SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimension: px
Commencer à balayer dès la page:

Download "SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville"

Transcription

1 SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville TOERANA ALEHA FIAINGANA ZOTRA RAISINA DESTINATION DEPART TANA LIGNE A PRENDRE A Ambohitrapeto Isotry D Itaosy Itaosy Cite Itaosy Hopitaly Itaosy Ambaniala Itaosy Vinany Itaosy Ankadimanga Tsaralalana A Beravina Itaosy Cnaps Ampefiloha A Ambatofotsy Sud Amboanjobe Tsiafahy Ambatofahavalo Tsinjony Ambatomarobiby Ambohijanaka Ankadivoribe Ankadivorobe EPP Ankaraobato Ifarihy Anosibe Sud Ifarihy Malaho PP Tongarivo Ampanefy PP Soavina Anjomakely Cnaps Ampefiloha 64 F

2 SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville TOERANA ALEHA FIAINGANA ZOTRA RAISINA DESTINATION DEPART TANA LIGNE A PRENDRE Ambodianfotsy Ambodiafontsy Ambohimangidy Ambohimiadana ouest Ampitatafika Ambohitrimanjaka Ampangabe Ampangabe Cnaps Ampefiloha 67ha J B Ambohidratrimo Ivato Ivato Horizon Alakamisy Anosiala Imerimandroso Ivato Imerimandroso Mahitsy Vassacos Antsalovana D D Ambohimangakely Ambodizozoro Behoririka E Ambohimalaza Anjepy Manakavaly Ambanitsena Anjeva Andranosoa Antsahamarina Mahazo 65 E

3 SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville TOERANA ALEHA FIAINGANA ZOTRA RAISINA DESTINATION DEPART TANA LIGNE A PRENDRE Cur Vontovorona Imerintsiatosika Ambatomirahavavy Ambohijafy Ambohijoky Ampilanonana Ampitatafika Antsahadinta Anosibe G Ambohimiadana Anosibe J Ambohimanga Rova Talatavolonondry Ambodivona H Ambatofotsy Nord Ambohitrantenaina Faravohitra Nord Iavoambony Manandriana Talatavolonondry Vilihazo Ambohibary Nord Anosy Faravohitra Antanambao Namehana Ambodivona (St Antoine) H 66

4 SUB URBAIN Ireo zotra manodidina ny renivohitra Les lignes aux alentours de la ville TOERANA ALEHA FIAINGANA ZOTRA RAISINA DESTINATION DEPART TANA LIGNE A PRENDRE Ankadinandriana Ankadindratombo I Ambohimanambola Androrohoro Anjeva Anjeva (Via By Pass) Ambohimanambola Ankadinandriana Ambohimanambola Masindray Alasora Ambohitanety Mahatsinjo Ambohijatovo I Beravina Ankadivoribe Antanetikely Anosizato J Ambohijoky Anosizato G Ambohijanaka Andoharanofotsy F 67

5 REGIONAL & NATIONAL Ireo fiantona fiara rezionaly sy nasionaly Gare routière «Régional» et «National» 70

6 REGIONAL & NATIONAL Ireo fiantona fiara rezionaly sy nasionaly Gare routière «Régional» et «National» GARE AMPASAPITO 71

7 REGIONAL & NATIONAL Ireo fiantsona fiara rezionaly sy nasionaly Gare routière «Régional» et «National» 72

8 REGIONAL & NATIONAL Ireo fiantona fiara rezionaly sy nasionaly Gare routière «Régional» et «National» 73

9 AGENCE DES TRANSPORTS TERRESTRES MASOIVOHO SY SOLONTENAN'NY ATT ANY AMIN'NY FARITANY REPRESENTATIONS & ANTENNES REPRESENTATIONS INTERREGIONALES ANTSIRABE Lot D-350 Ambohimena Sud Tel: TOLIARY Avenue de France Tsimenantse Tel: MAHAJANGA Bâtiment de la DRT Bloc Administratif Tel: ANTSIRANANA Bloc Administratif Tel: FIANARANTSOA 03 Ivory Antsimo Tel: TOAMASINA Ville Eglée Angle Boulevard de la libération et Augagneur Tel: ANTENNES REGIONALES SAMBAVA Bâtiment Enceinte des Travaux Publics Ambositra Tel: MORONDAVA Bâtiment Enceinte des Travaux Publics Avaradrova Tel: AMBATONDRAZAKA Bâtiment Enceinte des Travaux Publics Ambositra Tel: Pour des Transports Terrestres Accessibles, Sécurisés et de Référence 75

10 AGENCE DES TRANSPORTS TERRESTRES IREO TARATASY ANDOAVAMBOLA DROITS A PAYER ACTES ADMINISTRATIFS DROITS Service Exploitation Autorisation Spéciale Autorisation de renfort Ar ( fmg) Licences 9 à 15 places 16 à 30 places Plus de trente places Ar ( fmg) Ar ( fmg) Ar ( fmg) Permis de conduire Droit Ar ( fmg) ARRÊT MAHAZO 76

11 AGENCE DES TRANSPORTS TERRESTRES FAHAZOAN-DALANA MANOKANA AUTORISATION SPECIALE DE TRANSPORT PUBLIC ROUTIER DE VOYAGEURS Demande d autorisation spéciale (en deux exemplaires) -Signée par le demandeur, -Visée par le président de la coopérative Photocopie de: -La licence en cours de validité, -La carte grise, -La carte violette en cours de validité, -La patente en cours de validité, -L attestation d assurance en cours de validité. Liste des passagers (Pour la destination plus de 100km) -Visée par le responsable de la coopérative, -Arrêtée par l ATT Droit: Ariary Validité: (Quinze) 15 jours, un aller et un retour. Délai de traitement de dossier: une journée Agence des Transports Terrestres (A.T.T) Lot IIE 2CG Iadiambola Ampasampito Antananarivo Tel: (261) / (261)

12 AGENCE DES TRANSPORTS TERRESTRES FANGATAHANA FAHAZOAN-DALANA MITATITRA DEMANDE DE LICENCE D EXPLOITATION NOUVELLE DEMANDE - demande de licence (double exemplaires) - présentation de la carte grise originale Copie de : - la carte grise, - la carte violette ou procès verbal de la réception technique, - certificat de résidence, - la patente, - l attestation d assurance. RENOUVELLEMENT - demande de licence (double exemplaires), - licence originale ou attestation de dépôt de licence, - lettre de démission (changement de coopérative), Copie de : - la carte grise, - la carte violette ou procès verbal de réception technique, - la patente, - l attestation d assurance. RENOUVELLEMENT Lettre de démission signée par le propriétaire, visée par le Président de la Coopérative ou par le Président du Conseil d Administration de la Coopérative, Licence Originale. 78

13 AGENCE DES TRANSPORTS TERRESTRES IREO TARATASY ANDOAVA-BOLA TARIFS DES DROITS A PAYER DROITS AUTORISATION D EXPLOITER TARIFS Ar LICENCE D EXPLOITATION Véhicule de transport routier en commun de voyageurs : 9 à 15 places 16 à 30 places 31 et plus Ar Ar Ar AUGMENTATION DU NOMBRE DE PLACES (Zone Régionale) 15 à 18 places Ar AUTORISATION SPECIALE Ar N.B : L Autorisation spéciale relative au transport de dépouille mortelle est délivrée gratuitement sur présentation de pièces justificatives. Agence des Transports Terrestres (A.T.T) Lot IIE 2CG Iadiambola Ampasampito Antananarivo Tel: (261) / (261)

14 Fandikan-dalana mateti-pitranga Infractions routières fréquentes Fandikan-dalana mitarika fandoavana lamandy raikitra Infractions entrainant une amende SAZY: heloka maivana mitarika famaizana tsotra PEINE: Contravention Toetoetry ny fandikan-dalana Tsy fanidiana ny varavarana ampandehanana na fidinana ny fiara amin'ny fomba na fotoana mampidi-doza Nature de l infraction Occupation d'un véhicule ouvrant une portière ou descendant sans s'assurer qu'il peut le faire sans danger Onitra Amende Ar 500 Fandikana na fanitsahana ny tsipika mitohy Mpamily manao "demi-tour" ao anatin'ny tanàna Fandaozana ny fiara misy fahasimbana Takelaka misy ny laharan'ny fiara tsy araka ny tokony ho izy Fijanonana maharitra na fiatoana eo amin'ny arabe misy sisin-dalana ahafahana manao izany Tsy fisian'ny "essuie glace" amin'ny "pare-brise" Varavarana misokatra eny am-pandehanana Fiara mihoatra ny 3,5 T tsy misy takelaby fanairana Entana eo ambony fiara mihaotra ny 0,80 m ny haavony Franchissement ou chevauchement d'une ligne continue Conducteur effectuant un demi-tour dans une agglomération Abandon d'un véhicule par suite d'une panne mécanique Plaque d'immatriculation non-conforme Stationnement ou arrêt sur la chaussée lorsque l'accotement le permet Défaut d'essuie glace au pare-brise Portière non fermée en marche Défaut des appareils de pré signalisation sur véhicule de plus de 3,5 T Chargement sur le toit des véhicules dépassant 0,80 m de hauteur Ar

15 Toetoetry ny fandikan-dalana Fandikan-dalana mateti-pitranga Infractions routières fréquentes Nature de l infraction Onitra Amende Tsy fananana kodiarana fanolo ara-dalàna Isan'ny mpandeha mihoatra ny isa voafetran'ny karatra volom-parasy Fijanonana ambony "trottoir" Tsy fisian'ny jiro famantarana Tsy fisian'ny "rettroviseur" Occupation d'un véhicule ouvrant une portière ou descendant sans s'assurer qu'il peut le faire sans danger Voyageurs en nombre excédant le chiffre fixé par la carte viollette Stationnement sur le trottoir Défaut de feux de position Défaut de miroir de rétroviseur Ar 1000 Fivilian-dalana tsy misy fampiomanana Fiara ratsy fipetraka Fibahanan-dalana Tsy fanajana ny filazana fiatoana (Stop) Fijanonan ny fiara amin ny sisin ny arabe amin ny andaniny roa Fiara ratsy fipetraka Fijanonana eny amin ny toerana natokana ho an ny taxi be sy taxi Fandikana ny fandraràna ny fiviliana miankavia na miankavanana Kodiarana sola na malama Fandehanana amin ny lalana voarara Changement de direction sans avertir Stationnement interdit Embaras sur la voie publique Non-respect du stop Stationnement en double file Vehicule mal garé Stationnement à un emplacement resevé pour bus et taxis Défense de tourner à gauche ou à droite Bandage pneumatique lisse Usage d'un sens interdit Ar

16 Toetoetry ny fandikan-dalana Fandikan-dalana mateti-pitranga Infractions routières fréquentes Nature de l infraction Onitra Amende Fitondrana mpandeha mitsangana mihoatra ny isa voatondro Fandehanana mafy loatra tsy araka izay voafetran ny lalana Tsy fampiasan ny fiara vaventy ny telozoro famantarana rehefa hijanona ivelan ny tanàna amin ny alina Fisongonana mampidi-doza Tsy fisian'ny jiro mitsitapitapy manondro fiviliana (clignotant) Fampiasana finday mandritra ny familiana fiara na mijanona ka tsy maty motera Fitaratra fiara miloko tsy ahitana izay ao anaty na tsy ahafahana mahita izay ao anatiny afa-tsy ireo sokajin'ireo olona sasany voalzan'ny lalàna Fijanonana amin'ny toerana saro-pady (foto-drafitr'asa, tetezana, tonelina, lalamby manapaka) Tsy fametahana ny fehikibo fiarovana na ho an'ny mpamily na ny mpandeha mandritra ny fivezivezen'ny fiara anaty na ivelan'ny tanàna Fametrahana zaza latsaky ny 5 taona eo amin'ny seza aloha amin'ny fiara Voyageurs debout en nombre excédant du nombre indiqué Vitesse excessive dans le cas où elle doit être limitée Absence d'un triangle de présignalisation la nuit pour vehicule poids lourds en dehors des agglomérations Changement important de direction sans avertissement préalable Absence d'indicateur de changement de direction Usage du téléphone ou portable par le conducteur d'un véhicule en marche ou quand le moteur est allumé Vitre d'un véhicule fumée non limpide et transparente sauf pour certaines catégories de personnes selon le texte Stationnement sur une voie matérialisée (ouvrage d'art, pont, tunnel, passage à niveau) Défaut de port de ceinture de sécurité pour tout conducteur ou passager d'un véhicule, à l'interieur comme en déhors des agglomérations Transport d'enfant de moins de cinq ans aux places avant des véhicules automobiles Ar

17 Fandikan-dalana mateti-pitranga Infractions routières fréquentes Ireo fandikana lalàna mitarika figiazana ny fiara tsy hivezivezy na hihetsika SAZY: Heloka maivana mitarika famaizana tsotra PEINE: Contravention Toetoetry ny fandikan-dalana Onitra Amende Fiara mandeha alina tsy misy jiro R 289/13 NR 275 R 306 Fitondrana fiara ao anatin'ny hamamoana PV noho ny zava-mahadomelina Setroka mainty na entona mandoto, feo manelingelina, tsy fisiana famafàna fitaratra PV Ireo fandikana lalàna mitarika figiazana ny fiara tsy hivezivezy na hihetsika SAZY: Heloka tsotra mitarika famaizana tsotra (trano maizina) PEINE: Contravention Toetoetry ny fandikan-dalana Fijanonana eo amin'ny toerana izay tsy ampy ny fahitana (fiakarana, fialana lalam-by) Fijanonana mandritra ny fotoana fohy na maharitra amin'ny arabe nefa misy sisin-dàlana ahafahana manao izany Onitra Amende R 313 R 289/11 R 275 R 313 R 276 Tsy fisian'ny taratasy fahazoan-dàlana mitatitra ho an'ny fiara manao izany L 10 L 14 Tsy manana taratasy nahavitana fitsirihana teknika Tsy fananana volom-parasy (carte violette) fahazoan-dàlana hitatitra vahoaka (tsy azo afangaro amin'ny tsy fampisehoana azy). R 284 L 10 L 14 Tsy fananana fahazoan-dàlana hitatitra (patente) Tsy fananana taratasy fanamarinana ny fiatohana na fiantohana lany daty. 83

18 Fandikan-dalana mateti-pitranga Infractions routières fréquentes Ireo fandikana lalàna mitarika figiazana ny fiara tsy hivezivezy na hihetsika SAZY: Heloka maivana mitarika famaizana tsotra PEINE: Contravention Toetoetry ny fandikan-dalana Onitra Amende Mpandeha na olona tanterina tandidomin-doza Fitanterana mpandeha an-tsokosoko Tsy fanànana fahazoan-dàlana miasa (licence) Art 23 Arrêté 2097/98 du 23/03/98 Art 23 Arrêté 2097/98 du 23/03/98 Arrêté 2097/98 du 23/03/98 Tsy fanajana ny lalàna tokony halehan'ny zotra fitanterana, fihoarana ny zotra misy ny fiara (violation de ligne) Tsy fisian'ny hetra aro loza amin'ny seza alohan'ny fiara Fandikan-dalàna mateti-pitranga mitarika fitanàna an-tsoratra (P.V) SAZY: Heloka tsotra mitarika famaizana ts otra (trano maizina) Onitra Toetoetry ny fandikan-dalana PEINE: Contravention Amende Tsy misy taratasy fanamarinana fiantohana (assurance) na ifantohana efa lany daty Ord du 03/10/60 art.5 Tsy fijanonana iniana atao L 4 R 289/2 L 14 Fahazoan-dàlana mitondra fiara lany andro (Sokajy D) L12 L 14 R

19 Fandikan-dalana mateti-pitranga Infractions routières fréquentes Fandikan-dalàna mety mitarika fisintonana fahazoan-dàlana mamily fiara SAZY: Heloka maivana mitarika famaizana tsotra PEINE: Contravention Toetoetry ny fandikan-dalana Onitra Amende Fahazoan-dàlana mitondra fiara tsy misy ny takelaka fanoratana ny fahadisoana (volet des infractions) Tsy fanajana fiara tokony handeha avy hatrany (priorité) Fijanonana maharitra na malaky amin'ny toerana mampidi-doza R 104 R 106 R 275 R 313 R 289/11 R 275 Fandikan-dalàna mahatonga ny fitazoanana ny fiara any amin ny toby SAZY: PV miaraka amin'ny fampidirana fourrière ny fiara - Fandehanana mafy loatra mihoatra ny mety - Fitondrana ny fiara ao anatin'ny hamamoana - Fijanonana ambony tetezana - Fitanterana olona tsy ara-dalàna, jono botry - Fijanonana an-tampo-mpiakarana - Fijanonana anaty fiholanana - Fangalarana zotra ho an'ny fiara mpitatitra FAHADISOANA SAZY Fitondrana fiara anatin'ny hamamoana Fitanana an-tsoratra + mety hiafara amin'ny fisintonana permis Fitondrana fiarakodia ao anatin'ny hamamoana ka nitera-doza Fitazoanana ny fiara any amin ny toby = 600 Ar x tanjaky ny fiara Mise en fourrière = 600 Ar x nombre de chevaux 85 BAC + fanolorana eny amin'ny fitsarana + mety hiafara amin'ny fisintonana permis

20 Fandikan-dalana mateti-pitranga Infractions routières fréquentes Fandikan-dalana ka mahatonga ny fitazonana ny fiara any amin ny toby Les infractions courantes au code de la rou entrainant une mise en fourrière du véhicule Andininy 313 amin'ny fitsipika mifehy ny fifamoivoizana/article 313 du Code de la Route Didy navoakan'ny fiadidina ny tanàna / Arrêté Municipal FANDIKAN-DALANA INFRACTIONS SAZY SANCTIONS Fandehanana mafy loatra mihoatra ny mety Fitondrana ny fiara ao anatin'ny hamamoana Fijanonana ambony tetezana Fitanterana olona tsy ara-dalàna, jono botry Fijanonana an-tampo-mpiakarana Fijanonana anaty fiholanana Fangalarana zotra ho an'ny fiara mpitatitra Fitondrana fiara anatin'ny hamamoana Fitondrana fiarakodia ao anatin'ny hamamoana ka nitera-doza Excès de vitesse Conduite en état d'ivresse Stationnement sur un pont Transport clandestin Stationnement au sommet de côte Stationnement dans un virage Violation de ligne Conduite en état d'ivresse sans accident Conduite en état d'ivresse avec acident PV miaraka amin'ny fampidirana fourrière ny fiara - PV avec mise en fourrière du véhicule PV + proposition de retrait de permis de conduire Enquête BAC + déferrement + proposition de retrait de permis de conduire Ny tsy fandoavana ny onitra voatondro ho efaina ao anatin'ny 48 ora dia miafara amin'ny fampidirana fourrière ny fiara. 86

21 AGENCE DES TRANSPORTS TERRESTRES Lot IIE 2CG Iadiambola Ampasampito Antananarivo Tel: (261) / (261) Pour des transports terrestres accessibles, sécurisés et de référence

22 TORO-LALANA Toromarika hatsipy ho antsika mpandeha an-tongotra mba isorohana ny lozam-pifamoivozana. RY MPANDEHA AN-TONGOTRA -TANTANO NY ANKIZY REHEFA MIAMPITA -NY OLON-DEHBE NO MANAKAIKY NY ARABE FA NY ANKIZY TANTANANA NO AVY AO AN-TSISINY -NY ARABE DIA NATOKANA HANDEHANAN NY FIARA FA TSY TOERAM-PILA- LAOVAN NY ANKIZY -MANANTONA NY TOERANA VOATOKANA «Passage zébré» REHEFA IAMPITA ARABE -NY ARABE DIA VOATOKANA HO AN NY FIARA RAHA NY «TROITOIR» KOSA NO NATOKANA HO ANTSIKA MANDEHA AN-TONGOTRA «Ny aina tsy ananam-piry koa aleo misoroka toy izay mitsabo» Arrêt Anosy 88

23 TORO-LALANA Signaux routires les plus fréquents Sens interdit à tout véhicule Arrêt et stationnement interdits Stationnement interdit Endroit fréquenté par des enfants Passage pour piéton Cédez le passage à l intersection. Signal de position Balise pour passage à niveau Signalisation de position des intersections de routes 89 Balisage des virages

24 VONJEO! Ireo fihetsika mahavonjy raha misy lozam-pifamoivozana A Fomba fiantsoana ny Mpamonjy voina : 1- Tenenina ny LAHARAN NY FINDAY IZAY HIANTSOANA, miaraka amin ny anarana 2- NY ANTON NY OLANA : aretina na loza 3- NY METY HO VOKA-DRATSIN NY LOZA : zavatra mirehitra, fipoahana, fihotsahana zavatra, entona simika, na loza hafa 4- TOERANA MARINA nisehon ny loza 5- ISAN NY OLONA voakasika 6- NY ZAVATRA EFA NATAO tamin ilay olona niaram-boina ary famalina ny fanontaniana izay hapetrakin ny mpamonjy voina B Ny tokony hatao raha toa ka :. Misy olona hiaran ny dona mafy 1- Tsy tokony hetsehina ilay niaran-doza 2- Atsotra eo amin ny toerana mandry tsara 3- Torona hevitra ilay maratra mba tsy hihetsika, indrindra ny manetsika ny lohany.tsy azo esorina ny «casque» (raha loza azo avy amin ny fitondrana «moto») 4-Tazomina amin ny felan-tanana atao eo amin ny andaniny roa ny lohany (sary lah.01) 5- Antsoina haingana ny mpamonjy voina 6- Arahi-maso hatrany ilay niaram-boina. Isakin ny 2 minitra fara fahakeliny dia resahina sy anontanina izy : - Raha mahatsiaro-tena izy ka miresaka, dia arahi-maso hatrany, hazavaina aminy ny zava-misy mba hampitony azy - Raha tsy miresaka intsony izy dia atao izay tokony atao manoloana izany : HANTSOINA INDRAY NY MPAMONJY VOINA AMIN NY FIOMBON NY TOE-JAVATRA 90 Sary lah.01

25 VONJEO! Les gestes de premiers secours en cas d accident de la route A Procédure appel pompiers: 1- NUMERO DU TELEPHONE d où l on appelle, si nécessaire donner son nom 2- NATURE DU PROBLEME, maladie ou accidents 3- RISQUES éventuels : incendie, explosion, effondrement, produits chimiques et tout autre danger 4- LOCALISATION très précise de l événement 5- NOMBRE de personnes concernées 6- Appréciation de la GRAVITE de l état de chaque victime 7- PREMIERES MESURES PRISES ET GESTES EFFECTUES ;et répondre aux questions qui lui seront posées par les secours ou par un médecin B. Choc Comment réagir en cas de: 1- Ne jamais mobiliser la victime 2- Allonger par terre ou surface plane 3- Conseiller fermement au blessé de ne faire aucun mouvement en particulier de la tête (ne pas retirer le casque si accident moto) 4- Maintenir la tête avec les deux mains placées de chaque côté de celle-ci ; le sauveteur est à genoux derrière le blessé (image n 01) 5- Faire alerter les secours d urgence 6- Surveiller la victime de manière continue, toutes les 2 minutes au moins, lui parler, l interroger : - Si elle parle, elle est consciente, poursuivre la surveillance et lui expliquer ce qui se passe pour la réconforter - Si elle ne répond plus, pratiquer les gestes qui peuvent alors s imposer: SIGNALER L AGRAVATION EN APPELANT LES SECOURS Image n 01 91

26 VONJEO! Ireo fihetsika mahavonjy raha misy lozampifamoivozana. Misy olona mande-ra tsy mijanona: atao izay ijanonany alohan ny 2 mn 1- Jerena oe aiza ny misy ny fandehanan ny rà tsy mijanona 2- Hajanona ny fandehanan ny rà : -Tapenana avy hatrany amin ny tanana voaaro (gant, sachet) eo amin ny ilay faritra mande-rà -Ajanona avy aty alavitra ny fandehanan ny rà : - Eo amban ny tenda (sary lah.02) - Eo amin ny sandry (sary lah.03) - Eo amin ny foto-pe (sary lah.04) Raha tsy mahomby ireo fihetsika ireo ka mbola mande-rà tsy mijanona dia atao «garrot» (fatoranana eo amin ny sandry na ny fe)ilay olona. 3- Hampandrina mitsilany ilay maratra 4- Miantso ny mpamonjy voina na mampiantso ny Hamarino fa mijanona ilay «hémorragie» dia resaho tsy hankiato ilay marary eo ampiandrasana ny mpamonjy voina 6-Tsy azo omena rano ny marary mandrapahatonga any amin ny dokotera Raha anao fanofanana vonjy voina ianao dia manatona ny mpamonjy voiana etsy Tsaralalàna Antananarivo na antsoy ny laharana: / Sary lah.02 Sary lah.03 Sary lah.04 Lahy tokana ny aina, koa samia isika mitandrina! 92

27 VONJEO! Les gestes de premiers secours en cas d accident de la route. Hémorragie: arrêter avant 2 mn 1- Constater l hémorragie 2- Stopper l'hémorragie: -Réaliser une compression directe de l endroit qui saigne ; -Réaliser une compression à distance à l aide d un point de compression: -A la base du cou (image n 02) -A la face interne du bras (image n 03) -Au pli de l aine (image n 04) Si la compression directe est impossible ou inefficace : réaliser un garrot si le point de compression est impossible ou inefficace. 3- Allonger la victime en position horizontale 4- Donner l alerte ou mieux, faire donner l alerte en appelant le Vérifier que l hémorragie est arrêtée et parler régulièrement à la victime en attendant les secours 6- Ne pas donner à boire au malade avant son arrivé à l hopital Pour une formation en secourisme, contactez les pompiers au : / Image n 02 Image n 03 Image n 04 La santé est plus précieuse que l'or! 93

28 MAHASOA Ireo laharan-tarobia mety ilaina Les numeros utiles MPAMONJY VOINA/POMPIER 118 (Telma, Airtel,Orange) Zone d intervention: 6 arrondissements Disponible 24h/24h, 7j/7j Gratuit HÔPITALY SY KLINIKA/ HÔPITAL ET CLINIQUE Centre hospitalier de Soavinandrina (HOMI) : Hopital Andravoangy Andrianavalona HJRA : Hopital Général de Befelatanana : Pavion Sainte Fleur : Clinique et Maternité MM : Clinique et Maternité Marie Stopes Avaradoha : ZANDARY SY TOBY/ GENDARMERIE ET CASERNE Toby Ratsimandrava : Commissariat Mahamasina : / Brigade Aeroport Ivato : Hotel central de la police : 017 / / Brigade Criminelle : / / Groupe d intervention rapide : / Service Anti-gang (SAG) : Jiro sy Rano Malagasy/ JIRAMA Telma (Fixe et mobile): (22) Airtel: Orange:

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015

Octobre 2015. Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Octobre 2015 Latrines mini-septiques Tamatave-Fokontany Dépôt Analakininina 2015 Tamatave, une ville côtière de 270.000 habitants 1 12 personnes partagent une latrine 8000 personnes ne sont pas encore

Plus en détail

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE»

TERMES DE REFERENCE «CREATION DU LOGO ET DU SLOGAN DE LA COORDINATION NATIONALE DE LA MICROFINANCE» REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES FINANCES ET DU BUDGET SECRETARIAT GENERAL DIRECTION GENERALE DU TRESOR Coordination Nationale de la MicroFinance TERMES DE REFERENCE

Plus en détail

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées)

MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) MANUEL D UTILISATION «ROHI» (RessOurces Humaines Informatisées) Mai 2015 CONTEXTE De nos jours, l'etat ne peut plus affirmer l'effectif exact des fonctionnaires du fait de traitement manuel des opérations

Plus en détail

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois

Décret n 76-132 du 31 mars 1976. Didim-panjakana n 76-132. tamin ny 31 marsa 1976. portant réglementation des hauts emplois Décret n 76-132 du 31 mars 1976 portant réglementation des hauts emplois de l'etat (J.O. n 1129 du 05.06.76, p. 1333) Didim-panjakana n 76-132 tamin ny 31 marsa 1976 anoritana ny fitsipika mifehy ny asampanjakana

Plus en détail

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994.

Art. 8. Sont abrogées les dispositions des arrêtés n 1937/94 et 4367/94 en date des 5 mai 1994 et 28 septembre 1994. VII.13. ARRETE N 2971/95 du 13 juin 1995 fixant les modalités d application du décret n 95-082 du 24 janvier 1995 portant réglementation des comptes en devises, (J.O. n 2707, du 26/06/95, p.1398) modifié

Plus en détail

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana

PCDEA Vohilengo. Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana PCDEA Vohilengo Fanolorana ny drafitr asa fampandrosoana ny rano sy ny fahadiovana Jery todika ny fanangonana ny antontan-kevitra 1. Fanaovana fanadihana fanangonana ny antontan-kevitra Fivoriana teny

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY

REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana MINISTERAN NY ANGOVO SY NY HARENA ANKIBON NY TANY DIDIM-PANJAKANA LAHARANA FAHA-2006-910 mamaritra ny fepetra ampiharana ny Lalàna laharana

Plus en détail

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny

III.2. DIDIM-PANJAKANA N 95-326 tamin ny 3 mey 1995 mikasika ny fananganana ny III.2. DECRET N 95-326 du 3 mai 1995 portant création du Comptoir de l Or (J.O. n 2329 du 23.1.95, p. 2733) TITRE PREMIER : GENERALITES. CHAPITRE PREMIER : CREATION ET ATTRIBUTIONS. Article premier. Le

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-038 DU 14 JANVIER 2008 modifiant et complétant certaines dispositions du Code

Plus en détail

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004

FIOFANANA NATAO HO AN'IREO TOMPON'ANDRAIKITRA AO AMIN'NY FIKAMBANAN'NY MPAMPIASA RANO NANAOVANA FAMINDRAM-PINTANTANANA ETO AMIN'NY PADANE TAONA 2004 REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MNSISTERE DE L'AGRICULTURE DE L'ELEVAGE ET DE LA PECHE SECRETARIAT GENERAL PROJET D'AMELIORATION ET DE DEVELOPPEMENT AGRICOLE DANS LE NORD

Plus en détail

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA REPOBLIKAN'I MADAGASIKARA. Tanindrazana Fahafahana Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana FIADIDIANA NY REPOBLIKA REPOBLIKAN'I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana FIADIDIANA NY REPOBLIKA LOI N 2004 020 du 19 août

Plus en détail

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina.

FIVORIAMBE. FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: Andriamatoa isany - HELSON Brisson Erafa - LIAHOSOA Malement FOTOANA: Alakamisy 12 Febroary 2015, tamin ny 9 ora sy 55 minitra, maraina. FANDAHARAM-POTOANA:

Plus en détail

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA

REPOBLIKAN I MADAGASIKARA PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN I MADAGASIKARA FIADIDIANA NY REPOBLIKA REPOBLIKAN I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana PRESIDENCE DE LA REPUBLIQUE LOI N 2001-025 relative au tribunal administratif et au tribunal financier modifié par la loi n 2004-021 du

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA.

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana MINISTERE DES EAUX ET FORETS MINISITERAN'NY RANO SY ALA. Thème : Législation forestière N 1 Faha : 1 DECRET N _98-781 fixant les conditions

Plus en détail

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT

Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT Validation en langue malgache - IEN Secteur Océan Indien LIVRET DE L ENSEIGNANT 5 - A 1 Exercice 1 NIVEAU A 1 Fifampiarahabana (Salutations) Communiquer, au besoin avec des pauses pour chercher ses mots.

Plus en détail

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg

UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail <ugbm@wanadoo.mg 0 UNION DES GROUPES BIBLIQUES DE MADAGASCAR BP - 101 Antananarivo - Tél 22 612 38 /033 11 832 26 E-mail

Plus en détail

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana...

FOTOPOTOTRY NY FIVORIANA. Natao ny. Alarobia 2 Desambra 2015. Tolak andro. Pejy - Fitohizan ny fivoriana... 01. - Fiantsoana anarana... FOTOPOTOTRY NY FIVORIANA Natao ny Alarobia 2 Desambra 2015 Tolak andro Pejy - Fitohizan ny fivoriana... 01 - Fiantsoana anarana... 02 - Famakiana ny taratasy laharana faha-065-ceni/15 milaza ny tsy fahafahana

Plus en détail

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache)

Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Module 13 Fiofanana 5S eo amin ny sehatry ny Fahasalamana Modules de la formation pour le Personnel d appui (module en Malgache) Ministère de la santé publique à Madagascar Mars 2015 Appui par JICA Madagascar

Plus en détail

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7

ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO. Collection Bel Avenir Conte nº 7 ET LES FEUILLES DE MORINGA BALITA SY NY ANANAMBO Collection Bel Avenir Conte nº 7 La collection des livres de contes Bel Avenir mise en place par l ONG BEL AVENIR située à Tuléar a comme objectif afin

Plus en détail

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE

REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana ------------ MINISTERE DE L'ENVIRONNEMENT, DES EAUX ET FORETS DECRET MECIE Didim-panjakana laharana faha 99-954 tamin'ny 15 desambra 1999

Plus en détail

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit

Flash. Prix de l entrepreneur Social. Du nouveau pour l adresse e-mail de Orange. Sommaire. gratuit masolavitra mensuel d informations régionales 10è édition - Septembre 2011 gratuit Flash Prix de l entrepreneur Social Nouvelle date pour déposer son dossier Suite à de nombreuses demandes reçues de candidats

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS

REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana. LOI n 2006-028 EXPOSE DES MOTIFS REPOBLIKAN I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana LOI n 2006-028 autorisant la ratification de l Accord conclu le 29 septembre 2005 entre le Gouvernement de la République de Madagascar et l

Plus en détail

La FFCT c est : la randonnée en sécurité

La FFCT c est : la randonnée en sécurité La FFCT c est : la randonnée en sécurité Sécurité à vélo Les bons réflexes pour tous! Un vélo bien équipé Ce qui est obligatoire : une sonnette dont le son peut être entendu à 50 m au moins, deux freins

Plus en détail

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA

Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA REPOBLIKAN'I MADAGASIKARA Tanindrazana Fahafahana Fandrosoana PRIMATURE MINISTERAN NY FITANTANAM-BOLA SY NY FAMPIROBOROBOANA NY FARITANY MIZAKA TENA TOROLALANA HO AN NY BEN NY TANANA FIIARAHA--MIIASA "GOVERNEMANTA

Plus en détail

1 of 29 15/12/2008 08:43

1 of 29 15/12/2008 08:43 1 of 29 15/12/2008 08:43 Loi n 94-029 du 25 août 1995 portant Code du traail (J.O. n 2324 du 25.9.95, p.2564) TITRE PREMIER DISPOSITIONS GENERALES Article premier - La présente loi est applicable à tous

Plus en détail

1000 TEXTES mis à jour au 31 décembre 2001

1000 TEXTES mis à jour au 31 décembre 2001 REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Code du travail 1000 TEXTES mis à jour au 31 décembre 2001 DROIT DU TRAVAIL 2 Textes législatifs et réglementaires

Plus en détail

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce

Tanindrazana-Fahafahana-Fandrosoana. Tanindrazana-Fahafahana-Fandrosoana --------- LOI N 2003-038 du 03 septembre 2004. sur le fonds de commerce LOI N 2003-038 du 03 septembre 2004 sur le fonds de commerce (J.O. n 2939 du 08.11.04, p. 4259) REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana --------- PRESIDENCE DE LA REPUBLIQUE REPOBLIKAN

Plus en détail

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire

masolavitra gratuit mensuel d informations régionales 12è édition - nov 2011 Sommaire masolavitra mensuel d informations régionales 12è édition - nov 2011 gratuit Sommaire P 8 P 7 : P 6 P 2-3 : Un meilleur avenir grâce à une éducation de qualité p. 4-5 : En images Développement durable,

Plus en détail

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante.

LE LABORATOIRE UN SERVICE INDEPENDANT. Fanovana amin ny tsara kokoa. Road Show avec Rajao. Une usine en amélioration constante. ANNEE 1 NUMERO 2 GRATUIT SEPTEMBRE 2013 Fanovana amin ny tsara kokoa Road Show avec Rajao L usine Socolait Une usine en amélioration constante LE LABORATOIRE UN SERVICE INDEPENDANT L édito Mety hanaitra

Plus en détail

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC

REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1000 TEXTES. mis à jour au 31 décembre 2001 DROIT PUBLIC REPUBLIQUE DE MADAGASCAR TANINDRAZANA FAHAFAHANA FANDROSOANA MINISTERE DE LA JUSTICE 1 Constitution DROIT PUBLIC 1.1 Constitution 1992-1998 1.2 Pouvoirs constitutionnels 2 Libertés publiques 2.1 Droits

Plus en détail

Note pratique. Réseau PRATIQUES

Note pratique. Réseau PRATIQUES Note pratique Ny Herin ny hafatra / Le pouvoir des messages pour la santé préventive Expérience du programme de santé materno-infantile mené par Inter Aide à Farafangana, Madagascar Notice Type de document

Plus en détail

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS

LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS LOI N 67-030 DU 18 DECEMBRE 1967 RELATIVE AUX REGIMES MATRIMONIAUX ET A LA FORME DES TESTAMENTS (J.O. n 569 du 23.12.67, p. 2080 ; Errata : J.O. du 13.01.68, p. 44) modifiée par la loi n 68-012 du 4 juillet

Plus en détail

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012

masolavitra gratuit mensuel d informations régionales 14è édition - janvier 2012 masolavitra mensuel d informations régionales 14è édition - janvier 2012 gratuit Bonjour! Nous voici déjà en 2012 et c est avec un immense plaisir que nous vous présentons nos vœux les meilleurs pour cette

Plus en détail

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010

Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Augustin Andriamananoro, dans son bureau ministériel, ce 26 mai 2010 Qu est-ce qu on ne raconte pas sur certains ministres qui n ont plus été reconduits au sein du gouvernement Vital II. Cela n a qu une

Plus en détail

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE

ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE ETUDE D IMPACT ENVIRONNEMENTAL ET SOCIAL FAMINTININA TSY ARA-TEKNIKA RESUME NON TECHNIQUE Juin 2014 Résumé non technique - Juin 2014 TABLE DES MATIERES... 1 2. RESUME NON TECHNIQUE... 22 LISTE DES FIGURES

Plus en détail

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY

FTMT NTA AIiI.ÎSONAINA Ni TTYORIA}IBE. ffipffi,w!'ffi;tr;[ffimffi9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY T " Ël ffipffi,w!'ffi;tr;[ffimffi"9 ffiif;* REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN-DALANA VOALOHANY FOTOAM-PIVOR IANA ARA.POTOANA VOALOHANY TAONA 20'14 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX

Plus en détail

- 47 - TABLEAU COMPARATIF. Texte de la proposition de loi

- 47 - TABLEAU COMPARATIF. Texte de la proposition de loi - 47 - TABLEAU COMPARATIF Proposition de loi tendant à assurer une plus grande équité dans notre politique de sécurité routière, notamment en matière de retrait des points du permis de conduire Article

Plus en détail

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1

Version FINALE. 28 Avril 2008. Guide de recouvrement des impôts fonciers pour les Communes rurales de deuxième catégorie 1 Relance de la Fiscalité Foncière Guide du Recouvrement Communes rurales de deuxième catégorie ANNEXES Version FINALE 28 Avril 2008 Guide de recouvrement des impôts fonciers pour les Communes rurales de

Plus en détail

Nouvelle usine, dernière ligne droite

Nouvelle usine, dernière ligne droite ANNEE 2 NUMERO 4 GRATUIT AVRIL 2014 Nouvelle usine, dernière ligne droite Connaissance sur l HACCP NY FISONDROTAN FISONDROTAN--TOERANA ANATINY AMELIORER LE PRESENT PREPARER L AVENIR L édito T aorian ny

Plus en détail

REPOBLIKAN i MADAGASIKARA

REPOBLIKAN i MADAGASIKARA REPOBLIKAN i MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana --------------------- PRESIDENCE DE LA REPUBLIQUE LOI N 2007-036 DU 14 JANVIER 2008 sur les Investissements à Madagascar EXPOSE DES MOTIFS

Plus en détail

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA

NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA Together, build a brighter future.?????? NY TAMBERIN ANDRAIKITRA AO ANATIN NY FANONTANIANA 10 1 Inona no atao hoe Tamberin andraikitra? Nahoana no manan-danja izy io? Ny tamberin andraikitra dia azo faritana

Plus en détail

Retour au menu MinJustice

Retour au menu MinJustice Retour au menu MinJustice TABLE DES MATIERES Pages LIVRE I : LES ARTISANS I.1. LOI N 95-004 du 21 juin 1995 4 relative à l artisanat I.2. DECRET N 98-166 du 19 février 1998 8 portant organisation de l

Plus en détail

DOSSIER DE PRESSE. Opération de contrôle «Les fautes de comportement au volant»

DOSSIER DE PRESSE. Opération de contrôle «Les fautes de comportement au volant» Service départemental de communication interministérielle de la Corrèze Tulle, 5 septembre 2014 DOSSIER DE PRESSE Opération de contrôle «Les fautes de comportement au volant» Vendredi 5 septembre 2014

Plus en détail

mensuel d informations régionales 9è édition - Août 2011

mensuel d informations régionales 9è édition - Août 2011 masolavitra mensuel d informations régionales 9è édition - Août 2011 gratuit Sommaire page 2-3 : Prix de l Entrepreneur Social page 4 : Pour le développement de la région Haute-Matsiatra [Idees Vozama]

Plus en détail

Les infractions : Les contraventions de classe 4:

Les infractions : Les contraventions de classe 4: Les infractions : Les contraventions de classe 4: Non-respect du feu rouge Non-respect du stop Non respect de la priorité Circulation en sens interdit Marche arrière ou demi-tour sur autoroute Circulation

Plus en détail

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA

ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA ONIVERSITEN ANTANANARIVO FAKIOLTEN NY TENY AMAN-TSORATRA ARY NY SIANTSAN NY MAHAOLONA Sampana Vinanin-taranja Manofana Aman asa Sampana Serasera Tatitrynyfizarana asa mikasikanyfitantananasyfampandrosoanamaharitrany

Plus en détail

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014

FTTAIYANA AI{':NSORAIRA NT trryorua}ibe TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 TIONALE REPOBLIKA FAHAEFATRA FEPOTOANA FANAOVAN.DALANA VOALOHANY FOTOAM-PIVORIANA MANOKANA TAONA 2014 DIRECTION DE LA LEGISLATION SERVICE DES PROCES-VERBAUX EÏ DES COMPTES-RENDUS ANALYTIQUES FTTAIYANA

Plus en détail

NY FIRAISANKINA NO HERY

NY FIRAISANKINA NO HERY ANNEE 3 NUMERO 10 GRATUIT OCTOBRE 2015 NY FIRAISANKINA NO HERY LES BONNES PRATIQUES D HYGIENE LA RELANCE DU KAOATRY L édito Ny tsy fihatsaran ny tontolo ara-pahasalamana misy eto amin ny firenena no mitarika

Plus en détail

PROJET DE LOI N 014/2013

PROJET DE LOI N 014/2013 PRESIDENCE DE LA TRANSITION PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES POUR 2014 IMPRIMERIE NATIONALE 2013 1 PROJET DE LOI N 014/2013 DU 23 OCTOBRE 2013 PORTANT LOI DE FINANCES

Plus en détail

MÉMO SÉCURITÉ LES 1 ERS SECOURS DANS L ENTREPRISE ENTREPRISES ARTISANALES DU BTP

MÉMO SÉCURITÉ LES 1 ERS SECOURS DANS L ENTREPRISE ENTREPRISES ARTISANALES DU BTP MÉMO SÉCURITÉ ENTREPRISES ARTISANALES DU BTP LES 1 ERS SECOURS DANS L ENTREPRISE Les premiers instants qui suivent un accident sont décisifs et des gestes simples peuvent parfois sauver une vie. Dans votre

Plus en détail

Serment des Apothicaires

Serment des Apothicaires ORDRE DES PHARMACIENS DE MADAGASCAR CODE DE DEONTOLOGIE DES PHARMACIENS JANVIER 2010 Serment des Apothicaires Je jure en présence de Maîtres de la Faculté des Conseillers de l Ordre des Pharmaciens et

Plus en détail

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA

E1 403 VOL. 1 JIRO SY RANO MALAGASY REPOBLIKAN'I MADAGASIKARA JIRAMA Public Disclosure Authorized a REPOBLIKAN'I MADAGASIKARA Tanindrazana - Fahafahana - Fandrosoana JIRAMA JIRO SY RANO MALAGASY E1 403 VOL. 1 Public Disclosure Authorized Public Disclosure Authorized ÉVALUATION

Plus en détail

RÈGLEMENT SUR LA CIRCULATION ET LE STATIONNEMENT

RÈGLEMENT SUR LA CIRCULATION ET LE STATIONNEMENT VU, notamment, les articles 62, 66, 67 et 79 à 81 de la Loi sur les compétences municipales (L.R.Q., chapitre C-47.1); VU les articles 295 et 626 du Code de la sécurité routière (L.R.Q., chapitre C-24.2);

Plus en détail

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique

Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis (scope and sequence) des émissions radiophoniques interactives pour le CP1 Ministère de l Éducation Nationale et de la Recherche Scientifique Synopsis du contenu (les savoirs) des émissions du

Plus en détail

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ;

EXPOSE DES MOTIFS. Uniformisation du taux du Droit de Douane sur les machines et appareils ; A- SUR LE CODE DES DOUANES EXPOSE DES MOTIFS Dans le cadre des réformes législatives initiées pour la Loi des Finances 11, l Administration des douanes a déterminé deux axes stratégiques pour faire face

Plus en détail

UN BON COMPORTEMENT. Anticiper sur les éventuels dangers : ouverture de portière, traversée des piétons, véhicule changeant de file.

UN BON COMPORTEMENT. Anticiper sur les éventuels dangers : ouverture de portière, traversée des piétons, véhicule changeant de file. UN BON COMPORTEMENT Respecter le Code de la route. - Je m arrête au Stop, aux feux jaune et rouge fixe et rouge clignotant. - J utilise le sas cycliste lorsqu il existe. - Je respecte le sens interdit.

Plus en détail

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.

Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere. Ecole Hôtelière LA RIZIERE Collège Saint François- Xavier B.P. 1032 - Antady, Fianarantsoa (301) Tél. 020.75.502 15 info@lariziere.org TAOM- PIANARANA 2015/2017 - - - - - - - - - - - - - - - - - - - -

Plus en détail

Règles de circulation à Vélo

Règles de circulation à Vélo Règles de circulation à Vélo circulation sur les trottoirs : les véhicules doivent, sauf en cas de nécessité absolue, circuler sur la chaussée ; toutefois, ils peuvent franchir un trottoir, à partir de

Plus en détail

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY

UN VECTEUR D AVENIR LE LAIT VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY ANNEE 2 NUMERO 5 GRATUIT JUIN 2014 VITA NY FANAVAOZANA SY NY FANATSARANA LA CHARTE INFORMATIQUE INTERVIEW RAMANANTSOA EPI PLUS BESARETY LE LAIT UN VECTEUR D AVENIR L édito Ny ronono, tsilo mpitondra amin

Plus en détail

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo

FIVORIAMBE. MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo 1 FIVORIAMBE FILOHA: RAKOTOMAMONJY Jean Max MPITANTSORATRA: - Ramatoa RAZAFIMANANTSOA Lobo Hanitriniaina - Andriamatoa ANDRIANARIVO Harimampianina Razakarivelo FOTOANA: Zoma 3 Jolay 2015, tamin ny 5 ora

Plus en détail

Liste des délits et infractions Les plus importants : A apprendre!!

Liste des délits et infractions Les plus importants : A apprendre!! Liste des délits et infractions Les plus importants : A apprendre!! Les délits : Conduite en état d'ivresse manifeste ou sous l'empire d'un état alcoolique (>= 0.8 g/l de sang ou 0.4 mg/l d'air expiré)

Plus en détail

A m pifalianana tokoa no hanoloranay anareo ny

A m pifalianana tokoa no hanoloranay anareo ny N L A V O I X D E S (R I Z I) P I S C I C U L T E U R Aogositra 2004 n 0 Isaky ny roa volana Y F E O N N Y M P I O M P Y T R O N D R O A P D R A - F / I R E D E C MADAGASIKARA SASINTENY A m pifalianana

Plus en détail

De la ferme à l usine

De la ferme à l usine ANNEE 1 NUMERO 1 GRATUIT JUIN 2013 Vers la certification HACCP : un facteur clé pour le succès de SOCOLAIT Ny soatoavina maha SOCOLAIT Socolait mamorona hatrany De nouveaux produits arrivent De la ferme

Plus en détail

ARRÊTÉ MUNICIPAL portant RÈGLEMENT INTÉRIEUR du PARKING SOUTERRAIN de l HÔTEL de VILLE

ARRÊTÉ MUNICIPAL portant RÈGLEMENT INTÉRIEUR du PARKING SOUTERRAIN de l HÔTEL de VILLE ARRÊTÉ MUNICIPAL portant RÈGLEMENT INTÉRIEUR du PARKING SOUTERRAIN de l HÔTEL de VILLE Le Maire de la Ville d ELNE, VU les dispositions du Code Général des Collectivité locales, CONSIDERANT la nécessité

Plus en détail

Suspension 3 ans (sans sursis) Annulation 3 ans. 6 Suspension 3 ans - Annulation 3 ans. 6 Suspension 3 ans. 6 Suspension 3 ans - Annulation 3 ans

Suspension 3 ans (sans sursis) Annulation 3 ans. 6 Suspension 3 ans - Annulation 3 ans. 6 Suspension 3 ans. 6 Suspension 3 ans - Annulation 3 ans Conduite en état d'ivresse ou sous l'emprise d'un état alcoolique (de 0,8 g/l de sang ou 0,4 mg/l d'air expiré Refus de se soumettre au contrôle d'alcoolémie ou de produits stupéfiants. Conduite sous l'influence

Plus en détail

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung.

Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. Les idées et positions exprimées dans cette publication ne reflètent pas nécessairement les opinions de la Friedrich-Ebert-Stiftung. LOHARANON ANGOVO MAHARITRA ho an ny isan-tokan-trano, ny vondrombahoakam-paritra

Plus en détail

MAMPIANARA ANAY HIVAVAKA

MAMPIANARA ANAY HIVAVAKA MAMPIANARA ANAY HIVAVAKA Folo Andro Manova Fiainana Ao Amin ny Vavaky Ny Tompo Tonga soa amin ny Folo Androm-bavaka 2014! Andriamanitra dia naneho fahagagana an arivony tamin ny alalan ny fandaharana Folo

Plus en détail

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015

ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 IMPRIMERIE NATIONALE 2014 1 LOI N 2014-030 PORTANT LOI DE FINANCES POUR 2015 2 ASSEMBLEE NATIONALE LOI N 2014-030 PORTANT LOI DE FINANCES

Plus en détail

Démocratie et justice sociale SOMMAIRE

Démocratie et justice sociale SOMMAIRE Démocratie et justice sociale N 03-1 er trimestre 2010 SOMMAIRE La démocratie malgache : entre farce et sérieux La démocratie malgache P - 2 Créons tout simplement! P - 2 Tableau de Science Politique P

Plus en détail

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011

LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES POUR 2011 IMPRIMERIE NATIONALE 2010 PRESIDENCE DE LA HAUTE AUTORITE DE LA TRANSITION LOI N 2010-001 DU 22 DECEMBRE 2010 PORTANT LOI DE FINANCES

Plus en détail

PARTIE 1: PERMIS DE CONDUIRE 9 1.1 Types de permis 10 Classe 2 10. Classe 3 11 Classe 5 12

PARTIE 1: PERMIS DE CONDUIRE 9 1.1 Types de permis 10 Classe 2 10. Classe 3 11 Classe 5 12 PARTIE 1: PERMIS DE CONDUIRE 9 1.1 Types de permis 10 Classe 1 10 Classe 2 10. Classe 3 11 Classe 4 12 Classe 5 12 Classe 6 13 Classe 7 Permis progressif (Niveau I et II) 13 Classe 8 14 Classe 9 15 1.2

Plus en détail

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA

BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA BOKY MIRAKITRA NY ZO SY ADIDIN NY MPIASA MPILA RAVIN AHITRA ETO LIBANONA Adidiko ny mahafantatra ireo Zoko MADAGASCAR Faly izahay fa mamaky ity boky ity ianao. Mikasika ny Zo sy ny Andraikitr ireo mpifindramonina

Plus en détail

480 tests. Code de la route. Codoroute - Tendance & Repères. Jean-Luc Millard. Groupe Eyrolles 2005, ISBN 2-212-11664-0

480 tests. Code de la route. Codoroute - Tendance & Repères. Jean-Luc Millard. Groupe Eyrolles 2005, ISBN 2-212-11664-0 480 tests Code de la route Jean-Luc Millard Groupe Eyrolles 2005, ISBN 2-212-11664-0 Codoroute - Tendance & Repères S é r i e N 1 À la sortie de ce carrefour, je vais emprunter la rue la plus à gauche,

Plus en détail

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992.

~m II11 E 7 7 C - Date Printed: 02/05/2009. JTS Box Number:. IFES 46. Tab Number: 34. Document Title: Document Date: 1992. Date Printed: 02/05/2009 JTS Box Number:. IFES 46 Tab Number: 34 Document Title: LAW ON CONSTITUTIONAL REFERENDUM Document Date: 1992 Document Country: Document Language: IFES ID: MLA-FRE EL00634 ~m II11

Plus en détail

ATRIKA Le journal de l ASMF

ATRIKA Le journal de l ASMF Association des Anciens du Collège St-Michel en France ATRIKA Le journal de l ASMF OCTOBRE 2010 ÉDITION : Octobre 2010, NUMÉRO 12 Éditorial 2010 ASMF bureau 2009/2010 Joël Rambatomanga(1990) Président

Plus en détail

FICHE TECHNIQUE 1/ LA VILLE DE MONTRÉAL EST FAVORABLE AUX MESURES SUIVANTES : COMMENTAIRES ET POSITIONNEMENT DE LA VILLE DE MONTRÉAL

FICHE TECHNIQUE 1/ LA VILLE DE MONTRÉAL EST FAVORABLE AUX MESURES SUIVANTES : COMMENTAIRES ET POSITIONNEMENT DE LA VILLE DE MONTRÉAL FICHE TECHNIQUE POSITION DE LA VILLE DE MONTRÉAL DANS LE CADRE DE LA MODERNISATION DU CODE DE LA SÉCURITÉ ROUTIÈRE AFIN D AMÉLIORER LA SÉCURITÉ DES CYCLISTES 21 septembre 2015 1/ LA VILLE DE MONTRÉAL EST

Plus en détail

CARNET POUR ELEVES ET ACCOMPAGNATEURS. EN A.A.C et C.S. ETATS-UNIS CONDUITE 31200 TOULOUSE. Secourir Si vous n êtes pas secouriste, il faut éviter :

CARNET POUR ELEVES ET ACCOMPAGNATEURS. EN A.A.C et C.S. ETATS-UNIS CONDUITE 31200 TOULOUSE. Secourir Si vous n êtes pas secouriste, il faut éviter : CARNET POUR ELEVES ET ACCOMPAGNATEURS EN A.A.C et C.S. 15 : SAMU ou SMUR 17 : POLICE ou GENDAMERIE 18 : POMPIERS 112 : NUMERO UNIQUE A PARTIR D UN PORTABLE Secourir Si vous n êtes pas secouriste, il faut

Plus en détail

CHARTE DE L AUTOMOBILISTE

CHARTE DE L AUTOMOBILISTE CHARTE DE L AUTOMOBILISTE CHARTE DE L AUTOMOBILISTE A travers cette charte, nous voulons rappeler le bon comportement de l automobiliste pour permettre le mieux vivre des gens et la sécurité de tous. Nous

Plus en détail

LANY TAMINGANA ETO AMINTSIKA

LANY TAMINGANA ETO AMINTSIKA cyan magenta jaune noir GTT-FRANCE UN PUTSCH EN VUE Un projet de coup d Etat contre GRATUIT VOAHARY KARAZANY MARO NO AHIANA HO LANY TAMINGANA ETO AMINTSIKA L accès sans peine à l information QUOTIDIEN

Plus en détail

REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana -------------

REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana ------------- REPOBLIKAN I MADAGASIKARA Tanindrazana-Fahafahana-Fandrosoana ------------- MINISTERE DE L ECONOMIE, DES FINANCES ET DU BUDGET --------- ARRETE N 12590/06- MEFB/SG/DGT/DOF/ASS portant application du Décret

Plus en détail

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet:

Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Randriamiharisoa Alex De: randriamihaja josefa [r_josefa@yahoo.fr] Envoyé: jeudi, 1. octobre 2009 16:03 À: AZ Cc: Tehindrazanarivelo Liva; Mamy Aimanantsoa; Toky Rabemanantsoa; Alex Objet: Tr : DEVIS ET

Plus en détail

Propositions de Vélo Québec pour réhabiliter le Code de la sécurité routière en faveur de la mobilité durable. [Version condensée]

Propositions de Vélo Québec pour réhabiliter le Code de la sécurité routière en faveur de la mobilité durable. [Version condensée] Propositions de Vélo Québec pour réhabiliter le Code de la sécurité routière en faveur de la mobilité durable [Version condensée] 14 août 2014 NOTRE VISION : UNE CIRCULATION SÉCURITAIRE POUR TOUS Depuis

Plus en détail

Collision n 1 : le croisement de droite

Collision n 1 : le croisement de droite 1 SECURITE des CYCLISTES : (SUR) VIVRE AVEC ET MALGRE LES AUTRES VEHICULES Au-delà des simples consignes habituelles, respecter le code de la route et porter un casque. Le texte qui suit montre de façon

Plus en détail

voly vary maro anaka système de riziculture intensive

voly vary maro anaka système de riziculture intensive voly vary maro anaka système de riziculture intensive tantara an-tsary ny voka-pikarohana lehibe sady mahagaga malagasy histoire toute simple d une très grande découverte malgache Henri de Laulanie de

Plus en détail

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent

GRATUIT. 250.000 litres de jus l Espace de Concertation veulent cyan magenta jaune noir PROGRAMME P.7 RENCONTRE DE VONTOVORONA POSSIBLE ECHEC Les partis et associations de GRATUIT QUOTIDIEN D INFORMATION N 0137 DU Mercredi 25 Août 2010 FIARAHAMONINA HADIHADIANA NY

Plus en détail

22. - PRIORITÉ TRAIN TRAM AUTOBUS

22. - PRIORITÉ TRAIN TRAM AUTOBUS 22. - PRIORITÉ TRAIN TRAM AUTOBUS TRAIN 1. Généralités. Un train circule sur des voies ferrées ou rails. Sa distance d arrêt est très longue et il lui est impossible de dévier sa trajectoire. C est pourquoi

Plus en détail

PRESIDENCE DE LA TRANSITION

PRESIDENCE DE LA TRANSITION PRESIDENCE DE LA TRANSITION LOI N 2012-021 PORTANT LOI DE FINANCES POUR 2013 IMPRIMERIE NATIONALE 2012 1 LOI N 2012-021 DU 17 DECEMBRE 2012 PORTANT LOI DE FINANCES POUR 2013 2 PRESIDENCE DE LA TRANSITION

Plus en détail

En cas d urgence. Selon la Croix Rouge, voici les différents gestes à faire en cas d urgence

En cas d urgence. Selon la Croix Rouge, voici les différents gestes à faire en cas d urgence 1 En cas d urgence Selon la Croix Rouge, voici les différents gestes à faire en cas d urgence Quel que soit la situation d urgence _ Sécurisez le lieu de l accident ainsi que la victime. Vérifiez qu il

Plus en détail

Liste des délits et infractions au code de la route.

Liste des délits et infractions au code de la route. Liste des délits et infractions au code de la route. Délits Conduite en état d'ivresse manifeste ou sous l'empire d'un état alcoolique (>= 0.8 g/l de sang ou 0.4 mg/l d'air expiré) CR: code de la route,

Plus en détail

LIVRET. La prévention des risques routiers professionnels pour les dirigeants des PME-TPE

LIVRET. La prévention des risques routiers professionnels pour les dirigeants des PME-TPE LIVRET La prévention des risques routiers professionnels pour les dirigeants des PME-TPE Club Entreprises Sécurité routière du Rhône Mail : contact@clubesr69.fr www.clubesr69.com FICHE 1 ASPECTS HUMAINS

Plus en détail

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES

INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES INONA MARINA NY ATAO HOE THEOREME DES VALEURS INTERMEDIAIRES Par Tsira Louis Venceslas Dernière mise à jour : 31/12/2015 Sommaire I. Ahoana marina ny ahatakarana ny logique momba an io TVI io?... 3 Théorème...

Plus en détail

L ASSR. Le BSR. Les accidents de la route

L ASSR. Le BSR. Les accidents de la route L ASSR L'ASSR de premier niveau est obligatoire pour pouvoir conduire un cyclomoteur. Pour conduire un cyclomoteur, il faut en effet avoir quatorze ans et posséder le brevet de sécurité routière (BSR).

Plus en détail

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37

TAHIRY. Tahirimbolam-panjakana tany. Matoan-dahatsoratra SOMMAIRE. Numéro 37 TAHIRY S e r a s e r a n n y T a h i r i m b o l a m - p a n j a k a n a Bulletin mensuel d information et de liaison de la Direction Générale du Trésor Andry RAKOTOARIDERA Trésorier Général Tsiroanomandidy

Plus en détail

TATITRA KOMITY PARITANY FAHA ROA

TATITRA KOMITY PARITANY FAHA ROA TATITRA KOMITY PARITANY FAHA ROA 0 Septambra 20 TOURS - FANOKAFANA : Fiarahabana sy Fanompoam-pivavahana :Pst Rasoanirina Raharinoro Salamo 9: 45-52 Hira : 2 Vavaka Teny sitrapon'andriamanitra Vavaka Fifonana

Plus en détail

CONDUCTEURS. de véhicules lourds. Connaissez-vous vos OBLIGATIONS?

CONDUCTEURS. de véhicules lourds. Connaissez-vous vos OBLIGATIONS? CONDUCTEURS de véhicules lourds Connaissez-vous vos OBLIGATIONS? 01 Lisez bien ce qui suit si >vous prenez la route avec: Un véhicule routier dont la masse nette est de plus de 3 000 kg : >> un autobus;

Plus en détail

INTERROGATION ORALE PERMIS B VERIFICATIONS INTERIEURES DU VEHICULE SEAT IBIZA

INTERROGATION ORALE PERMIS B VERIFICATIONS INTERIEURES DU VEHICULE SEAT IBIZA INTERROGATION ORALE PERMIS B VERIFICATIONS INTERIEURES DU VEHICULE SEAT IBIZA Vérifications intérieures du véhicule 01/67. Effectuez un appel lumineux. Mettez le contact. Utilisez la commande de gauche

Plus en détail

MINISTÈRE DE L ÉCOLOGIE, DU DÉVELOPPEMENT DURABLE ET DE L ÉNERGIE DOSSIER DE PRESSE

MINISTÈRE DE L ÉCOLOGIE, DU DÉVELOPPEMENT DURABLE ET DE L ÉNERGIE DOSSIER DE PRESSE MINISTÈRE DE L ÉCOLOGIE, DU DÉVELOPPEMENT DURABLE ET DE L ÉNERGIE DOSSIER DE PRESSE Campagne de sensibilisation sur la sécurité des personnels aux abords des chantiers routiers Du 18 au 22 juin 2012 DIR

Plus en détail

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant

Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Ao Analyse de quelques occurrences issues d un corpus oral (dialecte betsileo) Quelques pistes pour l apprenant Préambule Locutrice non native du malgache Présentations traditionnelles de ao Sens et le

Plus en détail

Le transport scolaire, responsabilité partagée

Le transport scolaire, responsabilité partagée Le transport scolaire, une responsabilité partagée Par les citoyens Avec plus de 10 000 véhicules, près de 563 000 élèves transportés et un million de kilomètres parcourus chaque jour, le transport scolaire

Plus en détail

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires

masolavitra Sommaire gratuit P 2-3 : News de nos partenaires P 4-5 : Témoignages de nos partenaires masolavitra mensuel d informations régionales Numéro15 - Février 2012 gratuit Bonjour! Nous partageons avec vous dans cette édition, quelques unes des nouvelles qui nous parviennent des organisations que

Plus en détail