Réplication, mitose, méiose

Information Génétique et hérédité 1- Réplication, mitose, méiose Information Génétique et hérédité 1- Réplication, mitose, méiose REPLICATION DE L ADN et CYCLE CELLULAIRE quantité d'adn 4C 2C G 1 S G 2 M G 1 5 12 15 16 duplication de l'adn mitose temps heures CYCLE

Plus en détail

Chapitre 2: Les mécanismes de

Chapitre 2: Les mécanismes de Chapitre 2: Les mécanismes de l immunité I-Les anticorps: agents du maintien de l intégrité du milieu extracellulaire 1- La réaction antigène- anticorps et l élimination du complexe immun Les anticorps:

Plus en détail

MECANISME MOLECULAIRE DU TRANSPORT NUCLEAIRE

MECANISME MOLECULAIRE DU TRANSPORT NUCLEAIRE MECANISME MOLECULAIRE DU TRANSPORT NUCLEAIRE INTRODUCTION d'après le cours du Dr NEHRBASS L enveloppe nucléaire renferme l ADN et défini le compartiment nucléaire. Elle est formé de 2 membranes concentriques

Plus en détail

Ecole Centrale Paris Année 2009-2010 1 ère année. Cours «Biologie». Vendredi 28 mai 2010

Ecole Centrale Paris Année 2009-2010 1 ère année. Cours «Biologie». Vendredi 28 mai 2010 Ecole Centrale Paris Année 2009-2010 1 ère année. Cours «Biologie». Vendredi 28 mai 2010 Contrôle des Connaissances. 2 ème session) (Durée : 1h30, tous documents autorisés, ordinateur interdit) Important

Plus en détail

Virus et machinerie cellulaire

Virus et machinerie cellulaire Virus et machinerie cellulaire 1 Dr Céline Bressollette-Bodin Multiplication des virus dans la cellule - principales étapes - mécanismes de transcription / réplication Les interactions virus / cellules

Plus en détail

L'ordre et la nature des acides aminés (ou séquence) d un polypeptide dépend de la séquence des nucléotides de l ADN du gène qui le code.

L'ordre et la nature des acides aminés (ou séquence) d un polypeptide dépend de la séquence des nucléotides de l ADN du gène qui le code. L'ordre et la nature des acides aminés (ou séquence) d un polypeptide dépend de la séquence des nucléotides de l ADN du gène qui le code. Une mutation, peut entraîner une modification de la séquence des

Plus en détail

TD de Biochimie 4 : Coloration.

TD de Biochimie 4 : Coloration. TD de Biochimie 4 : Coloration. Synthèse de l expérience 2 Les questions posées durant l expérience 2 Exposé sur les méthodes de coloration des molécules : Générique Spécifique Autres Questions Pourquoi

Plus en détail

Figure 3-4 Fonction du nucléole dans la synthèse des ribosomes.

Figure 3-4 Fonction du nucléole dans la synthèse des ribosomes. III.1.6 Le Nucléole Ce sont des structures fibrillaires sphériques denses du noyau interphasique et prophasique des organismes supérieurs. Les nucléoles qui sont le site de formation des ribosomes fixent

Plus en détail

La Pandémie du SIDA. Taux de prévalence du VIH/sida chez les adultes âgés entre 15 et 49 ans à la fin de 1999, Source : ONUSIDA, juin 2000.

La Pandémie du SIDA. Taux de prévalence du VIH/sida chez les adultes âgés entre 15 et 49 ans à la fin de 1999, Source : ONUSIDA, juin 2000. La Pandémie du SIDA Taux de prévalence du VIH/sida chez les adultes âgés entre 15 et 49 ans à la fin de 1999, Source : ONUSIDA, juin 2000. Adultes Région/Pays infectés (%) afrique subsaharienne 8,57 antilles

Plus en détail

infovihtal #6 hiver 2001

infovihtal #6 hiver 2001 infovihtal #6 Primo-infection Primo-infection Le stade qui suit l infection par le VIH est connu sous le nom de primo-infection ou phase aiguë de l infection à VIH. Quand le VIH entre dans l organisme

Plus en détail

TD Révision BIO57. Connaissance et Technique du gène

TD Révision BIO57. Connaissance et Technique du gène TD Révision BIO57 Connaissance et Technique du gène Novembre 2007 Cécile BAUDOT cecile.baudot@medecine.univ-mrs.fr INSERM 910 «Génétique Médicale et Génomique Fonctionnelle» Maladies Neuromusculaires Le

Plus en détail

Macromolécules et la Cellule

Macromolécules et la Cellule Macromolécules et la Cellule Macromolécules Campbell chapitre 5 Macromolécules Définition: Molécule géante formée par l assemblage de plusieurs petites molécules organiques Macromolécules Définition:

Plus en détail

LA SYNTHÈSE DES PROTÉINES

LA SYNTHÈSE DES PROTÉINES LA SYNTHÈSE DES PROTÉINES La transcription Information : dans le noyau (sous forme d'adn) Synthèse des protéines : dans le cytoplasme (au niveau des ribosomes du reticulum endoplasmique) L'ADN ne sort

Plus en détail

Le vivant est complexe: - 30 millions de types d organismes - 100 000 protéines différentes chez l homme

Le vivant est complexe: - 30 millions de types d organismes - 100 000 protéines différentes chez l homme Introduction Le vivant est complexe: - 30 millions de types d organismes - 100 000 protéines différentes chez l homme Informatique: - stocker les données - éditer les données - analyser les données (computational

Plus en détail

Chapitre 2 : Organisation de la cellule

Chapitre 2 : Organisation de la cellule Partie 1 : notions de biologie cellulaire DAEU- Cours Sciences de la Nature & de la Vie- Marc Cantaloube Chapitre 2 : Organisation de la cellule La cellule est l unité de base des êtres vivants. Il existe

Plus en détail

Acides Nucléiques. ADN et ARN Unités de base : les nucléotides donc les nucléotides = monomères ADN et ARN = polynucléotides = polymères

Acides Nucléiques. ADN et ARN Unités de base : les nucléotides donc les nucléotides = monomères ADN et ARN = polynucléotides = polymères Acides Nucléiques ADN et ARN Unités de base : les nucléotides donc les nucléotides = monomères ADN et ARN = polynucléotides = polymères Structure d un nucléotide Tous composés d une base azotée, d un sucre

Plus en détail

Principales techniques utilisées en génie génétique Ces différentes techniques peuvent également se combiner entre elles. Séquençage de l ADN

Principales techniques utilisées en génie génétique Ces différentes techniques peuvent également se combiner entre elles. Séquençage de l ADN Principales techniques utilisées en génie génétique Ces différentes techniques peuvent également se combiner entre elles Séquençage de l ADN 1- Un brin complémentaire de l ADN à séquencer est fabriqué

Plus en détail

Structure générale d'une particule virale de type herpès

Structure générale d'une particule virale de type herpès Virus de type herpès et coquillages 1 - Caractéristiques des virus de type herpès infectant les coquillages Des infections à virus de type herpès sont associées à des mortalités massives chez différentes

Plus en détail

Dans chaque cellule: -génome nucléaire -génome mitochondrial (-génome chloroplastique)

Dans chaque cellule: -génome nucléaire -génome mitochondrial (-génome chloroplastique) 6- Structure et organisation des génomes 6-1 Génomes eucaryotes Dans chaque cellule: -génome nucléaire -génome mitochondrial (-génome chloroplastique) 6-1-1 Génomes nucléaires 6-1-1-1 Nombre d exemplaires

Plus en détail

Méthodes et techniques de la biologie du développement

Méthodes et techniques de la biologie du développement Méthodes et techniques de la biologie du développement 1. Etude de l expression des gènes : Détecter les transcrits et les protéines au cours de l ontogenèse l outil anticorps 1.1. La RT-PCR La réaction

Plus en détail

II. Les lymphocytes T cytotoxiques (T8) : agents du maintien de l'intégrité des populations cellulaires Doc 1 page 396. exercice 3 page 407.

II. Les lymphocytes T cytotoxiques (T8) : agents du maintien de l'intégrité des populations cellulaires Doc 1 page 396. exercice 3 page 407. PB : Comment sont éliminées les cellules reconnues comme étrangères. (infectées, cancéreuses, greffées.) L'organisme dispose d'autres moyens de défense que les anticorps pour se débarasser d'un intrus.

Plus en détail

LES BACTERIOPHAGES. Petit phage à ADN: Phage à ARN:

LES BACTERIOPHAGES. Petit phage à ADN: Phage à ARN: LES BACTERIOPHAGES. Par définition, ce sont les virus des Bactéries. Chaque Bactéries possèdent son propre phage. Ils sont facilement isolables car ils se développent parallèlement aux Bactéries. Ils se

Plus en détail

Chapitre 2 - VARIABILITÉ GÉNÉTIQUE ET MUTATION DE L ADN

Chapitre 2 - VARIABILITÉ GÉNÉTIQUE ET MUTATION DE L ADN Chapitre 2 - VARIABILITÉ GÉNÉTIQUE ET MUTATION DE L ADN Les organismes ne peuvent survivre que si leur ADN est soigneusement répliqué et protégé des altérations chimiques et physiques qui pourraient changer

Plus en détail

Dr E. CHEVRET UE2.1 2013-2014. Aperçu général sur l architecture et les fonctions cellulaires

Dr E. CHEVRET UE2.1 2013-2014. Aperçu général sur l architecture et les fonctions cellulaires Aperçu général sur l architecture et les fonctions cellulaires I. Introduction II. Les microscopes 1. Le microscope optique 2. Le microscope à fluorescence 3. Le microscope confocal 4. Le microscope électronique

Plus en détail

Chapitre 3 Propriétés et Analyses des protéines

Chapitre 3 Propriétés et Analyses des protéines Chapitre 3 Propriétés et Analyses des protéines 1.Isolement des protéines A. Choix d une source de protéines B. Techniques de solubilisation C. Stabilisation des protéines D. Détection des protéines E.

Plus en détail

GUIDE NATIONAL SUR LE DIAGNOSTIC BIOLOGIQUE DE L INFECTION A VIH/sida

GUIDE NATIONAL SUR LE DIAGNOSTIC BIOLOGIQUE DE L INFECTION A VIH/sida REPUBLIQUE ALGERIENNE DEMOCRATIQUE ET POPULAIRE Ministère de la Santé, de la Population et de la Réforme Hospitalière Direction Générale de la Prévention et de la Promotion de la Santé GUIDE NATIONAL SUR

Plus en détail

Série : STL Spécialité biotechnologies SESSION 2014 BACCALAURÉAT TECHNOLOGIQUE

Série : STL Spécialité biotechnologies SESSION 2014 BACCALAURÉAT TECHNOLOGIQUE BACCALAURÉAT TECHNLGIQUE Série : STL Spécialité biotechnologies SESSIN 2014 CBSV : sous épreuve coefficient 4 Biotechnologies : sous épreuve coefficient 4 Durée totale de l épreuve: 4 heures Les sujets

Plus en détail

Chapitre 1. La cellule : unité morphologique et fonctionnelle

Chapitre 1. La cellule : unité morphologique et fonctionnelle Chapitre 1. La cellule : unité morphologique et fonctionnelle 1. Historique de la biologie : Les premières cellules eucaryotes sont apparues il y a 3 milliards d années. Les premiers Homo Sapiens apparaissent

Plus en détail

Comment se manifeste cette maladie? Comment repérer la séropositivité au SIDA? -> Discussion préparatoire.

Comment se manifeste cette maladie? Comment repérer la séropositivité au SIDA? -> Discussion préparatoire. I.7 Immunologie 1/4. Le SIDA Le système immunitaire est l ensemble des cellules et tissus d un individu pouvant s opposer à la pénétration et à l infection par des micro-organismes. Les moyens «de défense»

Plus en détail

POPULATION D ADN COMPLEXE - ADN génomique ou - copie d ARNm = CDNA

POPULATION D ADN COMPLEXE - ADN génomique ou - copie d ARNm = CDNA POPULATION D ADN COMPLEXE - ADN génomique ou - copie d ARNm = CDNA Amplification spécifique Détection spécifique Clonage dans des vecteurs Amplification in vitro PCR Hybridation moléculaire - hôte cellulaire

Plus en détail

L exemple de la détermination de la structure cristallographique de la nucléocapside du bluetongue virus

L exemple de la détermination de la structure cristallographique de la nucléocapside du bluetongue virus J. Phys. IV France 130 (2005) 203 207 C EDP Sciences, Les Ulis DOI: 10.1051/jp4:2005130014 L exemple de la détermination de la structure cristallographique de la nucléocapside du bluetongue virus P. Gouet

Plus en détail

Cours de Biologie Cellulaire L1 2006/2007

Cours de Biologie Cellulaire L1 2006/2007 Cours de Biologie Cellulaire L1 2006/2007 Qu est ce que la biologie cellulaire? La biologie cellulaire étudie les cellules et leurs organites, les processus vitaux qui s'y déroulent ainsi que les mécanismes

Plus en détail

LE VIRUS DE L HEPATITE E O. ROUQUET

LE VIRUS DE L HEPATITE E O. ROUQUET LE VIRUS DE L HEPATITE E O. ROUQUET A Historique L analyse rétrospective de foyers épidémiques d hépatite aiguë non A, non B en Inde laisse supposer l existence d un autre type d hépatite virale. Le virus

Plus en détail

8.3.3 Réactifs. La polymérase catalyse la synthèse de brins complémentaires d ADN.

8.3.3 Réactifs. La polymérase catalyse la synthèse de brins complémentaires d ADN. 8.3.3 Réactifs 1. AD polymérase: La polymérase catalyse la synthèse de brins complémentaires d AD. Des polymérases qui sont résistantes à la chaleur sont utilisées, telles que la Taq polymérase (Thermus

Plus en détail

Université Bordeaux Segalen - PACES 2012-2013 ED UE9s Avril 2013

Université Bordeaux Segalen - PACES 2012-2013 ED UE9s Avril 2013 Sélectionner les propositions exactes Université Bordeaux Segalen - PACES 2012-2013 ED UE9s Avril 2013 QCM 1 La plupart des techniques de biologie moléculaire repose sur le principe de complémentarité

Plus en détail

«La solidarité médicale en action» Infection VIH. Dr Kara Biologiste CH Marc Jacquet 77000 Melun

«La solidarité médicale en action» Infection VIH. Dr Kara Biologiste CH Marc Jacquet 77000 Melun «La solidarité médicale en action» Infection VIH Dr Kara Biologiste CH Marc Jacquet 77000 Melun I. Les rétroviridae Famille des Rétroviridae : 3 sous-familles Spumavirus Oncovirus Lentivirus non pathogènes

Plus en détail

Professeur Joël LUNARDI

Professeur Joël LUNARDI Biochimie - Biologie moléculaire Chapitre 3 : La réplication du matériel génétique Professeur Joël LUNARDI MED@TICE PCEM1 - Année 2006/2007 Faculté de Médecine de Grenoble - Tous droits réservés. Chapitre

Plus en détail

Université Toulouse 3 Paul Sabatier(UT3 Paul Sabatier) Rémi Planès. le 28 octobre 2013. ED BSB: Immunologie. INSERM U1043 Equipe 8(Davrinche/Izopet)

Université Toulouse 3 Paul Sabatier(UT3 Paul Sabatier) Rémi Planès. le 28 octobre 2013. ED BSB: Immunologie. INSERM U1043 Equipe 8(Davrinche/Izopet) Université Toulouse 3 Paul Sabatier(UT3 Paul Sabatier) Rémi Planès le 28 octobre 2013 La protéine Tat du VIH-1 active la voie TLR4: Effets sur l'expression des facteurs immunosuppressifs IL-10, PD-L1 et

Plus en détail

Université Pierre et Marie Curie Master BMC Immunotechnologie. Module Immunothérapie Cellulaire et Génique Bertrand Bellier / François Lemoine

Université Pierre et Marie Curie Master BMC Immunotechnologie. Module Immunothérapie Cellulaire et Génique Bertrand Bellier / François Lemoine Université Pierre et Marie Curie Master BMC Immunotechnologie Module Immunothérapie Cellulaire et Génique Bertrand Bellier / François Lemoine Examen Janvier 2008 Introduction (à lire attentivement) L actualité

Plus en détail

Chapitre 14: La génétique

Chapitre 14: La génétique Chapitre 14: La génétique A) Les gènes et les protéines, ça te gêne? 1) a) Quel est l élément de base des vivants? Les cellules b) Qu a-t-elle en son centre? Un noyau c) Qu y retrouve-t-on sous forme de

Plus en détail

BIOLOGIE MOLECULAIRE ET EXERCICES

BIOLOGIE MOLECULAIRE ET EXERCICES SCEANCE 4 BIOLOGIE MOLECULAIRE ET EXERCICES LA REPLICATION Nous avons vu lors de la séance précédente de biomol les caractéristiques de l ADN et des différents ARN. Nous allons aujourd hui voir la réplication.

Plus en détail

Technologie de l ADN recombinant. Complément de cours sur: «Les Méthodes d Etude de la Cellule»

Technologie de l ADN recombinant. Complément de cours sur: «Les Méthodes d Etude de la Cellule» Technologie de l ADN recombinant Complément de cours sur: «Les Méthodes d Etude de la Cellule» 1 Les techniques de l ADN Recombinant But: isoler des fragments d ADN de génomes complexes et les recombiner

Plus en détail

THEME 1 A EXPRESSION, STABILITE ET VARIATION DU PATRIMOINE GENETIQUE

THEME 1 A EXPRESSION, STABILITE ET VARIATION DU PATRIMOINE GENETIQUE THEME 1 A EXPRESSION, STABILITE ET VARIATION DU PATRIMOINE GENETIQUE CHAPITRE 3 L EXPRESSION DU PATRIMOINE GENETIQUE I. LA RELATION GENES-PROTEINES Les protéines interviennent dans le fonctionnement d

Plus en détail

INVESTIGATIONS TECHNIQUES EN PHYSIOPATHOLOGIE CELLULAIRE ET MOLECULAIRE Partie I. La transfection. Responsable : Valérie Chopin.

INVESTIGATIONS TECHNIQUES EN PHYSIOPATHOLOGIE CELLULAIRE ET MOLECULAIRE Partie I. La transfection. Responsable : Valérie Chopin. INVESTIGATIONS TECHNIQUES EN PHYSIOPATHOLOGIE CELLULAIRE ET MOLECULAIRE Partie I La transfection Responsable : Valérie Chopin LBH semestre 6 Faculté des Sciences Laboratoire de Physiologie Cellulaire et

Plus en détail

Tutoriel pour les enseignants de lycée. Rappel du contenu des programmes au lycée en classe de seconde

Tutoriel pour les enseignants de lycée. Rappel du contenu des programmes au lycée en classe de seconde Tutoriel pour les enseignants de lycée Ce document sert à l enseignant pour préparer différentes séquences pédagogiques afin d aborder : les questions de la génétique, des maladies génétiques, et les métiers

Plus en détail

Réplication de l'adn

Réplication de l'adn 1) réplication chez les procaryotes : Réplication de l'adn - Synthèse de la nouvelle chaîne dans le sens 5'-3' : La synthèse de la nouvelle chaîne d'adn est réalisée par une ADN polymérase, qui ajoute

Plus en détail

L'ADN mitochondrial a été découvert en 1962 par Margit MK Nass et Sylvan Nass par microscopie électronique.

L'ADN mitochondrial a été découvert en 1962 par Margit MK Nass et Sylvan Nass par microscopie électronique. L L'ADN mitochondrial a été découvert en 1962 par Margit MK Nass et Sylvan Nass par microscopie électronique. Figure 1 Mitochondries observées au microscope électronique à transmission Plus tard, cet ADN

Plus en détail

Table des matières. Remerciements, x Avant-Propos, xi Abréviations, xii Guide de l utilisateur, xvi

Table des matières. Remerciements, x Avant-Propos, xi Abréviations, xii Guide de l utilisateur, xvi Table des matières v Remerciements, x Avant-Propos, xi Abréviations, xii Guide de l utilisateur, xvi 1 L immunité innée, 1 Les obstacles externes à l infection, 1 Les cellules phagocytaires tuent les micro-organismes,

Plus en détail

PHENOTYPE - GENOTYPE Le phénotype d un individu : - peut être observé uniquement à l échelle moléculaire et à l échelle cellulaire PROTEINES ENZYMES

PHENOTYPE - GENOTYPE Le phénotype d un individu : - peut être observé uniquement à l échelle moléculaire et à l échelle cellulaire PROTEINES ENZYMES REVISIONS DE 1 S. Vous devez indiquer pour chaque proposition si celle-ci est vraie (V) ou fausse (F) en cochant la case correspondante ; une abstention ou une réponse trop peu lisible seront considérées

Plus en détail

Lettres: A, T, G, C. Mots: à 3 lettres (codons) Phrase: gène (information pour synthétiser une protéine). Ponctuation

Lettres: A, T, G, C. Mots: à 3 lettres (codons) Phrase: gène (information pour synthétiser une protéine). Ponctuation 2- Les molécules d ADN constituent le génome 2-1 La séquence d ADN représente l information génétique Lettres: A, T, G, C Mots: à 3 lettres (codons) Phrase: gène (information pour synthétiser une protéine).

Plus en détail

TRANSCRIPTION TRADUCTION

TRANSCRIPTION TRADUCTION 4 TRANSCRIPTION TRADUCTION Objectifs : définir transcription et traduction et donner leur localisation cellulaire sur un schéma, identifier les acteurs de la transcription (ARNpol, brin transcrit, ARNm)

Plus en détail

LE GENIE GENETIQUE ET LE CLONAGE D'ADN

LE GENIE GENETIQUE ET LE CLONAGE D'ADN LE GENIE GENETIQUE ET LE CLONAGE D'ADN Le génie génétique est un ensemble de techniques de biologie moléculaire permettant d'isoler des gènes spécifiques, de les reconstruire puis de les réinsérer dans

Plus en détail

VIH/SIDA au Burkina Faso : prévention de la transmission verticale mère-enfant et détermination des mutations des gènes gag et pol du VIH-1

VIH/SIDA au Burkina Faso : prévention de la transmission verticale mère-enfant et détermination des mutations des gènes gag et pol du VIH-1 UNIVERSITE DE OUAGADOUGOU DEPARTEMENT DE BIOCHIMIE - MICROBIOLOGIE UNITE DE FORMATION ET DE RECHERCHE EN SCIENCES DE LA VIE ET DE LA TERRE CENTRE MEDICAL SAINT CAMILLE THESE Pour obtenir le grade de DOCTEUR

Plus en détail

Il s'agit d'une proposition de plan, tout autre plan intégrant les idées maîtresses énoncées ci-dessous étant également valable.

Il s'agit d'une proposition de plan, tout autre plan intégrant les idées maîtresses énoncées ci-dessous étant également valable. Rapport concernant le sujet d'écrit de biologie Traiter un sujet de ce type nécessite à la fois : une construction de l'exposé dégageant les idées maîtresses, avec un plan structuré apparent et comportant

Plus en détail

Clonage de Vénus et transformation de E.Coli.

Clonage de Vénus et transformation de E.Coli. Clonage de Vénus et transformation de E.Coli. Samueal Joseph, Romain Laverrière, Elias Laudato, Noé Mage Assisstants : Gisele Dewhurst, Charlotte Gehin, Miwa Umebayashi Résumé [1] L expérience consiste

Plus en détail

Biologie cellulaire. Perfectionnement à la culture cellulaire. Programme. ParTIe PraTIQUe. ParTIe THÉorIQUe. durée : 4 jours

Biologie cellulaire. Perfectionnement à la culture cellulaire. Programme. ParTIe PraTIQUe. ParTIe THÉorIQUe. durée : 4 jours Biologie cellulaire Perfectionnement à la culture cellulaire durée : 4 jours ingénieurs, chercheurs et chefs de projet connaissances de base en culture cellulaire ou validation du module «initiation à

Plus en détail

SCIENCES DE LA VIE ET DE LA TERRE. Durée : 3 heures

SCIENCES DE LA VIE ET DE LA TERRE. Durée : 3 heures Banque «Agro Véto» AT 0109 SCIENCES DE LA VIE ET DE LA TERRE Durée : 3 heures L usage de la calculatrice, d abaques et de tables est interdit pour cette épreuve. Si, au cours de l épreuve, un candidat

Plus en détail

LA PCR QUANTITATIVE EN TEMPS REEL OU LA "TAQMAN"

LA PCR QUANTITATIVE EN TEMPS REEL OU LA TAQMAN LA PCR QUANTITATIVE EN TEMPS REEL OU LA "TAQMAN" I- Terminologie Le terme TaqMan est souvent utilisé par abus de langage pour désigner : - la technique de PCR quantitative par détection en temps réel de

Plus en détail

TSSIBG Immunoglobulines et récepteurs pour l'antigène des lymphocytes B et T

TSSIBG Immunoglobulines et récepteurs pour l'antigène des lymphocytes B et T 14/10/2013 MARIANI Natacha L2 TSSIBG G. Pommier 8 pages TSSIBG Immunoglobulines et récepteurs pour l'antigène des lymphocytes B et T Immunoglobulines (Ig/AC) Récepteurs pour l'antigène des lymphocytes

Plus en détail

Chapitre 1 Acides aminés Protéines Méthodes d étude

Chapitre 1 Acides aminés Protéines Méthodes d étude Chapitre 1 Acides aminés Protéines Méthodes d étude Q1 - Parmi la liste des acides aminés cités ci-dessous, précisez ceux dont la chaîne latérale peut participer dans une structure peptidique, et à ph

Plus en détail

Fiche de présentation

Fiche de présentation Fiche de présentation Classe : 1 ère STL Enseignement : Chimie-biochimie-sciences du vivant THEME du programme : 4 Sous-thème : 4.1 Les propriétés informatives de l ADN sont liées à sa structure Présentation

Plus en détail

Chapitre 4 Les Protéines : définitions et Structures. Professeur Michel SEVE

Chapitre 4 Les Protéines : définitions et Structures. Professeur Michel SEVE UE1: Biomolécules (1) : Acides aminés et protéines Chapitre 4 Les Protéines : définitions et Structures Professeur Michel SEVE Année universitaire 2011/2012 Université Joseph Fourier de Grenoble - Tous

Plus en détail

Cécile DALARD DESS EGPR5 16.12.2004

Cécile DALARD DESS EGPR5 16.12.2004 Cécile DALARD DESS EGPR5 16.12.2004 1 RÉSUMÉ 3 1. INTRODUCTION 2 A. PRÉSENTATION DU VIRUS HIV ET DE LA PROTÉASE HIV 2 B. CARACTÉRISTIQUES DE LA PROTÉASE HIV 2 2. MISE EN ÉVIDENCE DU RÔLE DE LA PROTÉASE

Plus en détail

Cahier de texte de la classe 1 ère 4 - SVT

Cahier de texte de la classe 1 ère 4 - SVT Cahier de texte de la classe 1 ère 4 - SVT DATE SEQUENCE lundi 12 : revoir la fiche méthodologique «utiliser le microscope optique» (disponible sur le site du lycée) Lundi 12 1 er contact avec les élèves.

Plus en détail

Le choix d une stratégie de prévention et du traitement antirétroviral prophylactique dépend avant tout de l état immunovirologique de la mère.

Le choix d une stratégie de prévention et du traitement antirétroviral prophylactique dépend avant tout de l état immunovirologique de la mère. - 1 - Vingt cinq ans après la première manifestation du syndrome d immunodéficience acquise, le SIDA est devenu la maladie la plus dévastatrice que l humanité ait jamais connue. Dans le monde, il figure

Plus en détail

V APPLICATION DES TECHNIQUES DE RET A L ANALYSE DES INTERACTIONS PROTEINE-

V APPLICATION DES TECHNIQUES DE RET A L ANALYSE DES INTERACTIONS PROTEINE- Page : 45/ 77 V APPLICATION DES TECHNIQUES DE RET A L ANALYSE DES INTERACTIONS PROTEINE- PROTEINE : CAS DES RECEPTEURS COUPLES AUX PROTEINES G (RCPG) Les RCPG sont des protéines à sept domaines transmembranaires

Plus en détail

Virus a ARN négatifs (Dans la plupart des groupes viraux on trouve des espéces à génomes segmentés et non-segmentés)

Virus a ARN négatifs (Dans la plupart des groupes viraux on trouve des espéces à génomes segmentés et non-segmentés) Virus a ARN négatifs (Dans la plupart des groupes viraux on trouve des espéces à génomes segmentés et non-segmentés) virus de la grippe (7-8 segments 0.8-2,3 kb) virus de la rougeole, oreillons (1 segment

Plus en détail

Cahier de texte de la classe 1 ère 3 - SVT

Cahier de texte de la classe 1 ère 3 - SVT Cahier de texte de la classe 1 ère 3 - SVT DATE SEQUENCE jeudi 8 : revoir la fiche méthodologique «utiliser le microscope optique» (disponible sur le site du lycée) Jeudi 8 1 er contact avec les élèves.

Plus en détail

Biochimie Mme Botti et Mme tchillian Le 22/10/07 Defresne Diane TD N 3 DE BIOCHIMIE LES ANTICORPS 2

Biochimie Mme Botti et Mme tchillian Le 22/10/07 Defresne Diane TD N 3 DE BIOCHIMIE LES ANTICORPS 2 Biochimie Mme Botti et Mme tchillian Le 22/10/07 Defresne Diane TD N 3 DE BIOCHIMIE LES ANTICORPS 2 1 DOMAINE D UTILISATION DES ANTICORPS IN VITRO ET IN VIVO B)Utilisation des Anticorps in vitro - dosages

Plus en détail

Croissance bactérienne et expression des protéines

Croissance bactérienne et expression des protéines Croissance bactérienne et expression des protéines Stéphane Delbecq Laboratoire de Biologie Cellulaire et Moléculaire EA 4558 «vaccination antiparasitaire» Faculté de Pharmacie sdelbecq@univ-montp1.fr

Plus en détail

TABLE DES MATIÈRES. Avant-propos 11. Remerciements 13. Chapitre 1 - Les molécules organiques 15

TABLE DES MATIÈRES. Avant-propos 11. Remerciements 13. Chapitre 1 - Les molécules organiques 15 TABLE DES MATIÈRES Avant-propos 11 Remerciements 13 Chapitre 1 - Les molécules organiques 15 I. Les glucides 15 1. Les oses ou monosaccarides 15 2. Les diholosides ou disaccharides 15 3. Les polyholosides

Plus en détail

3. L'ARN: Structure, Diffférents Types Et Propriétés tructure assification des ARN ARN ribosoinaux (ARNr) synthétisés dans le noyau

3. L'ARN: Structure, Diffférents Types Et Propriétés tructure assification des ARN ARN ribosoinaux (ARNr) synthétisés dans le noyau 3. L'ARN: Structure, Diffférents Types Et Propriétés Structure Les ARN sont des polymères de RiboNucléotides liés par des liaisons phosophodiester 5'-3'. Les bases azotées sont A-U, C-G. Le sucre est le

Plus en détail

Les objets de l évolution :

Les objets de l évolution : Les objets de l évolution : éléments de biologie cellulaire Table des matières Les 3 règnes et leurs spécificitéss Les cellules procaryotes Les cellules eucaryotes Les cellules végétales Les cellules de

Plus en détail

LES CONSTITUANTS MOLÉCULAIRES DU VIVANT

LES CONSTITUANTS MOLÉCULAIRES DU VIVANT Préparation à l Agrégation Interne Paris VI 2009-2010 Séances des 19 et 23 septembre LES CONSTITUANTS MOLÉCULAIRES DU VIVANT Les mots clés : Lipide, glucide, protide, acide nucléique, monomère, polymère,

Plus en détail

Génie génétique. Définition : Outils nécessaires : Techniques utilisées : Application du génie génétique : - Production de protéines

Génie génétique. Définition : Outils nécessaires : Techniques utilisées : Application du génie génétique : - Production de protéines Génie génétique Définition : Ensemble de méthodes d investigation et d expérimentation sur les gènes. Outils nécessaires : ADN recombinant, enzyme de restriction, vecteur, banque ADNc, sonde nucléique...

Plus en détail

EXERCICES : MECANISMES DE L IMMUNITE : pages 406 407 408 409 410

EXERCICES : MECANISMES DE L IMMUNITE : pages 406 407 408 409 410 EXERCICES : MECANISMES DE L IMMUNITE : pages 406 407 408 409 410 EXERCICE 1 PAGE 406 : EXPERIENCES A INTERPRETER Question : rôles respectifs du thymus et de la moelle osseuse dans la production des lymphocytes.

Plus en détail

Génie de la biocatalyse et génie des procédés. «Production d enzymes industrielles»

Génie de la biocatalyse et génie des procédés. «Production d enzymes industrielles» Ministère de l Enseignement Supérieur et de la Recherche Scientifique Université Virtuelle de Tunis Génie de la biocatalyse et génie des procédés «Production d enzymes industrielles» Concepteur du cours:

Plus en détail

Les méthodes de diagnostic en virologie

Les méthodes de diagnostic en virologie Les méthodes de diagnostic en virologie Pourquoi faire du diagnostic en virologie? Dons de sang, d organes et de tissus (dépistage obligatoire) Suivi biologique des infections (VIH, VHB, VHC) Mesures prophylactiques

Plus en détail